CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP013082	Bordetella pertussis strain H382 chromosome, complete genome	4 crisprs	csa3,cas3,DinG,DEDDh	0	0	32	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP013082_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013082_1

250591-250675

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013082_1

>merge|NZ_CP013082|1|250591-250675|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>NZ_CP013082|1|1|250591-250675|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013082.1\|WP_003814339.1\|249530_250580_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
NZ_CP013082.1\|WP_010929708.1\|257792_258773_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP013082.1\|WP_010929704.1\|248576_249278_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
NZ_CP013082.1\|WP_010929701.1\|246037_246529_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
NZ_CP013082.1\|WP_003814356.1\|240335_241379_-\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
NZ_CP013082.1\|WP_010929703.1\|247881_248580_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP013082.1\|WP_003814324.1\|258908_259892_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295
NZ_CP013082.1\|WP_010929706.1\|255696_256233_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
NZ_CP013082.1\|WP_010929709.1\|259956_260856_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
NZ_CP013082.1\|WP_010929702.1\|246525_247881_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
NZ_CP013082.1\|WP_003814363.1\|238116_238527_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|131478
NZ_CP013082.1\|WP_003814351.1\|245062_246019_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP013082.1\|WP_010929707.1\|256384_257776_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
NZ_CP013082.1\|WP_010929705.1\|251623_253513_-\|DNA-mismatch-repair-endonuclease-MutL	unknown	unknown	gnl\|CDD\|234630
NZ_CP013082.1\|WP_003814332.1\|253599_254238_+\|VTT-domain-containing-protein	unknown	unknown	gnl\|CDD\|182775
NZ_CP013082.1\|WP_003814337.1\|250685_251627_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP013082.1\|WP_003814321.1\|260962_262717_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
NZ_CP013082.1\|WP_003814355.1\|241549_243652_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|129868
NZ_CP013082.1\|WP_003814358.1\|239548_240292_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP013082.1\|WP_019247543.1\|254380_255766_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376

Protein	Function_ID	Function_description	E-value
NZ_CP013082.1\|WP_003814339.1\|249530_250580_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP013082.1\|WP_010929708.1\|257792_258773_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
NZ_CP013082.1\|WP_010929704.1\|248576_249278_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
NZ_CP013082.1\|WP_010929701.1\|246037_246529_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
NZ_CP013082.1\|WP_003814356.1\|240335_241379_-\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
NZ_CP013082.1\|WP_010929703.1\|247881_248580_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
NZ_CP013082.1\|WP_003814324.1\|258908_259892_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
NZ_CP013082.1\|WP_010929706.1\|255696_256233_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
NZ_CP013082.1\|WP_010929709.1\|259956_260856_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
NZ_CP013082.1\|WP_010929702.1\|246525_247881_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
NZ_CP013082.1\|WP_003814363.1\|238116_238527_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
NZ_CP013082.1\|WP_003814351.1\|245062_246019_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
NZ_CP013082.1\|WP_010929707.1\|256384_257776_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
NZ_CP013082.1\|WP_010929705.1\|251623_253513_-\|DNA-mismatch-repair-endonuclease-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
NZ_CP013082.1\|WP_003814332.1\|253599_254238_+\|VTT-domain-containing-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
NZ_CP013082.1\|WP_003814337.1\|250685_251627_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
NZ_CP013082.1\|WP_003814321.1\|260962_262717_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
NZ_CP013082.1\|WP_003814355.1\|241549_243652_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
NZ_CP013082.1\|WP_003814358.1\|239548_240292_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
NZ_CP013082.1\|WP_019247543.1\|254380_255766_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	1.25625e-84

>NZ_CP013082.1|WP_003814339.1|249530_250580_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>NZ_CP013082.1|WP_010929704.1|248576_249278_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>NZ_CP013082.1|WP_010929703.1|247881_248580_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>NZ_CP013082.1|WP_010929702.1|246525_247881_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>NZ_CP013082.1|WP_010929701.1|246037_246529_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>NZ_CP013082.1|WP_003814351.1|245062_246019_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>NZ_CP013082.1|WP_003814355.1|241549_243652_+|TRAP-transporter-large-permease-subunit
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>NZ_CP013082.1|WP_003814356.1|240335_241379_-|TRAP-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>NZ_CP013082.1|WP_003814358.1|239548_240292_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>NZ_CP013082.1|WP_003814363.1|238116_238527_+|carboxymuconolactone-decarboxylase-family-protein
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>NZ_CP013082.1|WP_003814337.1|250685_251627_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>NZ_CP013082.1|WP_010929705.1|251623_253513_-|DNA-mismatch-repair-endonuclease-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>NZ_CP013082.1|WP_003814332.1|253599_254238_+|VTT-domain-containing-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>NZ_CP013082.1|WP_019247543.1|254380_255766_-|N-acetylmuramoyl-L-alanine-amidase
MVERDCPPAHGALSPRAAARRRLISVAATLLVLPVVPRLAHAATILAVRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>NZ_CP013082.1|WP_010929706.1|255696_256233_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>NZ_CP013082.1|WP_010929707.1|256384_257776_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>NZ_CP013082.1|WP_010929708.1|257792_258773_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>NZ_CP013082.1|WP_003814324.1|258908_259892_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>NZ_CP013082.1|WP_010929709.1|259956_260856_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>NZ_CP013082.1|WP_003814321.1|260962_262717_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013082_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013082_2

432034-432127

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP013082_2

>merge|NZ_CP013082|2|432034-432127|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>NZ_CP013082|2|2|432034-432127|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013082.1\|WP_010929785.1\|422321_423527_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
NZ_CP013082.1\|WP_003814720.1\|419373_420432_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP013082.1\|WP_003814726.1\|425050_426364_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_CP013082.1\|WP_003814730.1\|427143_427878_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
NZ_CP013082.1\|WP_003814691.1\|437985_439218_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP013082.1\|WP_003814728.1\|426554_426734_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
NZ_CP013082.1\|WP_022997984.1\|421148_422126_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP013082.1\|WP_019247421.1\|431404_431803_-\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|234569
NZ_CP013082.1\|WP_010929577.1\|430322_431273_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP013082.1\|WP_003814694.1\|437034_437790_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
NZ_CP013082.1\|WP_033446199.1\|420561_421056_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP013082.1\|WP_003814681.1\|441044_442022_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP013082.1\|WP_010929789.1\|436405_436924_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP013082.1\|WP_010929788.1\|433216_434617_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP013082.1\|WP_019247419.1\|442147_443320_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173841
NZ_CP013082.1\|WP_010929791.1\|439210_439996_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181723
NZ_CP013082.1\|WP_010929786.1\|423523_425035_+\|TAXI-family-TRAP-transporter-solute-binding-subunit	unknown	unknown	gnl\|CDD\|270238
NZ_CP013082.1\|WP_003814685.1\|440062_441034_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP013082.1\|WP_003814701.1\|432213_432684_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP013082.1\|WP_003820700.1\|432772_433117_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984

Protein	Function_ID	Function_description	E-value
NZ_CP013082.1\|WP_010929785.1\|422321_423527_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
NZ_CP013082.1\|WP_003814720.1\|419373_420432_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
NZ_CP013082.1\|WP_003814726.1\|425050_426364_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
NZ_CP013082.1\|WP_003814730.1\|427143_427878_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
NZ_CP013082.1\|WP_003814691.1\|437985_439218_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
NZ_CP013082.1\|WP_003814728.1\|426554_426734_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
NZ_CP013082.1\|WP_022997984.1\|421148_422126_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
NZ_CP013082.1\|WP_019247421.1\|431404_431803_-\|GTP-binding-protein	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
NZ_CP013082.1\|WP_010929577.1\|430322_431273_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
NZ_CP013082.1\|WP_003814694.1\|437034_437790_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
NZ_CP013082.1\|WP_033446199.1\|420561_421056_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
NZ_CP013082.1\|WP_003814681.1\|441044_442022_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
NZ_CP013082.1\|WP_010929789.1\|436405_436924_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
NZ_CP013082.1\|WP_010929788.1\|433216_434617_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
NZ_CP013082.1\|WP_019247419.1\|442147_443320_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
NZ_CP013082.1\|WP_010929791.1\|439210_439996_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
NZ_CP013082.1\|WP_010929786.1\|423523_425035_+\|TAXI-family-TRAP-transporter-solute-binding-subunit	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
NZ_CP013082.1\|WP_003814685.1\|440062_441034_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
NZ_CP013082.1\|WP_003814701.1\|432213_432684_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
NZ_CP013082.1\|WP_003820700.1\|432772_433117_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35

>NZ_CP013082.1|WP_019247421.1|431404_431803_-|GTP-binding-protein
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>NZ_CP013082.1|WP_010929577.1|430322_431273_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>NZ_CP013082.1|WP_003814730.1|427143_427878_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>NZ_CP013082.1|WP_003814728.1|426554_426734_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>NZ_CP013082.1|WP_003814726.1|425050_426364_-|short-chain-fatty-acid-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>NZ_CP013082.1|WP_010929786.1|423523_425035_+|TAXI-family-TRAP-transporter-solute-binding-subunit
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>NZ_CP013082.1|WP_010929785.1|422321_423527_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>NZ_CP013082.1|WP_022997984.1|421148_422126_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>NZ_CP013082.1|WP_033446199.1|420561_421056_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>NZ_CP013082.1|WP_003814720.1|419373_420432_-|glycosyltransferase-family-2-protein
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>NZ_CP013082.1|WP_003814701.1|432213_432684_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>NZ_CP013082.1|WP_003820700.1|432772_433117_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>NZ_CP013082.1|WP_010929788.1|433216_434617_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>NZ_CP013082.1|WP_010929789.1|436405_436924_-|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>NZ_CP013082.1|WP_003814694.1|437034_437790_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>NZ_CP013082.1|WP_003814691.1|437985_439218_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>NZ_CP013082.1|WP_010929791.1|439210_439996_+|crotonase/enoyl-CoA-hydratase-family-protein
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>NZ_CP013082.1|WP_003814685.1|440062_441034_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>NZ_CP013082.1|WP_003814681.1|441044_442022_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>NZ_CP013082.1|WP_019247419.1|442147_443320_+|acyl-CoA-dehydrogenase-family-protein
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013082_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013082_3

996352-996446

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013082_3

>merge|NZ_CP013082|3|996352-996446|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>NZ_CP013082|3|3|996352-996446|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013082.1\|WP_003813314.1\|996495_997221_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP013082.1\|WP_010930113.1\|990514_991423_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP013082.1\|WP_010926548.1\|1002083_1002656_-\|chorismate-lyase	unknown	unknown	gnl\|CDD\|225703
NZ_CP013082.1\|WP_023852686.1\|994338_994719_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP013082.1\|WP_010930123.1\|1009851_1010103_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP013082.1\|WP_010930112.1\|988652_989717_+\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
NZ_CP013082.1\|WP_003821527.1\|983041_984868_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP013082.1\|WP_005012067.1\|997316_998267_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP013082.1\|WP_014905652.1\|994726_995599_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|274527
NZ_CP013082.1\|WP_010929632.1\|999558_1000575_-\|IS110-like-element-IS1663-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP013082.1\|WP_014486063.1\|1008399_1009782_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP013082.1\|WP_170954292.1\|985814_986816_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
NZ_CP013082.1\|WP_023852693.1\|992910_994185_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP013082.1\|WP_010930118.1\|998371_999421_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
NZ_CP013082.1\|WP_010930111.1\|981868_982798_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
NZ_CP013082.1\|WP_003813315.1\|995904_996285_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
NZ_CP013082.1\|WP_010930121.1\|1005223_1008403_+\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
NZ_CP013082.1\|WP_029443805.1\|1003498_1004416_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP013082.1\|WP_003813333.1\|984950_985592_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
NZ_CP013082.1\|WP_010930119.1\|1002715_1003447_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108

Protein	Function_ID	Function_description	E-value
NZ_CP013082.1\|WP_003813314.1\|996495_997221_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
NZ_CP013082.1\|WP_010930112.1\|988652_989717_+\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
NZ_CP013082.1\|WP_010926548.1\|1002083_1002656_-\|chorismate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
NZ_CP013082.1\|WP_010930118.1\|998371_999421_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
NZ_CP013082.1\|WP_010930123.1\|1009851_1010103_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
NZ_CP013082.1\|WP_010930113.1\|990514_991423_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP013082.1\|WP_003821527.1\|983041_984868_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
NZ_CP013082.1\|WP_005012067.1\|997316_998267_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
NZ_CP013082.1\|WP_014905652.1\|994726_995599_-\|EamA-family-transporter	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
NZ_CP013082.1\|WP_010929632.1\|999558_1000575_-\|IS110-like-element-IS1663-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23
NZ_CP013082.1\|WP_014486063.1\|1008399_1009782_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
NZ_CP013082.1\|WP_170954292.1\|985814_986816_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
NZ_CP013082.1\|WP_023852693.1\|992910_994185_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
NZ_CP013082.1\|WP_010930111.1\|981868_982798_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
NZ_CP013082.1\|WP_003813315.1\|995904_996285_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
NZ_CP013082.1\|WP_010930121.1\|1005223_1008403_+\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP013082.1\|WP_029443805.1\|1003498_1004416_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
NZ_CP013082.1\|WP_003813333.1\|984950_985592_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132
NZ_CP013082.1\|WP_010930119.1\|1002715_1003447_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72

>NZ_CP013082.1|WP_003813315.1|995904_996285_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>NZ_CP013082.1|WP_014905652.1|994726_995599_-|EamA-family-transporter
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>NZ_CP013082.1|WP_023852686.1|994338_994719_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>NZ_CP013082.1|WP_023852693.1|992910_994185_+|PA0069-family-radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>NZ_CP013082.1|WP_010930113.1|990514_991423_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>NZ_CP013082.1|WP_010930112.1|988652_989717_+|sulfate-ABC-transporter-ATP-binding-protein
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>NZ_CP013082.1|WP_170954292.1|985814_986816_+|sulfate-ABC-transporter-substrate-binding-protein
MVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>NZ_CP013082.1|WP_003813333.1|984950_985592_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>NZ_CP013082.1|WP_003821527.1|983041_984868_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>NZ_CP013082.1|WP_010930111.1|981868_982798_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>NZ_CP013082.1|WP_003813314.1|996495_997221_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>NZ_CP013082.1|WP_005012067.1|997316_998267_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>NZ_CP013082.1|WP_010930118.1|998371_999421_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>NZ_CP013082.1|WP_010929632.1|999558_1000575_-|IS110-like-element-IS1663-family-transposase
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>NZ_CP013082.1|WP_010926548.1|1002083_1002656_-|chorismate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>NZ_CP013082.1|WP_010930119.1|1002715_1003447_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>NZ_CP013082.1|WP_029443805.1|1003498_1004416_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>NZ_CP013082.1|WP_010930121.1|1005223_1008403_+|efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>NZ_CP013082.1|WP_014486063.1|1008399_1009782_+|efflux-transporter-outer-membrane-subunit
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>NZ_CP013082.1|WP_010930123.1|1009851_1010103_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP013082_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP013082_4

3432499-3432608

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP013082_4

>merge|NZ_CP013082|4|3432499-3432608|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>NZ_CP013082|4|4|3432499-3432608|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP013082.1\|WP_003814239.1\|3437346_3438048_+\|response-regulator	unknown	unknown	gnl\|CDD\|181883
NZ_CP013082.1\|WP_003820957.1\|3441997_3443761_+\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	unknown	unknown	gnl\|CDD\|235424
NZ_CP013082.1\|WP_010931357.1\|3433139_3433820_+\|tellurite-resistance-TerB-family-protein	unknown	unknown	gnl\|CDD\|377342
NZ_CP013082.1\|WP_019247959.1\|3419165_3422144_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
NZ_CP013082.1\|WP_010931353.1\|3416776_3417865_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187652
NZ_CP013082.1\|WP_005013747.1\|3425897_3426848_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP013082.1\|WP_010930179.1\|3434891_3435842_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP013082.1\|WP_010927090.1\|3428145_3428946_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
NZ_CP013082.1\|WP_003814739.1\|3430460_3431246_+\|enoyl-ACP-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
NZ_CP013082.1\|WP_023994844.1\|3433824_3434796_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP013082.1\|WP_010931361.1\|3440541_3441882_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP013082.1\|WP_003814250.1\|3444863_3445679_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
NZ_CP013082.1\|WP_010931355.1\|3427354_3428125_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP013082.1\|WP_010931070.1\|3417861_3418812_-\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP013082.1\|WP_003818344.1\|3423070_3423949_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
NZ_CP013082.1\|WP_010931362.1\|3443872_3444751_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
NZ_CP013082.1\|WP_010927010.1\|3438047_3439472_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP013082.1\|WP_010931354.1\|3426844_3427312_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
NZ_CP013082.1\|WP_003814742.1\|3432609_3433002_-\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679
NZ_CP013082.1\|WP_010931356.1\|3428956_3430366_+\|transglycosylase-SLT-domain-containing-protein	unknown	unknown	gnl\|CDD\|182727

Protein	Function_ID	Function_description	E-value
NZ_CP013082.1\|WP_003814239.1\|3437346_3438048_+\|response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
NZ_CP013082.1\|WP_003820957.1\|3441997_3443761_+\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
NZ_CP013082.1\|WP_010931357.1\|3433139_3433820_+\|tellurite-resistance-TerB-family-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
NZ_CP013082.1\|WP_019247959.1\|3419165_3422144_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
NZ_CP013082.1\|WP_010931353.1\|3416776_3417865_+\|NAD(P)H-binding-protein	gnl\|CDD\|187652	cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs. 5beta-POR catalyzes the reduction of progesterone to 5beta-pregnane-3,20-dione in Digitalis plants. This subgroup of atypical-extended SDRs, shares the structure of an extended SDR, but has a different glycine-rich nucleotide binding motif (GXXGXXG) and lacks the YXXXK active site motif of classical and extended SDRs. Tyr-179 and Lys 147 are present in the active site, but not in the usual SDR configuration. Given these differences, it has been proposed that this subfamily represents a new SDR class. Other atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.76863e-97
NZ_CP013082.1\|WP_005013747.1\|3425897_3426848_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
NZ_CP013082.1\|WP_010930179.1\|3434891_3435842_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
NZ_CP013082.1\|WP_010927090.1\|3428145_3428946_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
NZ_CP013082.1\|WP_003814739.1\|3430460_3431246_+\|enoyl-ACP-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
NZ_CP013082.1\|WP_023994844.1\|3433824_3434796_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.71001e-129
NZ_CP013082.1\|WP_010931361.1\|3440541_3441882_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
NZ_CP013082.1\|WP_003814250.1\|3444863_3445679_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
NZ_CP013082.1\|WP_010931355.1\|3427354_3428125_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
NZ_CP013082.1\|WP_010931070.1\|3417861_3418812_-\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.27808e-22
NZ_CP013082.1\|WP_003818344.1\|3423070_3423949_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
NZ_CP013082.1\|WP_010931362.1\|3443872_3444751_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
NZ_CP013082.1\|WP_010927010.1\|3438047_3439472_+\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
NZ_CP013082.1\|WP_010931354.1\|3426844_3427312_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
NZ_CP013082.1\|WP_003814742.1\|3432609_3433002_-\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
NZ_CP013082.1\|WP_010931356.1\|3428956_3430366_+\|transglycosylase-SLT-domain-containing-protein	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76

>NZ_CP013082.1|WP_003814739.1|3430460_3431246_+|enoyl-ACP-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>NZ_CP013082.1|WP_010931356.1|3428956_3430366_+|transglycosylase-SLT-domain-containing-protein
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>NZ_CP013082.1|WP_010927090.1|3428145_3428946_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>NZ_CP013082.1|WP_010931355.1|3427354_3428125_-|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>NZ_CP013082.1|WP_010931354.1|3426844_3427312_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>NZ_CP013082.1|WP_005013747.1|3425897_3426848_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>NZ_CP013082.1|WP_003818344.1|3423070_3423949_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>NZ_CP013082.1|WP_019247959.1|3419165_3422144_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>NZ_CP013082.1|WP_010931070.1|3417861_3418812_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>NZ_CP013082.1|WP_010931353.1|3416776_3417865_+|NAD(P)H-binding-protein
MTGSTAGKVLVVGALGVVGRAALEHFGQRPGLARVGLSRHAPDFAPEASWVSADLRDAQATRAALAAHGDATHVVYAALNEQPDLLKGWRDSGNVDLNTGMLRNTLDALREAPLRHVTLLQGTKAYGVHTGRPMPVPARETDAVRDHANFYFDQQDLLAERAAAQGFGWTIFRPQIVLGVALGSAMNPVATLGAYAALSREAGQPLRYPGHPHLLTECTDARLIARAIAWAWDEPRAHGEAFNIANGDVVLWQPVFERLAALFGMPLGEPVDTRMREAMPQLAERWRAIAERERLAVPELRDLIGLSWQYADATWAARHPLPVPPLVSTIKLRQAGFGDCIDTQDCIVEHLREMQRLRYLPR
>NZ_CP013082.1|WP_003814742.1|3432609_3433002_-|OsmC-family-protein
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>NZ_CP013082.1|WP_010931357.1|3433139_3433820_+|tellurite-resistance-TerB-family-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>NZ_CP013082.1|WP_023994844.1|3433824_3434796_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>NZ_CP013082.1|WP_010930179.1|3434891_3435842_-|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>NZ_CP013082.1|WP_003814239.1|3437346_3438048_+|response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>NZ_CP013082.1|WP_010927010.1|3438047_3439472_+|HAMP-domain-containing-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>NZ_CP013082.1|WP_010931361.1|3440541_3441882_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>NZ_CP013082.1|WP_003820957.1|3441997_3443761_+|glutamine--tRNA-ligase/YqeY-domain-fusion-protein
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>NZ_CP013082.1|WP_010931362.1|3443872_3444751_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>NZ_CP013082.1|WP_003814250.1|3444863_3445679_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

27282 : 70036

Synechococcus_phage(50.0%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930363.1\|27282_28233_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023995007.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
WP_010929578.1\|28674_29109_-	OB-fold domain-containing protein	NA	NA	NA	NA
WP_019247164.1\|29141_30359_-	thiolase family protein	NA	NA	NA	NA
WP_010929580.1\|30364_30862_-	MaoC family dehydratase	NA	NA	NA	NA
WP_019247165.1\|31069_32005_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010929582.1\|32214_33006_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010929583.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_010929584.1\|34625_35576_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814398.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
WP_010929585.1\|37012_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_010929586.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003814404.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_003814405.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_010929587.1\|41318_42212_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_019247766.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_003814412.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
WP_010929588.1\|43663_44614_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929589.1\|45200_45749_+	hypothetical protein	NA	NA	NA	NA
WP_003815265.1\|45720_45957_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003815255.1\|46084_46978_+	AEC family transporter	NA	NA	NA	NA
WP_010929590.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_003817748.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_010929591.1\|50141_51092_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443813.1\|51134_52391_+	muropeptide transporter	NA	NA	NA	NA
WP_010929592.1\|53622_54357_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_019247224.1\|54362_54953_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
WP_003817737.1\|54977_55667_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_023852650.1\|55663_56425_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_010929594.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005012808.1\|57497_58448_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929595.1\|59248_60475_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_047122776.1\|60474_60888_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929597.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
WP_019248755.1\|62442_63417_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929599.1\|63473_64055_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_010929600.1\|64067_64370_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_029443770.1\|64488_65547_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_019247832.1\|65581_66853_-	TRAP transporter large permease	NA	NA	NA	NA
WP_010929603.1\|67482_68664_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_010929584.1\|69085_70036_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

77634 : 136108

Planktothrix_phage(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|77634_78585_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166334.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010929608.1\|79600_81475_-	O-antigen biosynthesis protein WlbL	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
WP_003807102.1\|82822_83527_-	O-antigen biosynthesis protein WlbI	NA	NA	NA	NA
WP_010929609.1\|83523_84696_-	O-antigen biosynthesis protein WlbH	NA	NA	NA	NA
WP_010929610.1\|84891_85485_-	O-antigen biosynthesis protein WlbG	NA	NA	NA	NA
WP_010929611.1\|85481_86714_-	O-antigen biosynthesis protein WlbF	NA	NA	NA	NA
WP_010929612.1\|86731_87991_-	O-antigen biosynthesis protein WlbE	NA	NA	NA	NA
WP_010929613.1\|88014_89103_-	O-antigen biosynthesis protein WlbD	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
WP_010929614.1\|89110_90211_-	O-antigen biosynthesis protein WlbC	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
WP_003807114.1\|90214_90790_-	O-antigen biosynthesis protein WlbB	NA	NA	NA	NA
WP_003807115.1\|90793_91846_-	O-antigen biosynthesis protein WlbA	NA	NA	NA	NA
WP_010929615.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
WP_010929616.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_003807124.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
WP_010929617.1\|94468_95272_-	type III pantothenate kinase	NA	NA	NA	NA
WP_010929618.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_010929619.1\|96209_97340_+	ABC transporter permease	NA	NA	NA	NA
WP_003807131.1\|97339_98179_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
WP_010929620.1\|99111_99714_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_010929621.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003807138.1\|100529_101786_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
WP_010929622.1\|101833_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
WP_003818417.1\|102808_103084_+	YbeD family protein	NA	NA	NA	NA
WP_010929623.1\|103091_103754_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_003807146.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
WP_003807148.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
WP_010929624.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_010929625.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
WP_010929626.1\|107427_108378_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929627.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
WP_010929628.1\|110552_111182_-	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_010927242.1\|111243_111927_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_023853376.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003815933.1\|113906_114254_+	DUF1840 domain-containing protein	NA	NA	NA	NA
WP_003815930.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
WP_010931363.1\|114944_115961_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003815929.1\|116036_116837_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_003815927.1\|116833_117709_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_010929633.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929634.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
WP_010929635.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
WP_005012067.1\|121122_122073_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014905488.1\|122171_123077_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-21	31.7
WP_003815918.1\|123073_123907_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_010929637.1\|124743_125754_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_019247800.1\|125750_126140_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_010929638.1\|127033_128287_+	amidase	NA	NA	NA	NA
WP_010929639.1\|128377_130078_-	2-isopropylmalate synthase	NA	NA	NA	NA
WP_010929640.1\|130504_131152_-	hypothetical protein	NA	NA	NA	NA
WP_023853393.1\|131150_132590_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003815905.1\|132682_132985_+	bacterioferritin-associated ferredoxin	NA	NA	NA	NA
WP_010929512.1\|133012_133891_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|135157_136108_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

164893 : 225404

Diachasmimorpha_longicaudata_entomopoxvirus(11.11%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005015810.1\|164893_165844_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929659.1\|167287_168190_-	YgcG family protein	NA	NA	NA	NA
WP_003815889.1\|168167_168797_-	LemA family protein	NA	NA	NA	NA
WP_010929660.1\|169079_170510_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-44	29.8
WP_010929661.1\|170543_171173_+	LysE family transporter	NA	NA	NA	NA
WP_003815895.1\|171221_172829_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
WP_010929663.1\|172853_173537_+	hypothetical protein	NA	NA	NA	NA
WP_003815898.1\|173618_174095_-	bacterioferritin	NA	NA	NA	NA
WP_010929591.1\|174301_175252_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929664.1\|176367_176895_+	META domain-containing protein	NA	NA	NA	NA
WP_010929665.1\|176986_177802_+	META and DUF4377 domain-containing protein	NA	NA	NA	NA
WP_003808370.1\|177862_178597_+	sulfurtransferase	NA	NA	NA	NA
WP_010929666.1\|178634_180713_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
WP_003808374.1\|180962_181235_-	hypothetical protein	NA	NA	NA	NA
WP_033446322.1\|181336_182422_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_010929668.1\|182425_184330_+	BamA/TamA family outer membrane protein	NA	NA	NA	NA
WP_014486044.1\|184326_188001_+	translocation/assembly module TamB domain-containing protein	NA	NA	NA	NA
WP_010929670.1\|188061_188625_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
WP_003808385.1\|188632_189055_-	VOC family protein	NA	NA	NA	NA
WP_010929671.1\|189082_189502_-	VOC family protein	NA	NA	NA	NA
WP_076879599.1\|189530_190004_-	GNAT family N-acetyltransferase	Q9AZG4	Lactococcus_phage	2.2e-11	31.1
WP_003808391.1\|190103_190601_+	hypothetical protein	NA	NA	NA	NA
WP_003808393.1\|190755_193026_+	arginine/lysine/ornithine decarboxylase	NA	NA	NA	NA
WP_010929672.1\|193074_194307_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010929591.1\|194405_195356_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929673.1\|195458_196094_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-83	73.8
WP_019248671.1\|196090_196984_+	ZIP family metal transporter	NA	NA	NA	NA
WP_010929675.1\|197378_198479_+	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_010929676.1\|198560_198935_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_010929677.1\|198994_201859_+	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
WP_010929678.1\|202003_202744_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_010929679.1\|202813_204025_+	CoA transferase	NA	NA	NA	NA
WP_010929680.1\|204053_205022_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931070.1\|205635_206586_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929699.1\|206742_207066_+	phosphate starvation-inducible protein	NA	NA	NA	NA
WP_023853200.1\|207170_208211_-	cyclase family protein	NA	NA	NA	NA
WP_010929697.1\|208216_208996_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
WP_003807672.1\|209041_209338_-	YciI family protein	NA	NA	NA	NA
WP_003807674.1\|209363_209639_-	muconolactone Delta-isomerase	NA	NA	NA	NA
WP_003819086.1\|209695_210340_-	CoA transferase subunit B	NA	NA	NA	NA
WP_010929696.1\|210339_211026_-	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_010929695.1\|211155_212007_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010929694.1\|212057_212783_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010929693.1\|212814_214164_-	short-chain fatty acid transporter	NA	NA	NA	NA
WP_010929692.1\|214275_215208_-	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_033455792.1\|215665_218461_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
WP_010929690.1\|219054_221997_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_010929689.1\|222068_222788_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
WP_010929688.1\|222826_223375_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
WP_010929687.1\|223529_224429_+	virginiamycin B lyase	NA	NA	NA	NA
WP_005012808.1\|224453_225404_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

233336 : 286924

Bacillus_phage(25.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|233336_234287_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927663.1\|234373_235324_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010930742.1\|235320_236271_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929700.1\|236369_237167_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003814363.1\|238116_238527_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_003814358.1\|239548_240292_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003814356.1\|240335_241379_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_003814355.1\|241549_243652_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_003814351.1\|245062_246019_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929701.1\|246037_246529_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_010929702.1\|246525_247881_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
WP_010929703.1\|247881_248580_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_010929704.1\|248576_249278_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_003814339.1\|249530_250580_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
WP_003814337.1\|250685_251627_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_010929705.1\|251623_253513_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
WP_003814332.1\|253599_254238_+	VTT domain-containing protein	NA	NA	NA	NA
WP_019247543.1\|254380_255766_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.5e-17	30.3
WP_010929706.1\|255696_256233_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_010929707.1\|256384_257776_+	class II fumarate hydratase	NA	NA	NA	NA
WP_010929708.1\|257792_258773_-	AEC family transporter	NA	NA	NA	NA
WP_003814324.1\|258908_259892_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
WP_010929709.1\|259956_260856_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003814321.1\|260962_262717_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_010929710.1\|262724_263849_-	CoA transferase	NA	NA	NA	NA
WP_010929711.1\|263862_264843_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929591.1\|265573_266524_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929712.1\|267083_267629_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_010929713.1\|267712_269332_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_004567834.1\|269347_270502_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_003817696.1\|270515_270641_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
WP_010929714.1\|270637_272389_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
WP_010929715.1\|272385_274065_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
WP_010929716.1\|274127_274676_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.3e-28	43.1
WP_010929717.1\|275818_276097_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|277140_278091_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_173651708.1\|278108_278255_+	hypothetical protein	NA	NA	NA	NA
WP_010929718.1\|278368_278530_+	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_010929719.1\|278537_278678_+	hypothetical protein	NA	NA	NA	NA
WP_003815821.1\|279196_279646_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
WP_003815819.1\|279655_280267_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_019247426.1\|280425_281280_-	cytochrome c1	NA	NA	NA	NA
WP_003815816.1\|281299_282682_-	cytochrome bc complex cytochrome b subunit	NA	NA	NA	NA
WP_003815815.1\|282746_283388_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_010929721.1\|283527_283986_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_010927226.1\|284010_284787_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_014906092.1\|284840_285977_+	trypsin-like peptidase domain-containing protein	W5SAB9	Pithovirus	1.2e-07	31.2
WP_005015810.1\|285973_286924_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

390857 : 448366

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|390857_391808_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927231.1\|391944_392862_+	reductase	NA	NA	NA	NA
WP_003815842.1\|392858_393107_+	glutaredoxin family protein	NA	NA	NA	NA
WP_003815840.1\|393103_394309_+	CoA transferase	NA	NA	NA	NA
WP_014486045.1\|394381_395377_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014486046.1\|395399_396620_-	CoA transferase	NA	NA	NA	NA
WP_014486047.1\|396616_397261_-	hypothetical protein	NA	NA	NA	NA
WP_019248476.1\|398991_399801_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_014486048.1\|400105_401059_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.6e-59	42.5
WP_014486049.1\|401157_402141_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486050.1\|402067_402769_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_014486051.1\|402817_403588_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_019247259.1\|403584_404763_-	CoA transferase	NA	NA	NA	NA
WP_014486052.1\|404930_406637_-	thiamine pyrophosphate-requiring protein	NA	NA	NA	NA
WP_014486053.1\|406633_407530_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014486054.1\|407570_409160_-	rhodanese homology domain-containing protein	NA	NA	NA	NA
WP_003807867.1\|409209_410202_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807865.1\|410270_410870_-	hypothetical protein	NA	NA	NA	NA
WP_014486055.1\|411330_412311_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929577.1\|412386_413337_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_047122777.1\|413425_414340_+	DMT family transporter	NA	NA	NA	NA
WP_010929782.1\|414336_414996_+	LysE family translocator	NA	NA	NA	NA
WP_003814709.1\|415085_416009_+	alpha/beta fold hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
WP_010929783.1\|416014_416470_-	multidrug/biocide efflux PACE transporter	NA	NA	NA	NA
WP_010929784.1\|416466_417570_-	ChbG/HpnK family deacetylase	NA	NA	NA	NA
WP_157734656.1\|417528_417798_+	GtrA family protein	NA	NA	NA	NA
WP_010927086.1\|417757_419377_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_003814720.1\|419373_420432_-	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.8e-59	40.5
WP_033446199.1\|420561_421056_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_022997984.1\|421148_422126_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929785.1\|422321_423527_+	sodium/glutamate symporter	NA	NA	NA	NA
WP_010929786.1\|423523_425035_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_003814726.1\|425050_426364_-	short-chain fatty acid transporter	NA	NA	NA	NA
WP_003814728.1\|426554_426734_-	hypothetical protein	NA	NA	NA	NA
WP_003814730.1\|427143_427878_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
WP_010929577.1\|430322_431273_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247421.1\|431404_431803_-	GTP-binding protein	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
WP_003814701.1\|432213_432684_-	universal stress protein	NA	NA	NA	NA
WP_003820700.1\|432772_433117_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_010929788.1\|433216_434617_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010929789.1\|436405_436924_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.1e-12	38.9
WP_003814694.1\|437034_437790_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
WP_003814691.1\|437985_439218_+	CoA transferase	NA	NA	NA	NA
WP_010929791.1\|439210_439996_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_003814685.1\|440062_441034_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003814681.1\|441044_442022_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019247419.1\|442147_443320_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_010929793.1\|443346_444375_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003814674.1\|444440_445634_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_005012067.1\|447415_448366_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

590420 : 651612

uncultured_Mediterranean_phage(40.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|590420_591371_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023998122.1\|591867_592737_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_010931496.1\|592733_593555_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_019247235.1\|593755_594247_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_019247236.1\|594265_595339_+	CHAD domain-containing protein	NA	NA	NA	NA
WP_023853086.1\|595385_596489_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_003808577.1\|596564_597185_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_003808574.1\|597205_597715_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.2e-28	42.1
WP_003808570.1\|597769_598021_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.6e-18	53.4
WP_010931494.1\|598084_599218_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_003808567.1\|599225_599612_-	MOSC N-terminal beta barrel domain-containing protein	NA	NA	NA	NA
WP_010931493.1\|599608_602128_-	AsmA family protein	NA	NA	NA	NA
WP_003808563.1\|602556_602895_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003808562.1\|602891_603398_+	SRPBCC family protein	NA	NA	NA	NA
WP_010931492.1\|603459_604260_-	hypothetical protein	NA	NA	NA	NA
WP_010931491.1\|604370_605312_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931490.1\|605405_606941_-	M81 family metallopeptidase	NA	NA	NA	NA
WP_010931489.1\|608620_610471_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-17	29.2
WP_003808549.1\|610474_611308_-	ABC transporter permease	NA	NA	NA	NA
WP_010931488.1\|611307_612249_-	ABC transporter permease	NA	NA	NA	NA
WP_010931487.1\|612500_613472_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931486.1\|613613_615902_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_003808542.1\|616208_617117_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_010931485.1\|617171_618137_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931484.1\|618211_619873_+	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
WP_010931483.1\|619944_620655_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_154698388.1\|620621_620786_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|620803_621754_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814152.1\|622452_622836_+	membrane protein	NA	NA	NA	NA
WP_010927005.1\|622893_623496_+	DUF2946 family protein	NA	NA	NA	NA
WP_003820995.1\|623513_623915_-	DoxX family protein	NA	NA	NA	NA
WP_003814158.1\|624048_624942_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931481.1\|624938_625520_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003814165.1\|626314_627049_+	arginyltransferase	NA	NA	NA	NA
WP_010931480.1\|627089_628139_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003814172.1\|628286_628865_-	TIGR01841 family phasin	NA	NA	NA	NA
WP_010931479.1\|629251_630229_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
WP_010931478.1\|630322_634717_-	dermonecrotic toxin	NA	NA	NA	NA
WP_003814178.1\|634917_635766_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010931477.1\|635924_636737_-	competence/damage-inducible protein A	NA	NA	NA	NA
WP_005015810.1\|636792_637743_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931453.1\|637841_638642_-	EI24 domain-containing protein	NA	NA	NA	NA
WP_003814185.1\|638703_639087_+	thioredoxin family protein	NA	NA	NA	NA
WP_010931454.1\|639098_640532_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
WP_003814188.1\|640738_641068_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_010931455.1\|641070_641820_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_010931456.1\|642002_642923_+	branched-chain amino acid transaminase	NA	NA	NA	NA
WP_003814195.1\|642969_643182_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_010931457.1\|643204_643627_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_010931458.1\|643643_644744_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_010931459.1\|644840_646358_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_003814203.1\|646433_647273_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-66	48.9
WP_003814205.1\|647294_648176_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
WP_003814206.1\|648257_649352_-	porin	NA	NA	NA	NA
WP_076879617.1\|649645_650596_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_041166340.1\|650670_651612_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

656936 : 703127

uncultured_Caudovirales_phage(18.18%)

tRNA,transposase,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023995141.1\|656936_657962_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003814221.1\|658002_658242_+	DNA-binding protein	NA	NA	NA	NA
WP_010931464.1\|658311_659901_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
WP_010931465.1\|659900_660449_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_003814226.1\|660529_661102_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_010927008.1\|661120_662032_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_003814230.1\|662105_663074_-	threo-3-hydroxy-L-aspartate ammonia-lyase	NA	NA	NA	NA
WP_010931466.1\|663196_664270_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
WP_010931467.1\|664274_666095_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
WP_010930800.1\|666171_667122_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446132.1\|667210_667546_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_003819076.1\|667679_668330_+	carbonic anhydrase	NA	NA	NA	NA
WP_010931468.1\|668351_669770_-	amidase	NA	NA	NA	NA
WP_019248554.1\|669839_670595_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019247734.1\|670563_671322_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931471.1\|671332_672214_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931472.1\|672230_672938_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
WP_010931473.1\|672940_673699_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
WP_010931474.1\|673908_675651_+	nitrite/sulfite reductase	NA	NA	NA	NA
WP_010925795.1\|675643_676168_+	DUF934 domain-containing protein	NA	NA	NA	NA
WP_010931475.1\|676207_677002_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019248926.1\|677169_678243_+	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|678341_679292_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247378.1\|679543_679750_-	hypothetical protein	NA	NA	NA	NA
WP_010931451.1\|679821_680433_-	S24 family peptidase	NA	NA	NA	NA
WP_023853179.1\|680987_681239_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_161633094.1\|681231_681921_+	hypothetical protein	NA	NA	NA	NA
WP_023853183.1\|681938_682160_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|682177_683128_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247942.1\|683767_684253_+\|transposase	transposase	C7U0W1	Enterobacteria_phage	7.3e-39	61.5
WP_010931447.1\|684239_685517_+\|terminase	terminase large subunit	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
WP_010931446.1\|685519_686938_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
WP_010931445.1\|686966_688022_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
WP_010931444.1\|688027_688270_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
WP_010931443.1\|688392_688995_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
WP_005012808.1\|689423_690374_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931442.1\|691048_691300_+	hypothetical protein	NA	NA	NA	NA
WP_019247789.1\|691362_691845_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
WP_010931440.1\|691846_692047_+	hypothetical protein	NA	NA	NA	NA
WP_010931439.1\|692046_692442_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
WP_010931438.1\|692438_692837_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
WP_010931437.1\|692833_693256_+	DUF4128 domain-containing protein	NA	NA	NA	NA
WP_010931436.1\|693263_693764_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
WP_010931435.1\|694018_694537_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
WP_003813412.1\|694546_694876_+\|tail	phage tail assembly chaperone	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
WP_010931434.1\|694893_695184_+	DUF1799 domain-containing protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
WP_010931433.1\|695209_697822_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
WP_010931432.1\|697831_698191_+	hypothetical protein	NA	NA	NA	NA
WP_010931431.1\|698258_698792_+	DUF1833 family protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
WP_010931430.1\|698788_699178_+	C40 family peptidase	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
WP_010931429.1\|699170_703127_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8

DBSCAN-SWA_8

709293 : 763223

Planktothrix_phage(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003814636.1\|709293_711024_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
WP_010931419.1\|711076_711505_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
WP_003814641.1\|711507_712188_+	protein TolQ	NA	NA	NA	NA
WP_003814643.1\|712187_712646_+	protein TolR	NA	NA	NA	NA
WP_010931418.1\|712682_713657_+	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_010931417.1\|713673_714990_+	Tol-Pal system protein TolB	NA	NA	NA	NA
WP_003814650.1\|715021_715519_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_003814652.1\|715605_716295_+	tol-pal system protein YbgF	NA	NA	NA	NA
WP_010931416.1\|716294_717344_+	iron ABC transporter permease	NA	NA	NA	NA
WP_003814657.1\|717340_718135_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
WP_019247923.1\|718303_718654_+	hypothetical protein	NA	NA	NA	NA
WP_019247922.1\|718629_719187_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_005012808.1\|720316_721267_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929184.1\|723404_724634_+	spore maturation protein	NA	NA	NA	NA
WP_003814419.1\|724636_726079_-	pyruvate kinase	NA	NA	NA	NA
WP_010931414.1\|726183_727329_+	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	42.2
WP_010931413.1\|727360_728158_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_010931412.1\|728182_729742_-	chaperone SurA	NA	NA	NA	NA
WP_010931411.1\|729738_732111_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_010931410.1\|732220_733324_+	phosphotransferase	NA	NA	NA	NA
WP_010931409.1\|733323_734016_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_003814436.1\|734159_734861_+	membrane protein	NA	NA	NA	NA
WP_003814437.1\|734845_735223_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_010929591.1\|735954_736905_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814441.1\|737064_737937_-	oxaloacetate decarboxylase	NA	NA	NA	NA
WP_003814443.1\|738277_738496_+	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_019247242.1\|738535_739915_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010929976.1\|739956_741354_-	amidase family protein	NA	NA	NA	NA
WP_010927038.1\|741393_743046_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-16	30.8
WP_010929977.1\|743049_743934_-	ABC transporter permease	NA	NA	NA	NA
WP_010929978.1\|743933_744875_-	ABC transporter permease	NA	NA	NA	NA
WP_010929979.1\|744953_746573_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010929980.1\|746739_747555_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_003814459.1\|747622_748192_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|748192_749143_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814461.1\|749797_750895_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
WP_003814462.1\|750928_752194_+	saccharopine dehydrogenase family protein	NA	NA	NA	NA
WP_010929591.1\|752351_753302_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929982.1\|753545_754136_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_010929983.1\|754151_756596_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_003814467.1\|756715_757687_-	FecR family protein	NA	NA	NA	NA
WP_023852739.1\|757818_758343_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_005012067.1\|758302_759253_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929984.1\|759474_761670_-	DUF1156 domain-containing protein	NA	NA	NA	NA
WP_010929985.1\|761742_762171_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005012808.1\|762272_763223_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

859796 : 913927

Vibrio_phage(25.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003813960.1\|859796_861755_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
WP_005013747.1\|861837_862788_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930032.1\|863008_863677_+	transcriptional regulator	NA	NA	NA	NA
WP_010930031.1\|863800_864907_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_010930030.1\|864919_868033_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.5e-57	21.5
WP_010930029.1\|868029_869523_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_010926969.1\|869537_870209_+	transcriptional regulator	NA	NA	NA	NA
WP_003813974.1\|870252_870747_-	azurin	NA	NA	NA	NA
WP_010930027.1\|870887_871535_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_023853163.1\|871638_873687_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_010930025.1\|873683_875696_+	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_010930024.1\|875721_877056_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_003813981.1\|877164_878157_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003813982.1\|878223_880308_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_010930023.1\|880332_881304_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930022.1\|881432_882464_-	succinylglutamate desuccinylase/aspartoacylase family protein	NA	NA	NA	NA
WP_010930021.1\|882467_883619_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_076879542.1\|883789_884713_+	transcriptional regulator LrhA	NA	NA	NA	NA
WP_003813987.1\|884790_885615_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_023994644.1\|885811_886828_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003813988.1\|887024_888008_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930019.1\|889606_890995_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_003813991.1\|891025_892015_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003813992.1\|892125_893358_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
WP_003813993.1\|893639_894440_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010930018.1\|894462_896694_-\|holin	choline BCCT transporter BetT	NA	NA	NA	NA
WP_010930017.1\|897481_897928_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_003813996.1\|897949_898696_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_003813997.1\|898839_899817_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_010930016.1\|900450_901062_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
WP_003813999.1\|901055_902273_-	threonine ammonia-lyase	NA	NA	NA	NA
WP_005013747.1\|902413_903364_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814000.1\|903360_904080_-	lipoprotein	NA	NA	NA	NA
WP_003821234.1\|904200_906360_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_003814002.1\|906450_906720_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_003814003.1\|907013_907541_+	lipoprotein	NA	NA	NA	NA
WP_003814004.1\|907559_908339_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_010930015.1\|908506_909523_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_003814006.1\|909595_910087_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_003814007.1\|910097_911813_-	acetolactate synthase 3 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	3.1e-60	30.3
WP_005012067.1\|912976_913927_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

934674 : 1069833

117

uncultured_Caudovirales_phage(10.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|934674_935625_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930064.1\|935677_935899_+	hypothetical protein	NA	NA	NA	NA
WP_003810832.1\|936058_936271_+	hypothetical protein	NA	NA	NA	NA
WP_003810835.1\|936390_937509_+	mannose-6-phosphate isomerase	NA	NA	NA	NA
WP_003810839.1\|938014_938266_+	hypothetical protein	NA	NA	NA	NA
WP_010930066.1\|938378_939329_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003810840.1\|939325_939709_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_023852913.1\|939763_941578_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
WP_010930068.1\|941727_942555_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
WP_010930069.1\|942600_943581_+	aldo/keto reductase	NA	NA	NA	NA
WP_003810850.1\|943577_943790_-	hypothetical protein	NA	NA	NA	NA
WP_003810851.1\|943786_944968_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_019248496.1\|945131_945866_+	metallophosphoesterase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
WP_010930071.1\|945867_948480_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_003810859.1\|948615_950529_-	S9 family peptidase	NA	NA	NA	NA
WP_010930072.1\|951144_951555_-	PaaI family thioesterase	NA	NA	NA	NA
WP_003810865.1\|951652_952738_+	DNA polymerase IV	NA	NA	NA	NA
WP_005012067.1\|952836_953787_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930088.1\|953783_954758_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003821497.1\|954882_955794_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
WP_004566317.1\|956070_956463_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
WP_005012808.1\|956592_957543_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930090.1\|957572_957755_-	type II toxin-antitoxin system HicA family toxin	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
WP_010930091.1\|958527_959709_-	MFS transporter	NA	NA	NA	NA
WP_010930092.1\|959924_960602_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_010930093.1\|960598_961324_-	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
WP_010930094.1\|961449_962031_-	OmpA family protein	NA	NA	NA	NA
WP_010930095.1\|962401_965083_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
WP_010930096.1\|965082_966216_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
WP_010930097.1\|966208_967294_+	prephenate dehydratase	NA	NA	NA	NA
WP_010930098.1\|967380_968280_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
WP_010930099.1\|968276_969605_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_010930100.1\|969619_970291_+	(d)CMP kinase	NA	NA	NA	NA
WP_010930101.1\|970478_972194_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_010930102.1\|972195_972555_+	integration host factor subunit beta	NA	NA	NA	NA
WP_010930103.1\|972746_973061_+	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_010930104.1\|973103_974324_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_010930105.1\|974320_975262_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
WP_003821513.1\|975258_976248_+	ADP-glyceromanno-heptose 6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
WP_033446303.1\|976282_976867_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|976965_977916_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486062.1\|977996_978908_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.0e-47	38.8
WP_010930108.1\|978968_980114_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_003821521.1\|980133_981048_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	9.8e-45	34.7
WP_010930110.1\|981119_981869_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_010930111.1\|981868_982798_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
WP_003821527.1\|983041_984868_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003813333.1\|984950_985592_+	peroxiredoxin	NA	NA	NA	NA
WP_170954292.1\|985814_986816_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930112.1\|988652_989717_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-24	30.3
WP_010930113.1\|990514_991423_+	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
WP_023852693.1\|992910_994185_+	PA0069 family radical SAM protein	NA	NA	NA	NA
WP_023852686.1\|994338_994719_+	hypothetical protein	NA	NA	NA	NA
WP_014905652.1\|994726_995599_-	EamA family transporter	NA	NA	NA	NA
WP_003813315.1\|995904_996285_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_003813314.1\|996495_997221_+	CoA pyrophosphatase	NA	NA	NA	NA
WP_005012067.1\|997316_998267_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930118.1\|998371_999421_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_010929632.1\|999558_1000575_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010926548.1\|1002083_1002656_-	chorismate lyase	NA	NA	NA	NA
WP_010930119.1\|1002715_1003447_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_029443805.1\|1003498_1004416_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930121.1\|1005223_1008403_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_014486063.1\|1008399_1009782_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_010930123.1\|1009851_1010103_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_010930124.1\|1010248_1010863_-	SCO family protein	NA	NA	NA	NA
WP_019248379.1\|1011049_1013164_-	M3 family metallopeptidase	NA	NA	NA	NA
WP_003811948.1\|1013239_1014091_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
WP_010930126.1\|1014087_1014714_-	response regulator transcription factor	NA	NA	NA	NA
WP_003817147.1\|1014710_1016465_-	PAS domain S-box protein	NA	NA	NA	NA
WP_010930127.1\|1016757_1019463_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_010930128.1\|1019475_1021137_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
WP_010930129.1\|1021149_1022940_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
WP_003817151.1\|1023161_1024337_-	FliC/FljB family flagellin	NA	NA	NA	NA
WP_010929584.1\|1024379_1025330_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930130.1\|1025428_1026169_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_010930131.1\|1026363_1028400_+	transketolase	NA	NA	NA	NA
WP_010930132.1\|1028417_1029428_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_010930133.1\|1029545_1030739_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_010930134.1\|1030768_1031542_-	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_010930135.1\|1031538_1032729_-	acetate kinase	NA	NA	NA	NA
WP_003809454.1\|1032754_1033693_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_010930136.1\|1033689_1036038_-	DUF3141 domain-containing protein	NA	NA	NA	NA
WP_010930137.1\|1036192_1036834_-	glutathione transferase	NA	NA	NA	NA
WP_023853531.1\|1036937_1038071_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_023994624.1\|1038163_1038316_-	hypothetical protein	NA	NA	NA	NA
WP_010930138.1\|1038347_1038896_-	DinB family protein	NA	NA	NA	NA
WP_003819814.1\|1038914_1039400_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010930139.1\|1039577_1040516_+	DnaJ domain-containing protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
WP_003809467.1\|1040518_1040836_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_019247197.1\|1040881_1041826_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_010930141.1\|1043506_1044157_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
WP_003809479.1\|1044210_1044546_+	hypothetical protein	NA	NA	NA	NA
WP_010930142.1\|1044542_1045403_+	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
WP_003819817.1\|1045419_1045701_-	hypothetical protein	NA	NA	NA	NA
WP_003809486.1\|1045774_1046038_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_005012067.1\|1046281_1047232_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811933.1\|1047530_1048268_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
WP_010930143.1\|1048703_1049027_+	flagellar transcriptional regulator FlhD	NA	NA	NA	NA
WP_003811929.1\|1049061_1049622_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
WP_003811927.1\|1049742_1050618_+	flagellar motor stator protein MotA	NA	NA	NA	NA
WP_003817154.1\|1050630_1051578_+	flagellar motor protein MotB	NA	NA	NA	NA
WP_019247393.1\|1051679_1051973_+	response regulator	NA	NA	NA	NA
WP_010930144.1\|1051999_1054057_+	chemotaxis protein CheA	NA	NA	NA	NA
WP_003811919.1\|1054071_1054572_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_010930145.1\|1054645_1056352_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
WP_010930146.1\|1057215_1058268_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_003811911.1\|1058320_1058710_+	chemotaxis response regulator CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
WP_003817162.1\|1058718_1059351_+	protein phosphatase CheZ	NA	NA	NA	NA
WP_010931363.1\|1059450_1060467_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930148.1\|1061255_1062305_+	aldo/keto reductase	NA	NA	NA	NA
WP_014486064.1\|1062301_1063945_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_010930149.1\|1063941_1064829_-	CBS domain-containing protein	NA	NA	NA	NA
WP_003809396.1\|1064969_1065443_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_010930151.1\|1065432_1066455_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
WP_015041211.1\|1066451_1067879_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_010931363.1\|1068816_1069833_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1073586 : 1134613

Catovirus(20.0%)

tRNA,transposase,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930155.1\|1073586_1074723_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
WP_023853534.1\|1074719_1075793_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003809423.1\|1075950_1077387_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
WP_010930157.1\|1077477_1078119_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_023853536.1\|1078454_1079471_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_019248433.1\|1079803_1082551_+	pertactin autotransporter	NA	NA	NA	NA
WP_010930160.1\|1082617_1084039_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_003809431.1\|1084302_1085019_+	hypothetical protein	NA	NA	NA	NA
WP_003809432.1\|1085103_1085421_+	DUF883 domain-containing protein	NA	NA	NA	NA
WP_003819794.1\|1085461_1085875_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_010930161.1\|1085876_1086236_+	hypothetical protein	NA	NA	NA	NA
WP_023853525.1\|1086278_1087823_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
WP_010930163.1\|1087906_1088737_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_010930164.1\|1088771_1089926_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_010930165.1\|1089968_1090841_+	hypothetical protein	NA	NA	NA	NA
WP_014486065.1\|1090957_1093246_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_003809441.1\|1094452_1094917_+	barstar family protein	NA	NA	NA	NA
WP_005013747.1\|1094943_1095894_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_154698393.1\|1095911_1096049_+	hypothetical protein	NA	NA	NA	NA
WP_010930167.1\|1096261_1097038_-	phosphate ABC transporter ATP-binding protein PstB	G9BWD6	Planktothrix_phage	4.3e-17	28.7
WP_003809638.1\|1097082_1097940_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_010930169.1\|1097961_1098978_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_014486066.1\|1099112_1100153_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
WP_010930171.1\|1100347_1102429_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_010930172.1\|1102664_1104158_+	exopolyphosphatase	NA	NA	NA	NA
WP_003809629.1\|1104388_1105183_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003819875.1\|1105403_1106762_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_010930173.1\|1106758_1107601_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
WP_010930174.1\|1107619_1109506_-\|protease	ATP-dependent zinc metalloprotease FtsH	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
WP_162096758.1\|1109447_1109699_+	hypothetical protein	NA	NA	NA	NA
WP_010930175.1\|1109743_1110376_-	RlmE family RNA methyltransferase	NA	NA	NA	NA
WP_003809618.1\|1110394_1110997_+	YhbY family RNA-binding protein	NA	NA	NA	NA
WP_010929591.1\|1111148_1112099_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_161633091.1\|1112679_1113387_+	DUF192 domain-containing protein	NA	NA	NA	NA
WP_003812707.1\|1113745_1114732_-	homoserine kinase	NA	NA	NA	NA
WP_010930178.1\|1114871_1115885_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_005012067.1\|1115881_1116832_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_155120815.1\|1116849_1116990_+	hypothetical protein	NA	NA	NA	NA
WP_003812703.1\|1116944_1117403_-	CBS domain-containing protein	NA	NA	NA	NA
WP_003812701.1\|1117439_1118753_-	YihY family inner membrane protein	NA	NA	NA	NA
WP_010930180.1\|1118770_1119142_+	DUF2069 domain-containing protein	NA	NA	NA	NA
WP_019248549.1\|1119138_1120602_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
WP_010930182.1\|1120742_1121471_+	response regulator transcription factor	NA	NA	NA	NA
WP_010930183.1\|1121452_1124302_-	EAL domain-containing protein	NA	NA	NA	NA
WP_010929591.1\|1124514_1125465_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930184.1\|1125632_1126457_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
WP_010930185.1\|1126456_1127335_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010930186.1\|1128239_1129355_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020699602.1\|1129383_1130178_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-11	23.3
WP_010930188.1\|1130174_1132040_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
WP_003812436.1\|1132118_1132751_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_010930189.1\|1132747_1133050_-	membrane protein	NA	NA	NA	NA
WP_010930190.1\|1133092_1134613_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0

DBSCAN-SWA_12

1316903 : 1382332

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|1316903_1317854_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930283.1\|1318622_1319261_-	glutathione S-transferase	NA	NA	NA	NA
WP_019247793.1\|1320150_1320597_+	aspartate/glutamate racemase family protein	NA	NA	NA	NA
WP_010930284.1\|1320678_1321380_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
WP_003811277.1\|1321380_1322148_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
WP_010930285.1\|1322144_1323383_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
WP_003811272.1\|1323382_1324309_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
WP_010930286.1\|1324411_1325527_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005015810.1\|1325542_1326493_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930287.1\|1326846_1327428_-	queuosine precursor transporter	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
WP_003811267.1\|1327424_1328258_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
WP_010930288.1\|1328468_1329782_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
WP_003811262.1\|1329958_1330840_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
WP_003811259.1\|1330859_1331711_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
WP_010930289.1\|1331763_1332852_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
WP_010930290.1\|1332962_1334090_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003811244.1\|1334324_1334936_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_010929584.1\|1335034_1335985_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811293.1\|1336206_1336584_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_003811295.1\|1336731_1337229_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_010930291.1\|1337225_1337753_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_003811298.1\|1337886_1338702_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930292.1\|1338714_1339896_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_003811301.1\|1339943_1340837_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_010930293.1\|1340963_1341434_-	hypothetical protein	NA	NA	NA	NA
WP_010930294.1\|1341559_1342387_-	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_003811306.1\|1342415_1343192_-	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_023852802.1\|1343188_1343464_-	hypothetical protein	NA	NA	NA	NA
WP_010930295.1\|1343478_1343943_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_010930296.1\|1343954_1344656_-	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_003811310.1\|1344765_1345266_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
WP_010930297.1\|1345348_1346527_-	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_003811313.1\|1348154_1348490_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_010930298.1\|1348677_1350126_+	CoA transferase	NA	NA	NA	NA
WP_023852799.1\|1350183_1350528_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
WP_003811316.1\|1350634_1351174_-	peroxiredoxin	NA	NA	NA	NA
WP_005012067.1\|1351266_1352217_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|1352315_1353266_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023999972.1\|1353283_1353523_+	hypothetical protein	NA	NA	NA	NA
WP_019247530.1\|1354004_1354436_-	YXWGXW repeat-containing protein	NA	NA	NA	NA
WP_010930300.1\|1354617_1355022_-	DoxX family protein	NA	NA	NA	NA
WP_010930301.1\|1356258_1356582_+	hypothetical protein	NA	NA	NA	NA
WP_019247533.1\|1356584_1357472_-	aldo/keto reductase	NA	NA	NA	NA
WP_003811322.1\|1357504_1357930_-	universal stress protein	NA	NA	NA	NA
WP_019247534.1\|1358001_1358355_-	hypothetical protein	NA	NA	NA	NA
WP_003811324.1\|1358594_1359101_-	hypothetical protein	NA	NA	NA	NA
WP_010930302.1\|1359139_1360471_-	transcriptional regulator PtsJ	NA	NA	NA	NA
WP_003811326.1\|1360530_1361346_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_010930303.1\|1361342_1362197_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
WP_010930304.1\|1365259_1367803_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
WP_010930305.1\|1369169_1370924_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
WP_010930306.1\|1370920_1373041_-	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_010930307.1\|1373045_1375241_-	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_010930308.1\|1375237_1378579_-	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
WP_010930208.1\|1381381_1382332_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1446930 : 1502418

Mollivirus(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|1446930_1447881_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811846.1\|1449082_1449529_-	flagellar export protein FliJ	NA	NA	NA	NA
WP_019247562.1\|1449521_1450997_-	flagellar protein export ATPase FliI	NA	NA	NA	NA
WP_010930338.1\|1450993_1451749_-	flagellar assembly protein FliH	NA	NA	NA	NA
WP_003817203.1\|1451741_1452752_-	flagellar motor switch protein FliG	NA	NA	NA	NA
WP_010930339.1\|1452741_1454418_-	flagellar M-ring protein FliF	NA	NA	NA	NA
WP_010930340.1\|1454730_1455063_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
WP_010930341.1\|1455076_1455472_-	hypothetical protein	NA	NA	NA	NA
WP_010930342.1\|1455481_1455808_-	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_019247563.1\|1455804_1456131_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
WP_023994685.1\|1456057_1457080_-	hypothetical protein	NA	NA	NA	NA
WP_010930343.1\|1457076_1457427_-	flagellar protein FliT	NA	NA	NA	NA
WP_010930344.1\|1457474_1457903_-	flagellar export chaperone FliS	NA	NA	NA	NA
WP_010930345.1\|1457910_1459284_-	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_003817216.1\|1459424_1459802_-	flagellar protein FlaG	NA	NA	NA	NA
WP_010930346.1\|1460064_1461372_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_023852965.1\|1461432_1462263_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_003811815.1\|1462259_1462748_+	CvpA family protein	NA	NA	NA	NA
WP_003811814.1\|1462789_1464310_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.8e-97	43.7
WP_003811812.1\|1464353_1464830_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_010930348.1\|1465633_1468231_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_003811806.1\|1468260_1469082_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003811803.1\|1469808_1470558_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_010926570.1\|1470741_1471620_+	elongation factor Ts	NA	NA	NA	NA
WP_010930349.1\|1471717_1472434_+	UMP kinase	NA	NA	NA	NA
WP_003811796.1\|1472448_1473009_+	ribosome recycling factor	NA	NA	NA	NA
WP_010930350.1\|1473175_1473940_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.7e-18	36.1
WP_010930351.1\|1473959_1474817_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003811788.1\|1474813_1476013_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_010930352.1\|1476052_1477387_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_010930353.1\|1477439_1479776_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_003811782.1\|1479901_1480465_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_010930354.1\|1480473_1481565_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003811776.1\|1481636_1482092_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_010930355.1\|1482092_1482887_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_010930356.1\|1482883_1484065_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_003811770.1\|1484051_1484657_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	8.8e-26	40.2
WP_003811768.1\|1484653_1485427_+	RNA methyltransferase	NA	NA	NA	NA
WP_010930357.1\|1485438_1486266_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_010930358.1\|1486427_1488791_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.2e-165	35.9
WP_010930359.1\|1488858_1489578_-	glutamine amidotransferase	NA	NA	NA	NA
WP_003811761.1\|1489701_1490127_+	NfeD family protein	NA	NA	NA	NA
WP_005012067.1\|1490161_1491112_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811759.1\|1491229_1492156_+	paraslipin	NA	NA	NA	NA
WP_010930360.1\|1492221_1493379_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
WP_003811754.1\|1493359_1493827_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
WP_010930800.1\|1493974_1494925_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003811752.1\|1494941_1495376_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_003811750.1\|1495365_1495716_+	RnfH family protein	NA	NA	NA	NA
WP_003811748.1\|1495912_1497067_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_003811746.1\|1497063_1498236_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003811743.1\|1498283_1499177_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
WP_003811741.1\|1499222_1499660_+	PaaI family thioesterase	NA	NA	NA	NA
WP_010930362.1\|1499719_1500409_+	VIT family protein	NA	NA	NA	NA
WP_010930363.1\|1500418_1501369_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_076879624.1\|1501467_1502418_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1597115 : 1665201

Streptococcus_virus(11.11%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010930416.1\|1597115_1597604_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_019248504.1\|1597721_1598300_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_010930418.1\|1598405_1598774_+	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|1598872_1599823_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023994932.1\|1599829_1600942_-	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
WP_010930419.1\|1601628_1602831_+	MFS transporter	NA	NA	NA	NA
WP_004568212.1\|1602866_1603013_+	hypothetical protein	NA	NA	NA	NA
WP_010930420.1\|1603034_1605695_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_010930421.1\|1605707_1609112_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_023995689.1\|1609779_1612005_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.2e-43	38.5
WP_010930423.1\|1612051_1612378_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_010930424.1\|1612428_1613037_+	recombination protein RecR	NA	NA	NA	NA
WP_005013747.1\|1613135_1614086_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930425.1\|1614155_1614920_-	hypothetical protein	NA	NA	NA	NA
WP_010930426.1\|1614916_1615516_-	hypothetical protein	NA	NA	NA	NA
WP_010930427.1\|1615619_1616471_-	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	7.0e-37	35.3
WP_010928449.1\|1616530_1617157_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_005012067.1\|1617153_1618104_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019249265.1\|1618202_1619315_-	DUF1513 domain-containing protein	NA	NA	NA	NA
WP_019248041.1\|1619304_1620306_-	imelysin family protein	NA	NA	NA	NA
WP_019247498.1\|1620411_1621923_-	c-type cytochrome	NA	NA	NA	NA
WP_023853587.1\|1621919_1623224_-	imelysin	NA	NA	NA	NA
WP_010930431.1\|1623335_1623896_-	membrane protein	NA	NA	NA	NA
WP_010930432.1\|1624163_1624718_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.7e-15	32.0
WP_010930433.1\|1625173_1625389_-	dodecin domain-containing protein	NA	NA	NA	NA
WP_033446228.1\|1625643_1628241_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.5e-21	22.6
WP_010930435.1\|1628237_1629425_+	cupin domain-containing protein	NA	NA	NA	NA
WP_010930436.1\|1630083_1630698_+	serotype 3 fimbrial subunit	NA	NA	NA	NA
WP_010930437.1\|1630786_1631914_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_033446216.1\|1631925_1632831_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_005012067.1\|1633723_1634674_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930439.1\|1634855_1635608_+	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_003811112.1\|1635676_1636336_+	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_003811113.1\|1636332_1637061_+	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	3.3e-35	39.3
WP_010930440.1\|1637073_1639353_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	5.9e-06	32.1
WP_010930441.1\|1639377_1639581_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_010930442.1\|1639622_1640255_-	guanylate kinase	A0A218KC48	Bacillus_phage	2.4e-13	33.9
WP_010930443.1\|1640390_1641308_-	c-type cytochrome	NA	NA	NA	NA
WP_010930444.1\|1641304_1642018_-	c-type cytochrome	NA	NA	NA	NA
WP_003811135.1\|1642255_1643026_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003811137.1\|1643030_1643630_-	C40 family peptidase	A0A0A8WF62	Clostridium_phage	1.4e-20	41.6
WP_003811138.1\|1643874_1645365_+	AMP nucleosidase	NA	NA	NA	NA
WP_010926696.1\|1645423_1645708_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010930445.1\|1645845_1646001_-	hypothetical protein	NA	NA	NA	NA
WP_003811148.1\|1646273_1647200_-	YicC family protein	NA	NA	NA	NA
WP_003811149.1\|1647336_1648077_+	ribonuclease PH	NA	NA	NA	NA
WP_010930446.1\|1648243_1649620_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_003811152.1\|1649801_1650707_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930448.1\|1652358_1654161_-	EAL domain-containing protein	NA	NA	NA	NA
WP_010930449.1\|1654287_1654929_+	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_005012808.1\|1655027_1655978_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930450.1\|1655999_1657220_+	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
WP_003811164.1\|1657405_1658818_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_003811167.1\|1658881_1659949_+	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
WP_010930451.1\|1659948_1661436_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
WP_010930452.1\|1661445_1662390_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003811176.1\|1662549_1663248_+	pirin family protein	NA	NA	NA	NA
WP_010930453.1\|1663325_1664231_+	pirin family protein	NA	NA	NA	NA
WP_005012067.1\|1664250_1665201_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1701150 : 1756741

Brazilian_cedratvirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|1701150_1702101_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930486.1\|1702159_1702933_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_014486074.1\|1702925_1704482_+	LTA synthase family protein	NA	NA	NA	NA
WP_005013747.1\|1704478_1705429_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003810741.1\|1706755_1707358_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_003810743.1\|1707597_1708299_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_003816696.1\|1708292_1709075_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
WP_005012808.1\|1709259_1710210_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930483.1\|1710308_1711046_-	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
WP_010926609.1\|1711235_1711994_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930482.1\|1712040_1713030_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930481.1\|1713207_1714176_-	transporter	NA	NA	NA	NA
WP_010930480.1\|1715715_1716684_+	AAA family ATPase	NA	NA	NA	NA
WP_010930479.1\|1716692_1717634_+	DUF58 domain-containing protein	NA	NA	NA	NA
WP_010930478.1\|1718107_1719118_+	VWA domain-containing protein	NA	NA	NA	NA
WP_010930477.1\|1719108_1720623_+	VWA domain-containing protein	NA	NA	NA	NA
WP_010930476.1\|1720619_1721966_+	BatD family protein	NA	NA	NA	NA
WP_010930475.1\|1721968_1723003_+	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
WP_023852967.1\|1723052_1724678_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
WP_005012067.1\|1725230_1726181_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930487.1\|1726285_1727233_+	hypothetical protein	NA	NA	NA	NA
WP_019247865.1\|1727286_1729101_-	sensor histidine kinase	NA	NA	NA	NA
WP_010930489.1\|1729093_1729768_-	response regulator transcription factor	NA	NA	NA	NA
WP_023995112.1\|1729897_1732972_+	autotransporter SphB2	NA	NA	NA	NA
WP_019247905.1\|1732985_1733285_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010930492.1\|1733599_1734223_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_010930493.1\|1734466_1735336_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_010930494.1\|1735313_1736258_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019247909.1\|1736343_1737270_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_019247910.1\|1737382_1738162_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930497.1\|1738152_1739349_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_010930498.1\|1739379_1740330_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_010930499.1\|1740551_1741241_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930500.1\|1741305_1742061_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930501.1\|1742112_1743105_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930502.1\|1743114_1744068_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003811538.1\|1744183_1745146_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_019249376.1\|1746547_1746976_+	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|1746972_1747923_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_170954298.1\|1748216_1748954_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
WP_010930504.1\|1749377_1750565_-	MFS transporter	NA	NA	NA	NA
WP_019249653.1\|1750568_1750949_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930506.1\|1752668_1753640_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930507.1\|1753653_1754367_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930508.1\|1754371_1755289_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003811452.1\|1755395_1755692_+	hypothetical protein	NA	NA	NA	NA
WP_010929588.1\|1755790_1756741_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1989505 : 2059157

Staphylococcus_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003818515.1\|1989505_1992163_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	3.3e-173	39.0
WP_010930709.1\|1992240_1993443_-	MFS transporter	NA	NA	NA	NA
WP_003810260.1\|1993439_1993952_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_019247822.1\|1994074_1994512_-	HU family DNA-binding protein	NA	NA	NA	NA
WP_010931070.1\|1994788_1995739_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_062826579.1\|1995837_1996788_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930710.1\|1997041_1998847_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	2.2e-19	27.5
WP_010930711.1\|1998960_1999128_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_003810297.1\|1999191_1999428_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_010930712.1\|1999796_2000996_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_010929591.1\|2002511_2003462_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818523.1\|2003913_2004915_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003810306.1\|2005087_2005945_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_003810308.1\|2005941_2007204_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.8e-28	36.6
WP_003818524.1\|2007304_2007679_+	tautomerase family protein	NA	NA	NA	NA
WP_010930713.1\|2007751_2008939_+	acetyl-CoA C-acyltransferase family protein	NA	NA	NA	NA
WP_010930714.1\|2009023_2009794_+	spermidine synthase	NA	NA	NA	NA
WP_010930715.1\|2009907_2010672_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010930716.1\|2010622_2011924_+	malonyl-CoA decarboxylase family protein	NA	NA	NA	NA
WP_010930717.1\|2011920_2012727_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003818532.1\|2014471_2015443_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003818533.1\|2015599_2016112_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	1.8e-43	52.3
WP_010930718.1\|2016270_2017245_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930719.1\|2018245_2019040_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.1e-05	25.7
WP_003818535.1\|2019065_2019872_-	TOBE domain-containing protein	NA	NA	NA	NA
WP_003810329.1\|2019982_2020573_+	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_010930720.1\|2020583_2021762_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_010930721.1\|2021864_2022239_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_019248531.1\|2022491_2023823_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_019247651.1\|2023889_2027120_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_003810344.1\|2028610_2029357_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_010930724.1\|2029441_2029903_+	holo-ACP synthase	NA	NA	NA	NA
WP_010930725.1\|2029940_2030999_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_010930726.1\|2030961_2032791_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_003810356.1\|2032830_2033403_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_010930727.1\|2034827_2035649_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	4.1e-42	37.6
WP_010930728.1\|2035967_2037290_+	isocitrate lyase	NA	NA	NA	NA
WP_010930729.1\|2037649_2038285_+	membrane protein	NA	NA	NA	NA
WP_010930730.1\|2038244_2039195_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930731.1\|2040065_2040938_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010930732.1\|2041015_2042155_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930733.1\|2042513_2043770_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_003816691.1\|2043775_2044303_+	aromatic-ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
WP_003816690.1\|2044307_2045126_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003816687.1\|2045125_2045848_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930735.1\|2045869_2046184_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_010930736.1\|2046201_2047350_+	CoA transferase	NA	NA	NA	NA
WP_010930737.1\|2047380_2048256_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003816680.1\|2048252_2049572_-	AMP-binding protein	NA	NA	NA	NA
WP_014486081.1\|2049644_2050841_-	acetyl-CoA acetyltransferase	NA	NA	NA	NA
WP_010930739.1\|2050851_2052339_-	hydroxymethylglutaryl-CoA synthase family protein	NA	NA	NA	NA
WP_010930740.1\|2054933_2055833_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_023852887.1\|2055970_2056936_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930800.1\|2057034_2057985_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|2058206_2059157_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2070653 : 2121737

Erysipelothrix_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|2070653_2071604_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812172.1\|2072747_2073044_-	hypothetical protein	NA	NA	NA	NA
WP_019247707.1\|2073218_2074571_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-45	27.6
WP_010930153.1\|2074713_2075730_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010930748.1\|2077709_2078723_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_010930749.1\|2078809_2079715_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003812179.1\|2079871_2080216_+	exported protein	NA	NA	NA	NA
WP_010930750.1\|2080373_2080832_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_010930751.1\|2080845_2083062_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_003812183.1\|2083058_2084120_+	XdhC family protein	NA	NA	NA	NA
WP_010930752.1\|2084148_2085123_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_010930753.1\|2085074_2085893_-	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	2.3e-16	28.8
WP_003812191.1\|2085905_2086514_-	LON peptidase substrate-binding domain-containing protein	NA	NA	NA	NA
WP_010930754.1\|2086688_2087084_+	VOC family protein	NA	NA	NA	NA
WP_010930755.1\|2087102_2088542_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	7.4e-55	37.4
WP_003812199.1\|2088570_2088918_+	GFA family protein	NA	NA	NA	NA
WP_010929577.1\|2088936_2089887_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|2090539_2091490_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023997035.1\|2091573_2093391_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
WP_019247659.1\|2093464_2094112_+	hypothetical protein	NA	NA	NA	NA
WP_010930758.1\|2094124_2095054_-	ZIP family metal transporter	NA	NA	NA	NA
WP_014905663.1\|2095223_2095688_+	hypothetical protein	NA	NA	NA	NA
WP_003816977.1\|2095935_2096616_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003816975.1\|2096664_2098356_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	5.0e-42	27.3
WP_010930760.1\|2098371_2098923_-	SRPBCC family protein	NA	NA	NA	NA
WP_003816971.1\|2098919_2099291_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010930761.1\|2099403_2100240_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_029443822.1\|2100250_2100775_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_003812228.1\|2100872_2101052_+	DUF3008 family protein	NA	NA	NA	NA
WP_010930763.1\|2101181_2102156_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003816964.1\|2102286_2102643_+	DUF1428 domain-containing protein	NA	NA	NA	NA
WP_010930764.1\|2102632_2103508_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_010930765.1\|2103606_2104491_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930766.1\|2104512_2105808_-	DUF445 domain-containing protein	NA	NA	NA	NA
WP_003816959.1\|2106756_2107407_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_010930767.1\|2107494_2109015_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_010930768.1\|2109272_2111138_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|2112183_2113134_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268681.1\|2113151_2113292_+	hypothetical protein	NA	NA	NA	NA
WP_010930769.1\|2114106_2114466_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_010930770.1\|2114453_2115890_-	dethiobiotin synthase	NA	NA	NA	NA
WP_010930771.1\|2115886_2116540_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_010930772.1\|2116536_2117730_-	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
WP_010930773.1\|2117833_2119108_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.6e-14	28.9
WP_005012067.1\|2119104_2120055_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268682.1\|2120072_2120327_+	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|2120786_2121737_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2132308 : 2172999

Klosneuvirus(25.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005013747.1\|2132308_2133259_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|2133357_2134308_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_047122784.1\|2134267_2134681_-	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.8e-36	59.0
WP_003816708.1\|2134965_2135265_+	hypothetical protein	NA	NA	NA	NA
WP_010930783.1\|2135674_2137957_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.2e-36	30.1
WP_124740709.1\|2138422_2138617_+	hypothetical protein	NA	NA	NA	NA
WP_010930784.1\|2138642_2140673_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.0e-65	41.9
WP_006218592.1\|2140692_2140905_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_003810720.1\|2141182_2141722_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_023852902.1\|2141835_2143131_-	adenylosuccinate synthase	A0A160ER07	Powai_lake_megavirus	3.0e-63	33.5
WP_010930786.1\|2143207_2144365_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_010930787.1\|2144548_2145448_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_010930788.1\|2145466_2146771_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_010930789.1\|2146736_2147843_-	GTPase HflX	NA	NA	NA	NA
WP_003810707.1\|2147930_2148167_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_010930790.1\|2148305_2149376_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
WP_003810703.1\|2149379_2150735_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_003810701.1\|2150761_2151922_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_010930791.1\|2151924_2152563_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_023995843.1\|2152564_2153851_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_010930793.1\|2153909_2155205_-	flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase	NA	NA	NA	NA
WP_003810693.1\|2155211_2155718_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004568542.1\|2155714_2156863_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_003810689.1\|2156890_2157316_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
WP_010930794.1\|2157638_2160521_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
WP_023852900.1\|2160613_2161369_-	MipA/OmpV family protein	NA	NA	NA	NA
WP_010930796.1\|2162134_2163484_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_076879566.1\|2163582_2164533_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930048.1\|2164631_2165582_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930594.1\|2165655_2166129_+	RidA family protein	NA	NA	NA	NA
WP_010930593.1\|2166154_2167363_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_003816734.1\|2167359_2168133_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_014905757.1\|2168132_2168756_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_010926757.1\|2168921_2169182_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_010930591.1\|2169485_2170067_+	hypothetical protein	NA	NA	NA	NA
WP_004568544.1\|2170133_2170388_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_010930590.1\|2170374_2172999_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4

DBSCAN-SWA_19

2200782 : 2266331

Lake_Baikal_phage(20.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929577.1\|2200782_2201733_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930573.1\|2201933_2202743_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_005013747.1\|2202867_2203818_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930572.1\|2203814_2204708_-	methylglyoxal synthase	NA	NA	NA	NA
WP_003812452.1\|2204832_2205027_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003812453.1\|2205026_2205368_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_010930571.1\|2205377_2207240_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
WP_003812456.1\|2207369_2207882_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_003812458.1\|2207884_2208208_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
WP_003812460.1\|2208209_2208620_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
WP_010930570.1\|2208657_2209869_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
WP_003812463.1\|2209886_2210399_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
WP_010930569.1\|2210614_2211106_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_010930568.1\|2211358_2213395_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_019247244.1\|2213472_2214675_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
WP_010930566.1\|2214803_2215454_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	3.3e-10	50.7
WP_005012067.1\|2217011_2217962_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247934.1\|2218532_2218745_-	hypothetical protein	NA	NA	NA	NA
WP_019247935.1\|2218762_2219494_-	hypothetical protein	NA	NA	NA	NA
WP_003812478.1\|2219528_2220170_-	CoA transferase subunit B	NA	NA	NA	NA
WP_010930565.1\|2220162_2220831_-	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_010930564.1\|2223043_2223820_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010930563.1\|2223841_2224999_-	thiolase	NA	NA	NA	NA
WP_003812491.1\|2224995_2225427_-	OB-fold domain-containing protein	NA	NA	NA	NA
WP_015063637.1\|2225423_2226227_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010930561.1\|2226240_2226642_-	MaoC family dehydratase	NA	NA	NA	NA
WP_010930560.1\|2226708_2227680_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930559.1\|2227745_2228969_-	CoA transferase	NA	NA	NA	NA
WP_019247936.1\|2229196_2230147_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930557.1\|2230270_2232724_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
WP_010930556.1\|2232912_2234217_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
WP_003812508.1\|2234321_2234975_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
WP_010930555.1\|2234977_2236288_-	trigger factor	NA	NA	NA	NA
WP_010930554.1\|2236484_2237045_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
WP_010930553.1\|2237156_2237357_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
WP_003812519.1\|2237702_2238269_-	DUF924 family protein	NA	NA	NA	NA
WP_010930551.1\|2238352_2238556_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
WP_003812524.1\|2238862_2239183_-	hypothetical protein	NA	NA	NA	NA
WP_003812526.1\|2239224_2239506_-	membrane protein	NA	NA	NA	NA
WP_010930550.1\|2239580_2240837_-	autotransporter Phg	NA	NA	NA	NA
WP_010930549.1\|2241219_2241549_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_003812536.1\|2243119_2243941_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_010930548.1\|2243940_2245080_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_019247938.1\|2245086_2245983_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_010930546.1\|2245979_2247905_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
WP_010926400.1\|2248264_2250877_+	TonB-dependent receptor	NA	NA	NA	NA
WP_003812546.1\|2250929_2253230_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	9.9e-110	35.9
WP_003812548.1\|2253226_2254435_-	fatty acid desaturase	NA	NA	NA	NA
WP_010930545.1\|2254696_2255071_+	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|2255067_2256018_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_076879626.1\|2256116_2258111_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.4e-21	33.3
WP_010930543.1\|2258170_2259136_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_010930542.1\|2259125_2261987_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
WP_010930541.1\|2261989_2262496_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_010930540.1\|2262600_2263809_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
WP_033446178.1\|2263810_2264749_-	membrane protein	NA	NA	NA	NA
WP_010930538.1\|2264910_2265384_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_005012808.1\|2265380_2266331_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2352508 : 2416086

uncultured_Caudovirales_phage(11.11%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010931070.1\|2352508_2353459_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003809615.1\|2353760_2354237_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_019247142.1\|2354860_2356498_+	Tar ligand binding domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-12	30.2
WP_003809610.1\|2356528_2357842_-	pyrimidine permease	Q9KX94	Enterobacteria_phage	2.1e-149	67.1
WP_004568205.1\|2357975_2358293_+	hypothetical protein	NA	NA	NA	NA
WP_023852827.1\|2358393_2359716_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_010929591.1\|2359712_2360663_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929591.1\|2360761_2361712_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010930836.1\|2362241_2363264_-	putative 2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003820286.1\|2363292_2364123_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_029443740.1\|2364139_2365837_-	putative 2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
WP_010930838.1\|2365901_2366978_-	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-28	35.8
WP_010930839.1\|2367137_2368001_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010930840.1\|2368031_2368601_+	HD domain-containing protein	NA	NA	NA	NA
WP_010930841.1\|2368617_2369469_-	sulfurtransferase	NA	NA	NA	NA
WP_003813142.1\|2370526_2371408_+\|protease	protease HtpX	NA	NA	NA	NA
WP_010930842.1\|2371482_2372472_-	quinone oxidoreductase	NA	NA	NA	NA
WP_010930843.1\|2372534_2373485_-	DMT family transporter	NA	NA	NA	NA
WP_003813147.1\|2373547_2374405_+	DMT family transporter	NA	NA	NA	NA
WP_003813149.1\|2374464_2374953_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_010930844.1\|2376525_2377716_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_010930845.1\|2377712_2379299_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_010930846.1\|2379317_2380385_-	tartrate dehydrogenase	NA	NA	NA	NA
WP_010930847.1\|2380489_2382034_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	3.1e-14	25.4
WP_010930848.1\|2382453_2384028_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930849.1\|2384135_2385152_+	ABC transporter permease	NA	NA	NA	NA
WP_003813165.1\|2385148_2385988_+	ABC transporter permease	NA	NA	NA	NA
WP_010930850.1\|2385992_2387630_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-21	30.6
WP_005013747.1\|2387626_2388577_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268683.1\|2388594_2388738_+	hypothetical protein	NA	NA	NA	NA
WP_010930851.1\|2388719_2389994_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.6e-24	27.9
WP_010930852.1\|2390023_2390314_+	cupin domain-containing protein	NA	NA	NA	NA
WP_047122810.1\|2390386_2391400_+	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	1.7e-42	35.2
WP_010930854.1\|2391419_2392682_+	Zn-dependent hydrolase	NA	NA	NA	NA
WP_010930855.1\|2392684_2393608_+	DMT family transporter	NA	NA	NA	NA
WP_010930856.1\|2393604_2395098_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_010930857.1\|2395108_2396041_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_076879554.1\|2396222_2397548_+	aspartate aminotransferase family protein	A0A1C9EHH3	Mycobacterium_phage	1.8e-07	22.5
WP_023853659.1\|2397582_2398926_-	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_023853666.1\|2398998_2400519_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.7e-78	44.9
WP_010930861.1\|2400673_2401405_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_010930862.1\|2401472_2402813_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_010930863.1\|2402828_2403740_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_010930864.1\|2403730_2404324_+	nicotinate (nicotinamide) nucleotide adenylyltransferase	NA	NA	NA	NA
WP_003813196.1\|2404385_2404772_+	ribosome silencing factor	NA	NA	NA	NA
WP_003813199.1\|2404783_2405254_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_010930865.1\|2405265_2405889_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_010930866.1\|2405909_2408657_-	autotransporter Vag8	NA	NA	NA	NA
WP_005012808.1\|2415135_2416086_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2687023 : 2727691

Salmonella_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929591.1\|2687023_2687974_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_004567479.1\|2688084_2688267_+	hypothetical protein	NA	NA	NA	NA
WP_010931004.1\|2688366_2688963_-	lipoprotein	NA	NA	NA	NA
WP_010931005.1\|2689146_2690238_+	hypothetical protein	NA	NA	NA	NA
WP_003812822.1\|2690737_2691148_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_010931006.1\|2691206_2691548_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.8e-13	42.2
WP_010931007.1\|2691553_2693971_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_010926359.1\|2693983_2695006_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
WP_003812832.1\|2695080_2695440_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003812834.1\|2695455_2695653_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_010929584.1\|2695988_2696939_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003816756.1\|2697133_2697583_+	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
WP_005012808.1\|2697579_2698530_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931008.1\|2698640_2700089_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010931009.1\|2700203_2700485_-	hypothetical protein	NA	NA	NA	NA
WP_005013747.1\|2700588_2701539_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003820420.1\|2701783_2702497_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_019247724.1\|2702619_2702847_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003816758.1\|2703141_2703780_-	DedA family protein	NA	NA	NA	NA
WP_010931011.1\|2703888_2704923_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_010929591.1\|2704919_2705870_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931012.1\|2706285_2706810_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
WP_004567322.1\|2706813_2707083_-	hypothetical protein	NA	NA	NA	NA
WP_010931013.1\|2707281_2708343_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_010931014.1\|2708426_2710061_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
WP_010931015.1\|2710062_2710866_-	ABC transporter permease	NA	NA	NA	NA
WP_010931016.1\|2710894_2711854_-	ABC transporter permease	NA	NA	NA	NA
WP_010931017.1\|2711857_2713372_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_019248147.1\|2713408_2714413_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_033456131.1\|2714420_2714654_-	hypothetical protein	NA	NA	NA	NA
WP_010931018.1\|2714843_2715314_-	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_010931019.1\|2715349_2715961_-	LysE family translocator	NA	NA	NA	NA
WP_010931020.1\|2715991_2716615_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_010931021.1\|2716695_2718228_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010931022.1\|2718262_2719504_-	MFS transporter	NA	NA	NA	NA
WP_010931023.1\|2719547_2720579_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L339	Tupanvirus	1.8e-26	27.8
WP_010931024.1\|2720575_2721745_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_010931025.1\|2721738_2722419_-	cupin domain-containing protein	NA	NA	NA	NA
WP_010931026.1\|2722580_2723423_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931027.1\|2723585_2724557_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010931028.1\|2724728_2725607_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010931029.1\|2725629_2726700_-	FUSC family protein	NA	NA	NA	NA
WP_005013747.1\|2726740_2727691_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2783156 : 2856026

Moraxella_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003810909.1\|2783156_2783573_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_010931061.1\|2783683_2784316_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
WP_010931062.1\|2784344_2784788_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_003810897.1\|2784809_2785901_-	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_010931063.1\|2785955_2786756_-	aldolase	NA	NA	NA	NA
WP_010931064.1\|2786891_2787512_+	cupin domain-containing protein	NA	NA	NA	NA
WP_010931065.1\|2787651_2788125_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|2789264_2790215_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931066.1\|2790211_2797873_-	hemagglutinin repeat-containing protein	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
WP_010931067.1\|2798113_2802160_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
WP_003816847.1\|2802472_2803054_+	TRAP transporter small permease	NA	NA	NA	NA
WP_010931068.1\|2803050_2804349_+	TRAP transporter large permease	NA	NA	NA	NA
WP_010931069.1\|2804428_2805457_+	DctP family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_010931070.1\|2805717_2806668_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927663.1\|2806664_2807615_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931071.1\|2807931_2808537_+	fimbrial major subunit FimX	NA	NA	NA	NA
WP_010931072.1\|2808590_2809904_-	phenylacetate--CoA ligase	NA	NA	NA	NA
WP_003813284.1\|2809978_2810449_-	hydroxyphenylacetyl-CoA thioesterase PaaI	NA	NA	NA	NA
WP_010931073.1\|2810448_2811237_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
WP_010931074.1\|2811247_2812900_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
WP_010929591.1\|2812987_2813938_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931075.1\|2815099_2815606_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
WP_003813293.1\|2815602_2816367_-	phenylacetate-CoA oxygenase subunit PaaC	NA	NA	NA	NA
WP_010931076.1\|2816382_2816667_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
WP_003813298.1\|2816731_2817721_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
WP_010931077.1\|2817892_2818822_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
WP_003813302.1\|2818793_2819480_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_003813303.1\|2819513_2820059_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
WP_003813306.1\|2820103_2821369_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_003813309.1\|2821365_2822268_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_019247679.1\|2823449_2824394_-	ABC transporter permease	NA	NA	NA	NA
WP_010931079.1\|2824488_2826006_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010931080.1\|2826047_2827676_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_003811986.1\|2827783_2828665_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_010931081.1\|2831777_2832152_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
WP_003812004.1\|2832176_2832515_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_010931082.1\|2832558_2834193_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
WP_010931083.1\|2834231_2835578_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_003812010.1\|2835685_2837107_+	argininosuccinate lyase	NA	NA	NA	NA
WP_010931084.1\|2837176_2837761_-	nitroreductase	NA	NA	NA	NA
WP_005012067.1\|2837863_2838814_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931085.1\|2838948_2840055_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010931086.1\|2840065_2841163_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_010931087.1\|2841307_2842513_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_010931088.1\|2842519_2843041_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_010931089.1\|2843037_2843529_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_003819740.1\|2843525_2843777_-	MoaD/ThiS family protein	NA	NA	NA	NA
WP_003819741.1\|2843757_2844243_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_010931090.1\|2844378_2847840_+	DUF748 domain-containing protein	NA	NA	NA	NA
WP_010931091.1\|2847857_2848742_+	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_010931092.1\|2848751_2849183_-	lipoprotein	NA	NA	NA	NA
WP_003809348.1\|2849429_2849933_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
WP_010931094.1\|2850010_2851411_+	MFS transporter	NA	NA	NA	NA
WP_010931095.1\|2851485_2852361_-	membrane protein	NA	NA	NA	NA
WP_023853546.1\|2852357_2853365_-	biotin synthase BioB	NA	NA	NA	NA
WP_010931097.1\|2853832_2854138_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_003819753.1\|2854228_2854819_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010930525.1\|2855009_2856026_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

2859169 : 2925980

uncultured_Mediterranean_phage(28.57%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929956.1\|2859169_2860120_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|2860218_2861169_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931099.1\|2861165_2861960_-	N-formylglutamate deformylase	NA	NA	NA	NA
WP_010931100.1\|2861991_2862696_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010931101.1\|2862770_2863571_-	SURF1 family protein	NA	NA	NA	NA
WP_003809276.1\|2863567_2863975_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_003819722.1\|2863971_2864613_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_010931102.1\|2864605_2866606_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_010931103.1\|2867866_2869198_+	MFS transporter	NA	NA	NA	NA
WP_005012067.1\|2869194_2870145_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931105.1\|2871851_2872118_-	accessory factor UbiK family protein	NA	NA	NA	NA
WP_003812839.1\|2872825_2873164_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_010931107.1\|2877717_2878320_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010931108.1\|2878416_2879706_+	MFS transporter	NA	NA	NA	NA
WP_003812846.1\|2879763_2880495_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
WP_010931109.1\|2880491_2881295_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
WP_003812851.1\|2881291_2882380_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_003820410.1\|2882376_2883306_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_003812857.1\|2883454_2884600_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930800.1\|2884621_2885572_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_154698391.1\|2885589_2885748_+	hypothetical protein	NA	NA	NA	NA
WP_010931110.1\|2885902_2889724_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_010931111.1\|2889880_2890549_-	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_014905522.1\|2890553_2892227_-	MCE family protein	NA	NA	NA	NA
WP_003820402.1\|2892245_2893565_-	PqiA/YebS family transporter subunit	NA	NA	NA	NA
WP_010931114.1\|2893569_2895885_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.1e-164	41.9
WP_010931115.1\|2895940_2898109_-	penicillin-binding protein 1C	NA	NA	NA	NA
WP_010931116.1\|2898105_2903295_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_003820400.1\|2903384_2903699_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
WP_003812875.1\|2903926_2904172_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
WP_003820399.1\|2904266_2904785_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
WP_010931117.1\|2904884_2906090_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_019247560.1\|2906205_2907603_-	chloride channel protein	NA	NA	NA	NA
WP_010931119.1\|2907719_2908298_-	superoxide dismutase [Fe]	NA	NA	NA	NA
WP_010931120.1\|2908370_2909762_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
WP_005012067.1\|2909929_2910880_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003812889.1\|2911160_2911781_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_010931122.1\|2911777_2912191_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_010931123.1\|2912187_2913231_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_003812895.1\|2913286_2913475_+	Trm112 family protein	NA	NA	NA	NA
WP_010931124.1\|2913484_2914249_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_010931125.1\|2914339_2914996_+	adenylate kinase	NA	NA	NA	NA
WP_010931126.1\|2915087_2915846_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_010931127.1\|2915871_2917473_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_010931128.1\|2917673_2918678_+	FecR domain-containing protein	NA	NA	NA	NA
WP_003812908.1\|2918778_2919042_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_010931129.1\|2919159_2919936_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_005012067.1\|2920526_2921477_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931130.1\|2923860_2924973_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_005012808.1\|2925029_2925980_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

2956366 : 2995555

Planktothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012067.1\|2956366_2957317_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162268686.1\|2957334_2957484_+	hypothetical protein	NA	NA	NA	NA
WP_023852715.1\|2957437_2958334_-	inositol monophosphatase	NA	NA	NA	NA
WP_003814547.1\|2960611_2962837_+	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_003814544.1\|2963001_2964090_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.7e-32	36.4
WP_019247918.1\|2964046_2964700_+	ABC transporter permease	NA	NA	NA	NA
WP_010931144.1\|2964747_2965545_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010930176.1\|2966076_2967027_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247277.1\|2967101_2968256_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_005012067.1\|2968312_2969263_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814535.1\|2969361_2969667_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_003820797.1\|2969695_2970130_-	DUF126 domain-containing protein	NA	NA	NA	NA
WP_010931147.1\|2970131_2971376_-	DUF521 domain-containing protein	NA	NA	NA	NA
WP_003820799.1\|2971372_2972083_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_033446288.1\|2972097_2973009_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931149.1\|2973371_2973776_+	hypothetical protein	NA	NA	NA	NA
WP_019247890.1\|2973772_2974231_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_019247891.1\|2974237_2975146_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_010931150.1\|2975142_2976009_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_003814524.1\|2975995_2976823_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_003820806.1\|2976833_2977961_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
WP_023852748.1\|2979038_2980277_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_010931152.1\|2980318_2981581_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_010931153.1\|2981587_2982340_+	DNA-binding protein	NA	NA	NA	NA
WP_019248355.1\|2982391_2982577_-	hypothetical protein	NA	NA	NA	NA
WP_003820813.1\|2982852_2983317_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_003820814.1\|2983348_2984008_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_010931154.1\|2984152_2986261_+	AsmA family protein	NA	NA	NA	NA
WP_076879634.1\|2986257_2987208_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931155.1\|2987311_2987932_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_010931156.1\|2988023_2988776_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_019248356.1\|2989910_2991035_-	hypothetical protein	NA	NA	NA	NA
WP_019247402.1\|2991080_2991449_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|2991690_2992641_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247492.1\|2993676_2994219_-	hypothetical protein	NA	NA	NA	NA
WP_023998107.1\|2994416_2994587_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|2994604_2995555_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3122640 : 3186475

Pseudomonas_phage(30.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005015810.1\|3122640_3123591_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_047122802.1\|3123736_3124861_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.8e-38	33.3
WP_023853315.1\|3125066_3125630_+	isochorismatase family protein	NA	NA	NA	NA
WP_003814871.1\|3126624_3127107_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_003814873.1\|3127264_3128512_-	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	1.1e-99	52.7
WP_003820605.1\|3128732_3129389_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003814877.1\|3129424_3130654_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
WP_158516320.1\|3130748_3130904_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|3130921_3131872_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931221.1\|3131963_3133379_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.9e-18	46.9
WP_010931222.1\|3133384_3134521_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_003814883.1\|3134590_3134962_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.7e-30	56.9
WP_010931223.1\|3135049_3135796_-	membrane protein	NA	NA	NA	NA
WP_003820599.1\|3135832_3136897_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_010931224.1\|3137085_3137478_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_010927106.1\|3137487_3137916_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_004567739.1\|3138211_3139309_-	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_004567741.1\|3139650_3141015_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_023853313.1\|3141073_3141625_+	ribosome-associated protein	NA	NA	NA	NA
WP_010931226.1\|3141638_3142313_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_010931227.1\|3143569_3144379_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-33	37.9
WP_010931228.1\|3144381_3145218_+	ABC transporter permease	NA	NA	NA	NA
WP_003820594.1\|3145232_3145925_+	cysteine hydrolase	NA	NA	NA	NA
WP_003820593.1\|3145936_3146326_-	VOC family protein	NA	NA	NA	NA
WP_003820592.1\|3146431_3147820_-	ATP-dependent RNA helicase DbpA	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-54	33.5
WP_010931229.1\|3147936_3149433_-	membrane protein	NA	NA	NA	NA
WP_010931230.1\|3149729_3150404_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3150502_3151453_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931231.1\|3151449_3153909_-	bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003814917.1\|3154005_3155451_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_010931233.1\|3155454_3156642_-	MFS transporter	NA	NA	NA	NA
WP_023998238.1\|3156710_3157220_-	lipoprotein	NA	NA	NA	NA
WP_003814925.1\|3157421_3157874_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_192855352.1\|3157846_3158413_-	hypothetical protein	NA	NA	NA	NA
WP_019247415.1\|3158435_3161498_+	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
WP_010931235.1\|3161803_3164731_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	3.4e-171	43.9
WP_003814929.1\|3164752_3165949_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	1.0e-33	28.9
WP_010931236.1\|3166266_3166794_+	histone H1-like DNA-binding protein	NA	NA	NA	NA
WP_010931237.1\|3166932_3167508_+	YggT family protein	NA	NA	NA	NA
WP_010931238.1\|3167515_3168979_-	D-alanine--poly(phosphoribitol) ligase	A0A2K9L3I8	Tupanvirus	7.3e-26	25.1
WP_010931239.1\|3168989_3170117_-	membrane-bound O-acyltransferase	A0A125RNP0	Pseudomonas_phage	3.7e-25	30.8
WP_003814941.1\|3170246_3171374_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003814943.1\|3171399_3171639_-	acyl carrier protein	NA	NA	NA	NA
WP_010931240.1\|3171919_3172423_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_010931241.1\|3172595_3173537_-	carbohydrate kinase family protein	NA	NA	NA	NA
WP_010931242.1\|3173548_3174646_-	DUF3426 domain-containing protein	NA	NA	NA	NA
WP_003814951.1\|3175611_3176958_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_003814952.1\|3176967_3177417_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_003814953.1\|3177506_3177941_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_023853327.1\|3178019_3178568_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_003814955.1\|3178650_3180021_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_010931244.1\|3180031_3180625_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_014486102.1\|3180696_3182580_+	RNB domain-containing ribonuclease	NA	NA	NA	NA
WP_010931246.1\|3182617_3183517_+	TonB family protein	NA	NA	NA	NA
WP_010931247.1\|3183513_3184377_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_010929853.1\|3184475_3185426_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|3185524_3186475_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_26

3234619 : 3249856

Erwinia_phage(100.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|3234619_3235570_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814611.1\|3236014_3236326_-	cell division protein ZapA	NA	NA	NA	NA
WP_003820745.1\|3236325_3236856_-	hypothetical protein	NA	NA	NA	NA
WP_127013038.1\|3236812_3237001_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|3237018_3237969_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|3238067_3239018_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003820744.1\|3239307_3239772_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
WP_010931270.1\|3239786_3241292_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_023853019.1\|3241548_3243153_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_003814620.1\|3243208_3244114_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_005013747.1\|3244554_3245505_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|3245603_3246554_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023853416.1\|3246635_3247217_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_003807161.1\|3247641_3247947_+	copper-binding protein	NA	NA	NA	NA
WP_003807162.1\|3247960_3249295_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
WP_010931291.1\|3249316_3249856_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA

DBSCAN-SWA_27

3268279 : 3330344

Tupanvirus(12.5%)

holin,transposase,integrase,tRNA

attL 3261673:3261691|attR 3334431:3334449

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3261673:3261691	attL	NA	NA	NA	NA
WP_010931277.1\|3268279_3268615_+\|holin	phage holin family protein	NA	NA	NA	NA
WP_003807199.1\|3268614_3269457_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_005013747.1\|3269555_3270506_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818443.1\|3270570_3271542_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003818444.1\|3271605_3272625_-	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
WP_003807204.1\|3272626_3274000_-	MHS family MFS transporter	NA	NA	NA	NA
WP_010931276.1\|3274277_3274958_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_023995440.1\|3274970_3277097_+	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	5.5e-14	36.6
WP_010931274.1\|3277093_3278188_+\|tRNA	CCA tRNA nucleotidyltransferase	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
WP_004566001.1\|3278202_3279462_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010931273.1\|3279481_3281206_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.5e-49	32.9
WP_003818450.1\|3281444_3282197_-	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
WP_005012808.1\|3282335_3283286_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443788.1\|3283598_3285077_+	phospholipase D family protein	NA	NA	NA	NA
WP_010931293.1\|3285083_3286193_-	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-23	34.5
WP_003808339.1\|3286204_3286885_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_003808340.1\|3286906_3287662_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010925959.1\|3287797_3288682_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_010931294.1\|3288769_3289351_+	CGNR zinc finger domain-containing protein	NA	NA	NA	NA
WP_004566249.1\|3289611_3289911_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_010931296.1\|3290062_3290542_-	membrane protein	NA	NA	NA	NA
WP_023853362.1\|3291261_3292698_-	TonB-dependent receptor	NA	NA	NA	NA
WP_003808356.1\|3292694_3293198_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3293213_3294164_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003814148.1\|3294691_3295465_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003814146.1\|3295597_3296608_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931298.1\|3296759_3298415_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
WP_003814142.1\|3298469_3298811_-	cupin domain-containing protein	NA	NA	NA	NA
WP_010931299.1\|3298824_3300264_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003814139.1\|3300396_3301212_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_023994811.1\|3301175_3301388_-	hypothetical protein	NA	NA	NA	NA
WP_005012067.1\|3301405_3302356_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443749.1\|3303743_3304691_+	hypothetical protein	NA	NA	NA	NA
WP_014905961.1\|3304917_3305658_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3305743_3306694_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_162291319.1\|3306711_3306867_+	hypothetical protein	NA	NA	NA	NA
WP_014905963.1\|3308135_3309707_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_019247179.1\|3310039_3311893_+	autotransporter-associated beta strand repeat-containing protein	NA	NA	NA	NA
WP_019247178.1\|3311937_3314502_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_005012067.1\|3314920_3315871_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_077274087.1\|3318736_3319231_-	DUF4276 family protein	NA	NA	NA	NA
WP_010931070.1\|3319247_3320198_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931301.1\|3320381_3321593_-	AAA family ATPase	NA	NA	NA	NA
WP_010931302.1\|3321608_3324560_-	restriction endonuclease subunit M	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
WP_010931303.1\|3324561_3327681_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_010931304.1\|3327828_3328875_-	Fic family protein	NA	NA	NA	NA
WP_010931305.1\|3329216_3330344_-\|integrase	site-specific integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
3334431:3334449	attR	NA	NA	NA	NA

DBSCAN-SWA_28

3382101 : 3435842

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023995489.1\|3382101_3383052_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931336.1\|3383456_3384101_-	urease accessory protein UreG	NA	NA	NA	NA
WP_019247677.1\|3384125_3384710_-	urease accessory protein UreF	NA	NA	NA	NA
WP_014905506.1\|3384810_3385428_-	urease accessory protein UreE	NA	NA	NA	NA
WP_010931337.1\|3385430_3387146_-	urease subunit alpha	NA	NA	NA	NA
WP_010931338.1\|3387142_3387451_-	urease subunit beta	NA	NA	NA	NA
WP_003814828.1\|3387467_3388085_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_010931340.1\|3388129_3388432_-	urease subunit gamma	NA	NA	NA	NA
WP_003814832.1\|3388532_3389387_-	urease accessory protein UreD	NA	NA	NA	NA
WP_124740609.1\|3389574_3389799_-	hypothetical protein	NA	NA	NA	NA
WP_010929281.1\|3389968_3390241_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_010929282.1\|3390658_3391066_-	GFA family protein	NA	NA	NA	NA
WP_010931341.1\|3391435_3392230_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_010927102.1\|3392330_3393566_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
WP_003814852.1\|3393634_3394651_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931342.1\|3394662_3396039_+	MmgE/PrpD family protein	NA	NA	NA	NA
WP_003814856.1\|3396035_3397232_+	MFS transporter	NA	NA	NA	NA
WP_003814858.1\|3397228_3398767_-	SpoVR family protein	NA	NA	NA	NA
WP_010931343.1\|3398763_3400023_-	YeaH/YhbH family protein	NA	NA	NA	NA
WP_005012067.1\|3401963_3402914_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931344.1\|3403680_3404775_-	CoA transferase	NA	NA	NA	NA
WP_019247312.1\|3404767_3406102_-	AMP-binding protein	NA	NA	NA	NA
WP_003808193.1\|3406055_3406739_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_003808195.1\|3406764_3407928_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_004566224.1\|3407924_3408926_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931346.1\|3408925_3409798_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_010931347.1\|3409794_3410544_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
WP_010931348.1\|3410540_3411332_-	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
WP_010931349.1\|3411328_3412468_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_047122778.1\|3412743_3413529_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_014486103.1\|3413562_3414345_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_010931351.1\|3414348_3414738_+	OB-fold domain-containing protein	NA	NA	NA	NA
WP_010931352.1\|3415877_3416741_+	MaoC family dehydratase N-terminal domain-containing protein	NA	NA	NA	NA
WP_010931353.1\|3416776_3417865_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_010931070.1\|3417861_3418812_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247959.1\|3419165_3422144_+	hypothetical protein	NA	NA	NA	NA
WP_003818344.1\|3423070_3423949_+	fatty acid desaturase	NA	NA	NA	NA
WP_005013747.1\|3425897_3426848_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931354.1\|3426844_3427312_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
WP_010931355.1\|3427354_3428125_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010927090.1\|3428145_3428946_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_010931356.1\|3428956_3430366_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_003814739.1\|3430460_3431246_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_010931561.1\|3431485_3432502_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003814742.1\|3432609_3433002_-	OsmC family protein	NA	NA	NA	NA
WP_010931357.1\|3433139_3433820_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_023994844.1\|3433824_3434796_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010930179.1\|3434891_3435842_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_29

3441997 : 3501297

Acinetobacter_phage(27.27%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003820957.1\|3441997_3443761_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
WP_010931362.1\|3443872_3444751_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_003814250.1\|3444863_3445679_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_003814252.1\|3445682_3445934_+	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_010929632.1\|3446018_3447035_-\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_003814254.1\|3447365_3447587_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_019247693.1\|3449947_3450865_-	DMT family transporter	NA	NA	NA	NA
WP_019247692.1\|3451362_3452571_-	ABC transporter permease	NA	NA	NA	NA
WP_010931365.1\|3452650_3454222_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003814275.1\|3454339_3455275_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003814277.1\|3455463_3456408_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
WP_003814283.1\|3456975_3462693_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
WP_010931367.1\|3462698_3463826_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.8e-38	37.8
WP_003814287.1\|3463881_3464508_+	aminotransferase class IV	NA	NA	NA	NA
WP_010931363.1\|3464779_3465796_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA
WP_010927020.1\|3465891_3466602_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_010931368.1\|3466598_3467588_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010931369.1\|3467683_3469315_+	AMP-binding protein	NA	NA	NA	NA
WP_010931370.1\|3469317_3470055_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_019247745.1\|3470210_3471083_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_003814298.1\|3471351_3472572_+	MFS transporter	NA	NA	NA	NA
WP_003814300.1\|3472568_3473228_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_003814302.1\|3473299_3473932_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_010931372.1\|3473961_3474480_+	flavin reductase family protein	NA	NA	NA	NA
WP_010931373.1\|3474490_3475600_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003814312.1\|3475646_3476501_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_010931374.1\|3476502_3477405_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3478627_3479578_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023997720.1\|3481334_3482324_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_019247413.1\|3482320_3482479_+	hypothetical protein	NA	NA	NA	NA
WP_010931375.1\|3482499_3483288_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
WP_003817833.1\|3483284_3484316_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
WP_003815390.1\|3484334_3484898_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
WP_010931376.1\|3484953_3486474_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
WP_010931377.1\|3486737_3487442_-	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_003815384.1\|3487449_3488187_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003815381.1\|3488292_3488667_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_003815379.1\|3488709_3489999_+	murein transglycosylase A	NA	NA	NA	NA
WP_010931378.1\|3489995_3491165_+	UbiH/UbiF family hydroxylase	NA	NA	NA	NA
WP_010931379.1\|3491161_3492001_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
WP_010931380.1\|3492060_3492996_+	D-2-hydroxyacid dehydrogenase family protein	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
WP_005012067.1\|3493008_3493959_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931381.1\|3494057_3495020_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
WP_003817821.1\|3495051_3495411_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_010931382.1\|3495535_3496438_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
WP_010931383.1\|3496439_3498212_-	M61 family metallopeptidase	NA	NA	NA	NA
WP_003815367.1\|3498246_3499023_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_023852617.1\|3500346_3501297_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_30

3516235 : 3574308

Planktothrix_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005012808.1\|3516235_3517186_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931392.1\|3517314_3518448_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_010931393.1\|3518491_3519397_-	hydrolase	NA	NA	NA	NA
WP_023852622.1\|3519399_3521100_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
WP_010931394.1\|3521096_3522017_-	ABC transporter permease	NA	NA	NA	NA
WP_003817805.1\|3522024_3523002_-	ABC transporter permease	NA	NA	NA	NA
WP_010931395.1\|3523060_3524095_-	succinylglutamate desuccinylase/aspartoacylase family protein	NA	NA	NA	NA
WP_003815317.1\|3526069_3526306_-	hypothetical protein	NA	NA	NA	NA
WP_010931396.1\|3526432_3527296_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_003815315.1\|3527384_3528206_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_003815313.1\|3528285_3529023_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010931397.1\|3529019_3530012_-	nitronate monooxygenase	NA	NA	NA	NA
WP_003817794.1\|3530125_3530788_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_010931399.1\|3530832_3531981_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_010931400.1\|3534304_3535255_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_014486105.1\|3535595_3536546_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|3536644_3537595_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_029443756.1\|3537891_3538389_+	cupredoxin family protein	NA	NA	NA	NA
WP_010931403.1\|3538431_3540207_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_010931404.1\|3540214_3541081_+	copper resistance protein B	NA	NA	NA	NA
WP_019249391.1\|3541087_3541822_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010931406.1\|3542991_3543786_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_003815296.1\|3544075_3544666_+	cysteine dioxygenase	NA	NA	NA	NA
WP_010931407.1\|3544699_3546028_-	amidase	NA	NA	NA	NA
WP_010931408.1\|3546102_3547248_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014905478.1\|3547359_3548358_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_033446233.1\|3548320_3548755_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
WP_010929974.1\|3550271_3551156_+	DMT family transporter	NA	NA	NA	NA
WP_010929973.1\|3551152_3552358_-	cardiolipin synthase ClsB	NA	NA	NA	NA
WP_010929972.1\|3552354_3553215_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_003807038.1\|3553327_3555118_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
WP_003807035.1\|3555158_3555824_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	6.7e-11	28.4
WP_010929971.1\|3555824_3556133_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_010929970.1\|3556298_3557585_-	putative Na+/H+ antiporter	NA	NA	NA	NA
WP_010929969.1\|3559018_3559969_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929968.1\|3561920_3563135_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_003815171.1\|3563240_3564230_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
WP_003815172.1\|3564226_3564835_+	HAD-IIIA family hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
WP_010929967.1\|3564847_3565477_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003815175.1\|3565473_3566094_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_003815177.1\|3566125_3566917_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
WP_010929966.1\|3567768_3568224_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_010929965.1\|3568242_3569169_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_010929964.1\|3569222_3570509_-	cytochrome c	NA	NA	NA	NA
WP_003815183.1\|3571439_3572312_+	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
WP_010929963.1\|3572308_3573259_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
WP_005012067.1\|3573357_3574308_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_31

3706432 : 3838298

113

uncultured_Mediterranean_phage(10.34%)

tRNA,transposase,integrase

attL 3752125:3752142|attR 3794655:3794672

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010929577.1\|3706432_3707383_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005013747.1\|3707482_3708433_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929878.1\|3708429_3709065_-	LysE family transporter	NA	NA	NA	NA
WP_003818466.1\|3709194_3710094_+	LysR family transcriptional regulator ArgP	NA	NA	NA	NA
WP_003807278.1\|3710189_3710681_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_010929877.1\|3710727_3711693_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929876.1\|3712826_3714068_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.9e-14	24.9
WP_003807287.1\|3714181_3715198_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	3.5e-75	43.8
WP_010929875.1\|3715232_3715709_-	membrane protein	NA	NA	NA	NA
WP_003807291.1\|3715851_3716760_-	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
WP_010929874.1\|3716873_3717986_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.9e-21	35.0
WP_023853429.1\|3718086_3718572_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_003818477.1\|3718708_3719959_+	kynureninase	NA	NA	NA	NA
WP_003807300.1\|3720060_3720573_+	peptide deformylase	E3SLL2	Synechococcus_phage	8.5e-22	43.3
WP_005013747.1\|3720671_3721622_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929873.1\|3721687_3722626_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.4e-09	35.7
WP_010929872.1\|3722648_3723275_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_003818481.1\|3723271_3723928_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_010929871.1\|3723924_3724527_-	hypothetical protein	NA	NA	NA	NA
WP_010929870.1\|3724533_3725121_-	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	1.1e-07	23.3
WP_010929869.1\|3725301_3725871_+	bacterioferritin	NA	NA	NA	NA
WP_003807313.1\|3725941_3727261_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_003807315.1\|3727367_3727559_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_010929868.1\|3727810_3729100_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_010929867.1\|3729254_3730250_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807322.1\|3730334_3731009_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_005013747.1\|3731005_3731956_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003816336.1\|3732117_3733359_+	ornithine--oxo-acid transaminase	A0A1V0SKB7	Klosneuvirus	4.0e-25	25.2
WP_010929866.1\|3733355_3734300_+	arginase	A0A0N9R043	Chrysochromulina_ericina_virus	9.5e-27	33.3
WP_005012067.1\|3734418_3735369_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023853484.1\|3735328_3736258_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_003807759.1\|3736311_3736647_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_010929865.1\|3736691_3737456_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_010929864.1\|3737479_3738220_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_010929863.1\|3738227_3739781_-	acyl--CoA ligase	A0A2K9L3I8	Tupanvirus	1.5e-13	22.6
WP_010929862.1\|3739815_3740793_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_023853476.1\|3741065_3741647_-	ureidoglycolate lyase	NA	NA	NA	NA
WP_094145972.1\|3741698_3748601_-	autotransporter BatB	NA	NA	NA	NA
WP_003807750.1\|3749047_3749179_-	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_010929858.1\|3749444_3749651_-	DUF3596 domain-containing protein	NA	NA	NA	NA
WP_010929857.1\|3750655_3751315_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_010929856.1\|3751342_3752488_+	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
3752125:3752142	attL	NA	NA	NA	NA
WP_003807743.1\|3752628_3752964_+	YegP family protein	NA	NA	NA	NA
WP_010929855.1\|3753038_3753899_-	hypothetical protein	A0A2C9D0H9	Yersinia_phage	1.7e-51	53.6
WP_010929854.1\|3754162_3754864_-	glutathione S-transferase	NA	NA	NA	NA
WP_019248860.1\|3755033_3755429_+	RidA family protein	NA	NA	NA	NA
WP_005013747.1\|3755538_3756489_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929850.1\|3756524_3756992_+	hypothetical protein	Q3HQX1	Burkholderia_phage	2.1e-43	71.3
WP_010926411.1\|3757225_3757603_+	hypothetical protein	NA	NA	NA	NA
WP_010926410.1\|3757599_3757782_+	hypothetical protein	NA	NA	NA	NA
WP_010929849.1\|3757785_3758772_+	recombinase RecT	H9C0R8	Aeromonas_phage	2.0e-67	57.3
WP_010929848.1\|3758768_3759416_+	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	2.0e-31	41.4
WP_010929847.1\|3759473_3760001_+	hypothetical protein	NA	NA	NA	NA
WP_019247983.1\|3760037_3761222_+	hypothetical protein	A0A291L9X3	Bordetella_phage	1.5e-24	37.8
WP_010929845.1\|3761232_3761574_+	hypothetical protein	A0A0H5ARN8	Pseudomonas_phage	1.0e-10	45.3
WP_010926403.1\|3761686_3761887_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929843.1\|3761883_3762873_-\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	4.4e-75	44.4
WP_010929841.1\|3764359_3766330_-	type III secretion system effector BopC	NA	NA	NA	NA
WP_003814626.1\|3766571_3766970_+	hypothetical protein	NA	NA	NA	NA
WP_010929840.1\|3766978_3767902_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3768359_3769310_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010927254.1\|3769540_3771232_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_003816027.1\|3771280_3771553_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	7.0e-15	52.2
WP_003816026.1\|3771549_3771921_-	ribonuclease P protein component	NA	NA	NA	NA
WP_003816025.1\|3772016_3772151_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_010929554.1\|3772556_3773966_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_010929839.1\|3773968_3775078_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.2e-41	32.6
WP_010929838.1\|3775172_3777626_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.3e-112	34.8
WP_023853625.1\|3777744_3778536_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_010929836.1\|3778655_3780083_+	amidase	NA	NA	NA	NA
WP_010929835.1\|3780121_3781093_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929834.1\|3781511_3782675_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_010929833.1\|3782762_3783608_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_005012067.1\|3785164_3786115_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_003818201.1\|3786669_3787044_-	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_010929807.1\|3787118_3788177_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_005012067.1\|3788200_3789151_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929808.1\|3792032_3793202_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_003815953.1\|3793302_3794910_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	5.4e-22	57.3
3794655:3794672	attR	NA	NA	NA	NA
WP_010929810.1\|3794956_3796978_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_003815955.1\|3797006_3797252_-	DUF1653 domain-containing protein	NA	NA	NA	NA
WP_004565905.1\|3797265_3798456_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	4.4e-21	26.7
WP_010929811.1\|3798651_3799617_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_010929812.1\|3799639_3800779_-	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_010929813.1\|3800990_3801953_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_010929814.1\|3802076_3804101_+	TRAP transporter permease	NA	NA	NA	NA
WP_010929815.1\|3804297_3806541_+	TonB-dependent hemoglobin/transferrin/lactoferrin family receptor	NA	NA	NA	NA
WP_003815964.1\|3806819_3807278_+	DUF494 domain-containing protein	NA	NA	NA	NA
WP_010929816.1\|3808205_3810827_-	GDYXXLXY domain-containing protein	NA	NA	NA	NA
WP_010929817.1\|3810890_3813518_+	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	6.1e-23	25.4
WP_010929818.1\|3813669_3814734_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020699616.1\|3814733_3815504_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.1e-24	33.9
WP_010929819.1\|3815512_3816346_+	ABC transporter permease	NA	NA	NA	NA
WP_003818225.1\|3816358_3817138_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010929820.1\|3817211_3818645_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_010929821.1\|3818672_3819431_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_010929822.1\|3819486_3821337_-	biosynthetic-type acetolactate synthase large subunit	E4WLQ6	Ostreococcus_tauri_virus	2.2e-59	30.4
WP_010929823.1\|3821430_3821907_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_023853391.1\|3821923_3822844_-	bestrophin	NA	NA	NA	NA
WP_003818232.1\|3822950_3823451_+	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_010929826.1\|3823824_3824517_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.3e-36	41.6
WP_162268689.1\|3824631_3824808_-	hypothetical protein	NA	NA	NA	NA
WP_010929591.1\|3824825_3825776_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931556.1\|3825772_3829546_-	methionine synthase	A0A140XBC7	Dickeya_phage	8.6e-10	50.8
WP_010931557.1\|3829882_3831772_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	7.6e-07	30.8
WP_010931558.1\|3831783_3832677_+	cobalamin-binding protein	NA	NA	NA	NA
WP_010931559.1\|3832780_3833578_+	thiazole synthase	NA	NA	NA	NA
WP_010931560.1\|3833574_3834426_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003817656.1\|3834487_3835168_+	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.5e-15	34.8
WP_019247189.1\|3835195_3835531_+	TolC family protein	NA	NA	NA	NA
WP_019247190.1\|3835531_3836491_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_003815102.1\|3836511_3837000_-	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	1.6e-17	34.1
WP_010931561.1\|3837281_3838298_+\|transposase	IS110-like element IS1663 family transposase	NA	NA	NA	NA

DBSCAN-SWA_32

4027514 : 4070372

Planktothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010931661.1\|4027514_4028465_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010931662.1\|4028634_4029861_+	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_010931663.1\|4030060_4030927_+	ATP-binding protein	NA	NA	NA	NA
WP_003815027.1\|4030919_4031882_+	Nudix family hydrolase	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
WP_010927663.1\|4031982_4032933_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|4033031_4033982_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_005012067.1\|4034080_4035031_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_010929577.1\|4035129_4036080_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
WP_023994937.1\|4036076_4037570_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_003815032.1\|4037566_4040674_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_010931665.1\|4040670_4043739_-	MdtB/MuxB family multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_010931666.1\|4043735_4044986_-	MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003815038.1\|4045166_4045928_-	cell division protein ZapD	NA	NA	NA	NA
WP_019247320.1\|4045960_4046611_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_003820519.1\|4046613_4047453_-	prepilin peptidase	NA	NA	NA	NA
WP_003815047.1\|4047693_4048437_+	copper resistance protein NlpE N-terminal domain-containing protein	NA	NA	NA	NA
WP_003815049.1\|4048519_4048867_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003815051.1\|4048964_4049807_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_003815053.1\|4049851_4050739_-	segregation/condensation protein A	NA	NA	NA	NA
WP_003815055.1\|4050765_4050954_-	DUF3460 family protein	NA	NA	NA	NA
WP_010931669.1\|4051051_4052509_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_010931670.1\|4052495_4054022_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003815061.1\|4054040_4054508_-	CopD family protein	NA	NA	NA	NA
WP_010931671.1\|4054507_4055530_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_169507388.1\|4055650_4056370_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-34	39.9
WP_003815066.1\|4056445_4057546_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815068.1\|4057547_4058738_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003815070.1\|4058857_4059874_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
WP_003815073.1\|4060192_4060864_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.5e-29	38.2
WP_010927126.1\|4060860_4061769_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_010931672.1\|4061980_4062628_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
WP_010931673.1\|4066479_4067556_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_003815084.1\|4067566_4068376_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003815086.1\|4068465_4069239_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_023853189.1\|4069239_4069404_-	hypothetical protein	NA	NA	NA	NA
WP_010930363.1\|4069421_4070372_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP013082

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection