CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP019512	Enterococcus faecalis strain CLB21560 chromosome, complete genome	0 crisprs	csa3,cas3,cas14j,DinG,DEDDh	0	14
NZ_CP019513	Enterococcus faecalis strain CLB21560 plasmid pA, complete sequence	0 crisprs	NA	0	1
NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	1 crisprs	WYL	2	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

434539 : 482969

Staphylococcus_phage(44.44%)

transposase,integrase

attL 433363:433380|attR 488386:488403

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
433363:433380	attL	NA	NA	NA	NA
WP_000195429.1\|434539_435712_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002404803.1\|437125_438364_+	S8 family serine peptidase	NA	NA	NA	NA
WP_002368282.1\|438364_439348_+	hypothetical protein	NA	NA	NA	NA
WP_002404684.1\|439880_441539_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_002358491.1\|441707_442304_+	recombinase family protein	A0A1W5LU24	Ralstonia_phage	1.6e-19	36.8
WP_002358492.1\|442446_443172_+	hypothetical protein	NA	NA	NA	NA
WP_002358494.1\|443216_443384_+	antitoxin	NA	NA	NA	NA
WP_002404680.1\|443971_444172_+	hypothetical protein	NA	NA	NA	NA
WP_002358496.1\|444455_445481_+	hypothetical protein	NA	NA	NA	NA
WP_079996717.1\|445611_446040_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1X9I6C6	Streptococcus_phage	8.7e-36	61.9
WP_002358500.1\|446077_446233_-	hypothetical protein	NA	NA	NA	NA
WP_002358502.1\|446298_446550_+	hypothetical protein	NA	NA	NA	NA
WP_002358504.1\|448169_448625_-\|transposase	IS200/IS605 family transposase	A0A0H3UZM0	Geobacillus_virus	3.3e-17	35.0
WP_002358506.1\|449731_449914_+	hypothetical protein	NA	NA	NA	NA
WP_002358507.1\|450194_450827_+	hypothetical protein	NA	NA	NA	NA
WP_002404658.1\|451291_451972_+	hypothetical protein	NA	NA	NA	NA
WP_002358510.1\|451984_453814_+	peptidase C47	NA	NA	NA	NA
WP_002358511.1\|454064_454628_+	hypothetical protein	NA	NA	NA	NA
WP_002401492.1\|456689_457355_+	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_002358517.1\|457371_457563_+	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_002358518.1\|457591_458128_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_155119277.1\|458403_463800_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_000195429.1\|464030_465203_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002358521.1\|465331_466540_+	YSIRK-targeted surface antigen transcriptional regulator	NA	NA	NA	NA
WP_000195429.1\|466715_467888_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002358522.1\|468001_468418_+	hypothetical protein	NA	NA	NA	NA
WP_010708263.1\|468718_469384_+	hypothetical protein	NA	NA	NA	NA
WP_002401429.1\|470203_470857_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	1.5e-10	32.7
WP_002358529.1\|470965_471148_+	hypothetical protein	NA	NA	NA	NA
WP_002358531.1\|471603_472422_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002358533.1\|472577_473285_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002358534.1\|473277_474780_+	PTS glucose transporter subunit IIBC	NA	NA	NA	NA
WP_002358535.1\|474790_475273_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_002358536.1\|475905_476670_-	YibE/F family protein	NA	NA	NA	NA
WP_002358537.1\|476666_477710_-	YibE/F family protein	NA	NA	NA	NA
WP_002358539.1\|478060_478234_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_002358540.1\|478246_478633_+	hypothetical protein	NA	NA	NA	NA
WP_002358541.1\|478684_479089_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_010706720.1\|479282_480353_+	ammonium transporter	NA	NA	NA	NA
WP_002358543.1\|480455_481589_+	NAD(P)-binding domain-containing protein	V9VEY6	Lactococcus_phage	3.8e-06	26.7
WP_079996718.1\|482657_482969_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0N9SIX5	Staphylococcus_phage	3.6e-23	64.4
488386:488403	attR	NA	NA	NA	NA

DBSCAN-SWA_2

852413 : 860333

Planktothrix_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002355794.1\|852413_853472_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.1
WP_002355795.1\|853471_854428_+	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	3.2e-06	23.9
WP_002355796.1\|854468_855539_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	7.6e-89	49.0
WP_002355797.1\|855938_856460_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.0e-14	33.3
WP_002355798.1\|856573_856774_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002355799.1\|856834_857194_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002358828.1\|857239_857590_-	hypothetical protein	NA	NA	NA	NA
WP_002358829.1\|857687_858047_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_002361364.1\|858174_858609_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002361365.1\|858626_859142_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	7.7e-39	48.8
WP_002358831.1\|859157_860333_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.5e-85	47.7

DBSCAN-SWA_3

889524 : 941642

Enterococcus_phage(46.51%)

capsid,plate,terminase,holin,portal,tRNA,integrase,tail,protease,head

attL 906363:906390|attR 945415:945442

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002376131.1\|889524_890004_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_002358858.1\|889996_890518_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002355840.1\|890687_890897_+	hypothetical protein	NA	NA	NA	NA
WP_002358859.1\|890970_891981_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_002404478.1\|892004_893012_-	galactose mutarotase	NA	NA	NA	NA
WP_002355844.1\|893001_893670_-	beta-phosphoglucomutase	A0A1D8KNV9	Synechococcus_phage	8.6e-06	24.6
WP_010708306.1\|893662_895957_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_002358862.1\|896237_898406_+	PTS glucose transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	7.3e-06	37.2
WP_002358863.1\|898471_899296_+	maltose 6'-phosphate phosphatase	NA	NA	NA	NA
WP_002358864.1\|899355_900171_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	5.5e-23	29.5
WP_002358865.1\|900296_901259_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002358867.1\|901239_901539_+	hypothetical protein	NA	NA	NA	NA
WP_010708307.1\|901555_901846_+	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_002358869.1\|902000_902714_-	peptide ABC transporter permease	NA	NA	NA	NA
WP_025186153.1\|902718_903360_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_002358871.1\|903361_903511_-	hypothetical protein	NA	NA	NA	NA
WP_002358872.1\|903857_904634_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002358873.1\|904776_904977_+	hypothetical protein	NA	NA	NA	NA
WP_002355866.1\|905405_905714_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_002358874.1\|905746_906091_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_002355868.1\|906103_906391_+	50S ribosomal protein L27	NA	NA	NA	NA
906363:906390	attL	NA	NA	NA	NA
WP_010784379.1\|906478_907633_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.2e-65	36.1
WP_002403734.1\|907701_908271_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_080270837.1\|908451_908883_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_010716842.1\|908897_909311_-	helix-turn-helix transcriptional regulator	A0A0M4QX29	Bacillus_phage	3.6e-31	53.2
WP_002406956.1\|909544_909754_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010710745.1\|909757_910042_+	hypothetical protein	NA	NA	NA	NA
WP_010710744.1\|910056_910770_+	rha family phage regulatory protein	D2IYT0	Enterococcus_phage	1.2e-87	75.8
WP_010710743.1\|910780_910966_+	hypothetical protein	D2IZW5	Enterococcus_phage	3.3e-24	96.7
WP_010710742.1\|910977_911181_+	hypothetical protein	NA	NA	NA	NA
WP_077143654.1\|911167_911650_-	hypothetical protein	M1PL51	Streptococcus_phage	1.9e-18	36.9
WP_010708399.1\|911743_911938_+	hypothetical protein	D2IZW8	Enterococcus_phage	2.1e-29	100.0
WP_016024368.1\|912328_912565_+	helix-turn-helix transcriptional regulator	D2IZX1	Enterococcus_phage	4.0e-35	100.0
WP_002382573.1\|912585_912771_+	hypothetical protein	D2IZX2	Enterococcus_phage	7.0e-27	100.0
WP_002382574.1\|912813_913137_+	hypothetical protein	D2IZX3	Enterococcus_phage	5.9e-53	100.0
WP_002382575.1\|913136_913364_+	hypothetical protein	D2IZX4	Enterococcus_phage	3.0e-35	100.0
WP_010708403.1\|913363_913462_+	hypothetical protein	D2IZX5	Enterococcus_phage	2.0e-09	100.0
WP_002382577.1\|913458_913734_+	hypothetical protein	D2IZX6	Enterococcus_phage	9.2e-39	100.0
WP_002410219.1\|913695_914073_-	hypothetical protein	D2IZX7	Enterococcus_phage	1.5e-63	100.0
WP_010708404.1\|914145_915087_+	hypothetical protein	D2IZK1	Enterococcus_phage	7.5e-173	97.4
WP_002364218.1\|915089_915980_+	hypothetical protein	D2IYT9	Enterococcus_phage	1.3e-163	100.0
WP_002372048.1\|915993_916956_+	DUF4373 domain-containing protein	D2IZR2	Enterococcus_phage	3.0e-169	100.0
WP_002368214.1\|916959_917262_+	hypothetical protein	D2IZR3	Enterococcus_phage	1.6e-47	99.0
WP_002372047.1\|917262_917562_+	hypothetical protein	D2IZY1	Enterococcus_phage	1.3e-43	90.9
WP_010729980.1\|917579_918005_+	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	8.0e-58	80.0
WP_002357017.1\|918283_918544_+	hypothetical protein	NA	NA	NA	NA
WP_002372045.1\|918911_919328_+	autolysin	D2IZL7	Enterococcus_phage	1.6e-66	97.1
WP_010708332.1\|921115_921346_+	hypothetical protein	NA	NA	NA	NA
WP_010708334.1\|921570_921897_+	hypothetical protein	C5J957	Streptococcus_phage	3.7e-31	65.9
WP_010708335.1\|922086_922446_+	hypothetical protein	A0A0U4JV93	Exiguobacterium_phage	9.9e-17	48.5
WP_010708336.1\|922450_924238_+\|terminase	terminase large subunit	Q9AZY8	Lactococcus_phage	2.6e-219	64.2
WP_010708337.1\|924257_925469_+\|portal	phage portal protein	Q0H263	Geobacillus_phage	5.9e-138	59.6
WP_010708338.1\|925465_926047_+\|head,protease	HK97 family phage prohead protease	Q0H262	Geobacillus_phage	7.6e-67	67.9
WP_010708339.1\|926049_927318_+\|capsid	phage major capsid protein	Q0H261	Geobacillus_phage	1.3e-92	54.8
WP_010708340.1\|927320_927464_+	hypothetical protein	NA	NA	NA	NA
WP_010708341.1\|927490_927766_+	hypothetical protein	Q9AZY3	Lactococcus_phage	9.6e-12	44.4
WP_010708342.1\|927758_928079_+\|head	phage head closure protein	Q9AZY2	Lactococcus_phage	1.1e-19	46.9
WP_010708343.1\|928071_928452_+	hypothetical protein	A0A1S5SFC4	Streptococcus_phage	5.9e-20	51.8
WP_010708344.1\|928454_928772_+	hypothetical protein	Q9AZY0	Lactococcus_phage	1.8e-25	56.2
WP_010708345.1\|928788_929388_+\|tail	phi13 family phage major tail protein	Q9AZX9	Lactococcus_phage	1.8e-71	68.6
WP_010708346.1\|929390_929753_+	hypothetical protein	Q9AZX8	Lactococcus_phage	1.4e-39	67.5
WP_077143655.1\|929761_929965_+	hypothetical protein	NA	NA	NA	NA
WP_010708348.1\|929980_932503_+	hypothetical protein	Q9AZX7	Lactococcus_phage	3.6e-89	32.3
WP_010708349.1\|932507_933257_+	hypothetical protein	Q9AZX6	Lactococcus_phage	1.1e-89	60.6
WP_010784389.1\|933253_936052_+	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	3.4e-197	48.1
WP_002404576.1\|936070_936952_+\|plate	phage baseplate upper protein	Q9AYV5	Lactococcus_phage	4.0e-11	26.6
WP_002404577.1\|936944_937541_+	hypothetical protein	NA	NA	NA	NA
WP_002404578.1\|937537_937825_+	hypothetical protein	NA	NA	NA	NA
WP_002404579.1\|937824_938352_+	hypothetical protein	NA	NA	NA	NA
WP_002404580.1\|938370_938745_+	hypothetical protein	NA	NA	NA	NA
WP_002404581.1\|938744_938882_+	XkdX family protein	NA	NA	NA	NA
WP_010815473.1\|938915_939137_+	hypothetical protein	D2J019	Enterococcus_phage	3.9e-32	95.9
WP_002384371.1\|939129_939363_+\|holin	phage holin	D2J020	Enterococcus_phage	1.9e-29	87.8
WP_002394567.1\|939363_940605_+	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	8.9e-174	73.3
WP_002357053.1\|941441_941642_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-24	80.3
945415:945442	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1259217 : 1276886

Enterococcus_phage(42.86%)

tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002360498.1\|1259217_1261614_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.9e-19	23.8
WP_002360497.1\|1261638_1261989_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002357857.1\|1262271_1262745_-	toxin	A0A097BY56	Enterococcus_phage	1.1e-60	71.2
WP_002360496.1\|1262791_1263274_-	helix-turn-helix domain-containing protein	R9QTP6	Staphylococcus_phage	2.6e-20	47.7
WP_073459191.1\|1263442_1263625_+	hypothetical protein	NA	NA	NA	NA
WP_002360494.1\|1263655_1264426_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	2.5e-33	57.0
WP_002384644.1\|1264444_1265287_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	5.7e-31	31.0
WP_010706586.1\|1265289_1265382_+	hypothetical protein	NA	NA	NA	NA
WP_002413351.1\|1265374_1265746_+	hypothetical protein	NA	NA	NA	NA
WP_002360491.1\|1265765_1266173_+	transcriptional regulator	NA	NA	NA	NA
WP_002381949.1\|1266418_1266811_+	hypothetical protein	NA	NA	NA	NA
WP_077143662.1\|1266823_1267324_+\|tail	phage major tail protein, TP901-1 family	W6LP72	Streptococcus_phage	1.6e-33	48.4
WP_002357848.1\|1267356_1267716_+	hypothetical protein	A0A0F6N4J9	Staphylococcus_phage	7.6e-09	32.2
WP_002360486.1\|1267733_1268102_+	hypothetical protein	Q38180	Lactococcus_phage	3.3e-07	32.0
WP_002404500.1\|1268091_1271025_+	membrane protein	A0A1U9WR55	Streptococcus_virus	2.5e-09	25.0
WP_002360484.1\|1271026_1271953_+\|tail	phage tail family protein	C9E2K5	Enterococcus_phage	1.2e-146	78.6
WP_002360481.1\|1271965_1273423_+	phage minor structural protein	C9E2K6	Enterococcus_phage	4.2e-175	47.7
WP_002360478.1\|1273455_1275225_+	hypothetical protein	A0A097BYA8	Enterococcus_phage	9.8e-142	71.8
WP_002357842.1\|1275248_1275644_+\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	2.8e-33	48.9
WP_002404501.1\|1275788_1276886_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	4.0e-77	44.6

DBSCAN-SWA_5

1733930 : 1752022

Thermus_phage(25.0%)

integrase,transposase,protease

attL 1750220:1750244|attR 1755284:1755308

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002360105.1\|1733930_1734785_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_002360104.1\|1734833_1736366_-	M4 family metallopeptidase coccolysin	NA	NA	NA	NA
WP_087942341.1\|1736600_1737671_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002360102.1\|1737600_1738128_-	HD domain-containing protein	NA	NA	NA	NA
WP_002360101.1\|1738345_1739251_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_002360100.1\|1739424_1739841_-	hypothetical protein	NA	NA	NA	NA
WP_033072592.1\|1740755_1740857_+	hypothetical protein	NA	NA	NA	NA
WP_002360098.1\|1740998_1742177_-\|integrase	site-specific integrase	S6C485	Thermus_phage	2.0e-29	30.3
WP_002297662.1\|1742279_1742591_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002360096.1\|1742939_1743185_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297668.1\|1743178_1743580_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002297670.1\|1744147_1745983_-	beta-galactosidase	NA	NA	NA	NA
WP_010708157.1\|1746154_1747417_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002360092.1\|1747554_1747779_+	hypothetical protein	NA	NA	NA	NA
WP_002298159.1\|1747775_1747940_+	hypothetical protein	NA	NA	NA	NA
WP_002298157.1\|1748033_1749326_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-31	40.4
WP_010708156.1\|1749599_1749860_-	hypothetical protein	NA	NA	NA	NA
1750220:1750244	attL	NA	NA	NA	NA
WP_101495273.1\|1750464_1751626_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.0e-79	51.3
WP_077497620.1\|1751698_1751905_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	2.0e-06	53.3
WP_002383094.1\|1751908_1752022_+\|transposase	IS3 family transposase	NA	NA	NA	NA
1755284:1755308	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1768028 : 1779512

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298830.1\|1768028_1769033_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	1.4e-121	66.3
WP_002384404.1\|1769029_1771153_-\|transposase	transposase	A0A1S5SF30	Streptococcus_phage	2.4e-174	58.7
WP_002330910.1\|1771157_1773605_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.4
WP_002298826.1\|1773591_1773981_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	2.5e-42	66.7
WP_002330909.1\|1774044_1774773_+	hypothetical protein	NA	NA	NA	NA
WP_011109507.1\|1774779_1775607_-	abortive infection family protein	NA	NA	NA	NA
WP_002298823.1\|1775680_1776184_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	3.1e-56	61.2
WP_002298822.1\|1776196_1776418_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002360077.1\|1776814_1778065_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	6.1e-114	62.1
WP_002330905.1\|1778196_1778331_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002360076.1\|1778327_1779512_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.0e-142	62.1

DBSCAN-SWA_7

1910779 : 1922119

Enterococcus_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002359997.1\|1910779_1911850_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.8e-29	34.7
WP_002359996.1\|1913207_1913456_+	hypothetical protein	A0A097BYB1	Enterococcus_phage	6.1e-34	91.5
WP_002359995.1\|1913474_1914443_-	Abi family protein	A0A059NT88	Lactococcus_phage	1.3e-79	43.5
WP_077143769.1\|1915253_1916240_-	endolysin	F0PIJ7	Enterococcus_phage	6.1e-85	67.6
WP_002359993.1\|1916226_1916505_-\|holin	holin	NA	NA	NA	NA
WP_002359992.1\|1916504_1916759_-	hypothetical protein	NA	NA	NA	NA
WP_002359991.1\|1916771_1917191_-	XkdX family protein	F0PIJ5	Enterococcus_phage	1.1e-56	85.4
WP_080501854.1\|1917178_1918363_-	hypothetical protein	F0PIJ4	Enterococcus_phage	8.8e-62	65.4
WP_002399377.1\|1918352_1918841_-	hypothetical protein	A0A1W6JI16	Lactococcus_phage	6.4e-35	46.0
WP_033591150.1\|1918853_1919543_-	hypothetical protein	NA	NA	NA	NA
WP_002399380.1\|1919542_1922119_-	endolysin	A0A1B1IM47	Lactococcus_phage	3.9e-30	57.5

DBSCAN-SWA_8

1940389 : 1953589

Enterococcus_phage(58.82%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002399393.1\|1940389_1940809_-	hypothetical protein	A0A2H4J1L3	uncultured_Caudovirales_phage	2.7e-18	51.0
WP_002399394.1\|1940792_1941995_-	adenine methyltransferase	Q708N6	Streptococcus_phage	1.8e-110	51.1
WP_002393643.1\|1942402_1942828_-	ArpU family transcriptional regulator	D2IYV6	Enterococcus_phage	9.9e-24	42.3
WP_002393644.1\|1942973_1943099_-	hypothetical protein	NA	NA	NA	NA
WP_010708136.1\|1943126_1943327_-	hypothetical protein	D2IYV2	Enterococcus_phage	2.4e-28	89.4
WP_010708135.1\|1943327_1943813_-	hypothetical protein	C9E2P0	Enterococcus_phage	1.7e-88	98.1
WP_010708134.1\|1943809_1944334_-	DUF1642 domain-containing protein	D2IZZ0	Enterococcus_phage	2.4e-35	51.1
WP_010708133.1\|1944315_1944672_-	hypothetical protein	F0PIH7	Enterococcus_phage	5.3e-47	78.4
WP_010708132.1\|1944668_1944935_-	hypothetical protein	A0A059T7S7	Listeria_phage	4.4e-14	48.3
WP_077143689.1\|1945305_1945485_-	hypothetical protein	D2IYU5	Enterococcus_phage	1.1e-13	100.0
WP_010708130.1\|1945541_1946177_-	DUF2187 domain-containing protein	D2IZY3	Enterococcus_phage	2.3e-69	89.2
WP_010708129.1\|1946190_1946523_-	hypothetical protein	A0A0S2MYB8	Enterococcus_phage	8.0e-21	55.7
WP_002399588.1\|1946519_1946945_-	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	1.2e-58	80.4
WP_010708128.1\|1946953_1947823_-	DNA replication protein	U5PWH5	Bacillus_phage	4.7e-20	29.1
WP_077143690.1\|1947836_1948688_-	DUF4373 domain-containing protein	D2IZY0	Enterococcus_phage	1.2e-49	45.8
WP_010708126.1\|1948701_1949514_-	hypothetical protein	J7KGZ1	Streptococcus_phage	1.9e-63	50.8
WP_002393136.1\|1949479_1950403_-	recombinase RecT	A0A1S5S8V5	Streptococcus_phage	1.2e-66	53.6
WP_002359951.1\|1950392_1950725_-	hypothetical protein	NA	NA	NA	NA
WP_010708125.1\|1950755_1951046_-	hypothetical protein	NA	NA	NA	NA
WP_010708124.1\|1951130_1951457_-	hypothetical protein	NA	NA	NA	NA
WP_002380498.1\|1951457_1951667_-	hypothetical protein	NA	NA	NA	NA
WP_010711090.1\|1951685_1951796_-	hypothetical protein	NA	NA	NA	NA
WP_002359946.1\|1951809_1952061_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002393143.1\|1952075_1952603_-	hypothetical protein	NA	NA	NA	NA
WP_010708121.1\|1952873_1953059_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010708120.1\|1953211_1953589_+	helix-turn-helix transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	1.2e-12	37.0

DBSCAN-SWA_9

2105005 : 2116016

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002359823.1\|2105005_2106028_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	3.6e-120	65.4
WP_002383559.1\|2106024_2108139_-	FUSC family protein	A0A1S5SF30	Streptococcus_phage	7.0e-179	60.5
WP_002359821.1\|2108144_2110592_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	75.0
WP_002359820.1\|2110578_2110968_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.8e-43	68.3
WP_002359819.1\|2111044_2111659_+	hypothetical protein	NA	NA	NA	NA
WP_002359818.1\|2111674_2112247_+	hypothetical protein	NA	NA	NA	NA
WP_002359817.1\|2112279_2112780_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	6.8e-48	56.1
WP_002298822.1\|2112792_2113014_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002359816.1\|2113018_2113156_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002359815.1\|2113152_2114337_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	8.0e-140	61.1
WP_002359814.1\|2114593_2114848_-	hypothetical protein	NA	NA	NA	NA
WP_077143702.1\|2114873_2116016_-	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	1.4e-120	59.7

DBSCAN-SWA_10

2430626 : 2489510

Enterococcus_phage(36.36%)

transposase,capsid,terminase,holin,tRNA,portal,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002359567.1\|2430626_2431133_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_002359566.1\|2431444_2432290_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_002359565.1\|2432419_2433049_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002362548.1\|2433166_2434528_-	magnesium transporter	NA	NA	NA	NA
WP_002359563.1\|2434558_2435452_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_002356486.1\|2435459_2436257_-	NAD kinase	NA	NA	NA	NA
WP_002381475.1\|2436269_2436974_-	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_002356483.1\|2437140_2437719_+	CYTH domain-containing protein	NA	NA	NA	NA
WP_002359562.1\|2437782_2438442_+	DsbA family protein	NA	NA	NA	NA
WP_002404853.1\|2438724_2439420_-	helix-turn-helix transcriptional regulator	A0A0A7AQV8	Bacillus_phage	7.6e-05	42.3
WP_002356480.1\|2439634_2441446_-	oligoendopeptidase F	NA	NA	NA	NA
WP_002359560.1\|2441493_2442678_-	competence protein ComA	NA	NA	NA	NA
WP_002356478.1\|2442766_2443429_-	adaptor protein MecA	NA	NA	NA	NA
WP_002356477.1\|2443771_2444170_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_002359559.1\|2444529_2445540_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_002359558.1\|2445582_2446920_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.0e-47	32.5
WP_002359557.1\|2447028_2447277_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	2.9e-36	97.6
WP_002359555.1\|2447432_2448101_-	hypothetical protein	NA	NA	NA	NA
WP_139016409.1\|2448105_2448477_-	hypothetical protein	NA	NA	NA	NA
WP_025186173.1\|2448466_2449315_-	ParA family protein	A0A1X9IGI7	Lactococcus_phage	2.6e-31	38.4
WP_002404849.1\|2449497_2450604_-	N-acetylmuramoyl-L-alanine amidase	V5URN7	Enterococcus_phage	1.2e-84	47.7
WP_002358058.1\|2450657_2451056_-\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	1.6e-36	54.2
WP_002404848.1\|2451105_2451909_-	hypothetical protein	D2IYX9	Enterococcus_phage	4.8e-120	83.6
WP_077143707.1\|2451920_2452976_-	structural protein	D2J073	Enterococcus_phage	2.0e-49	37.0
WP_002359549.1\|2452986_2454111_-	hypothetical protein	Q77MU2	Lactococcus_phage	3.7e-86	44.5
WP_002359548.1\|2454113_2455013_-\|tail	phage tail family protein	D2J071	Enterococcus_phage	8.4e-49	37.0
WP_025186171.1\|2455012_2459764_-\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	7.2e-14	43.0
WP_002359543.1\|2459985_2460333_-	hypothetical protein	NA	NA	NA	NA
WP_002359542.1\|2460387_2460861_-	Ig domain-containing protein	A0A1D6Z291	Staphylococcus_phage	1.9e-23	45.8
WP_002358071.1\|2460934_2461528_-\|tail	tail protein	A0A060AKE9	Staphylococcus_phage	2.6e-22	35.1
WP_077143708.1\|2461560_2461956_-	hypothetical protein	A8ATA3	Listeria_phage	4.4e-18	45.8
WP_002359539.1\|2461952_2462345_-	hypothetical protein	A0A1S5SF89	Streptococcus_phage	1.3e-09	38.5
WP_002404844.1\|2462341_2462716_-	hypothetical protein	A8ATA1	Listeria_phage	1.5e-28	52.1
WP_002358075.1\|2462702_2463008_-	hypothetical protein	A0A0U4K528	Bacillus_phage	1.3e-09	47.5
WP_002359535.1\|2463085_2464231_-\|capsid	phage major capsid protein	A8AT98	Listeria_phage	2.1e-116	56.5
WP_002404843.1\|2464257_2465031_-\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	2.0e-54	50.4
WP_002409513.1\|2465002_2466178_-\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	6.4e-73	39.5
WP_002409514.1\|2466393_2468034_-\|terminase	terminase large subunit	A0A1S5SF58	Streptococcus_phage	2.4e-182	58.9
WP_002359529.1\|2468030_2468384_-	hypothetical protein	A0A2H4JAH7	uncultured_Caudovirales_phage	2.7e-35	67.8
WP_010707157.1\|2468540_2468807_-	hypothetical protein	NA	NA	NA	NA
WP_080501855.1\|2468803_2469529_-	hypothetical protein	NA	NA	NA	NA
WP_002380696.1\|2469519_2469831_-	HNH endonuclease	A0A1S5SFB3	Streptococcus_phage	1.0e-30	62.1
WP_002380697.1\|2469823_2470138_-	hypothetical protein	NA	NA	NA	NA
WP_077143709.1\|2470130_2470319_-	hypothetical protein	NA	NA	NA	NA
WP_077143710.1\|2470810_2471341_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	5.4e-11	29.9
WP_077143711.1\|2471429_2471660_-	hypothetical protein	NA	NA	NA	NA
WP_077143712.1\|2471660_2472230_-	DUF1642 domain-containing protein	D2IZL3	Enterococcus_phage	6.8e-44	50.0
WP_002365172.1\|2472222_2472483_-	hypothetical protein	D2IZL2	Enterococcus_phage	7.3e-46	100.0
WP_021164528.1\|2472637_2473045_-	hypothetical protein	D2IZY8	Enterococcus_phage	2.1e-39	67.4
WP_077143713.1\|2473088_2473829_-	site-specific DNA-methyltransferase	A0A097QQ03	Enterococcus_phage	1.8e-129	94.6
WP_077143714.1\|2473949_2474705_-	hypothetical protein	D2IZY3	Enterococcus_phage	1.6e-138	97.6
WP_077143715.1\|2474704_2475127_-	RusA family crossover junction endodeoxyribonuclease	D2IZY2	Enterococcus_phage	3.8e-60	82.9
WP_077143716.1\|2475144_2475444_-	hypothetical protein	D2IZY1	Enterococcus_phage	5.5e-37	80.8
WP_077143717.1\|2475464_2475941_-	hypothetical protein	NA	NA	NA	NA
WP_077143718.1\|2475915_2476170_-	hypothetical protein	NA	NA	NA	NA
WP_077143719.1\|2476172_2476685_-	recombination protein U	A0A2K9V2V4	Faecalibacterium_phage	1.3e-25	42.8
WP_023042527.1\|2476674_2476995_-	hypothetical protein	NA	NA	NA	NA
WP_002359505.1\|2476991_2477807_-	hypothetical protein	Q0SPI6	Clostridium_phage	6.3e-27	34.2
WP_077143720.1\|2478034_2478787_-	hypothetical protein	A0A1S5S8N0	Streptococcus_phage	8.6e-47	43.6
WP_002399923.1\|2478806_2479265_-	hypothetical protein	A0A097BY30	Enterococcus_phage	2.8e-24	45.4
WP_002359502.1\|2479321_2479597_-	hypothetical protein	A0A0A7S062	Clostridium_phage	3.0e-13	56.5
WP_002381441.1\|2479590_2479818_-	hypothetical protein	D2IZX4	Enterococcus_phage	7.1e-13	54.1
WP_002381440.1\|2479814_2480129_-	hypothetical protein	NA	NA	NA	NA
WP_077143721.1\|2480630_2481122_+	hypothetical protein	NA	NA	NA	NA
WP_077143722.1\|2481108_2481342_-	hypothetical protein	A0A182BQC3	Lactococcus_phage	9.2e-08	42.9
WP_010730070.1\|2482147_2482369_+	hypothetical protein	A7TWL9	Staphylococcus_phage	1.3e-11	57.6
WP_077143723.1\|2482361_2482553_-	hypothetical protein	NA	NA	NA	NA
WP_077143724.1\|2482753_2483080_-	hypothetical protein	NA	NA	NA	NA
WP_077143725.1\|2483124_2483361_-	hypothetical protein	NA	NA	NA	NA
WP_077143726.1\|2483499_2483973_+	helix-turn-helix transcriptional regulator	A0A141E1S0	Streptococcus_phage	3.3e-20	52.2
WP_077143727.1\|2483990_2484455_+	toxin	R4IBK9	Listeria_phage	8.6e-13	39.6
WP_077143728.1\|2484543_2485119_+	hypothetical protein	A0A097BY58	Enterococcus_phage	5.1e-07	38.8
WP_077143729.1\|2485181_2486594_+	recombinase family protein	D7RWL2	Brochothrix_phage	6.3e-99	43.5
WP_002359483.1\|2486577_2486997_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_002356474.1\|2487324_2488038_+	HAD family hydrolase	NA	NA	NA	NA
WP_114679403.1\|2488108_2489510_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	5.4e-34	42.8

DBSCAN-SWA_11

2558025 : 2567765

Streptococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002385686.1\|2558025_2560209_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	3.1e-286	66.8
WP_002356379.1\|2560241_2560838_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	6.0e-51	56.4
WP_002359440.1\|2560882_2562001_-	DNA polymerase IV	NA	NA	NA	NA
WP_002356377.1\|2562126_2562885_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002359439.1\|2562868_2563531_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	5.1e-19	31.6
WP_002359438.1\|2563545_2564418_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.1e-80	57.2
WP_002356372.1\|2564529_2564877_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	8.1e-16	36.7
WP_002356371.1\|2564869_2565709_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002404418.1\|2565825_2566776_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.4e-33	33.0
WP_002356367.1\|2566777_2567107_-	hypothetical protein	NA	NA	NA	NA
WP_002356366.1\|2567126_2567765_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.1e-54	53.8

DBSCAN-SWA_12

2589039 : 2634096

Enterococcus_phage(64.52%)

terminase,holin,portal,plate,tail,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002367232.1\|2589039_2589750_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_002404589.1\|2589760_2590303_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002356329.1\|2590390_2591161_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002356327.1\|2591326_2591902_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_010708027.1\|2592007_2593558_+	hypothetical protein	NA	NA	NA	NA
WP_002359405.1\|2593578_2594643_+	DUF4950 domain-containing protein	C9E2L5	Enterococcus_phage	5.7e-20	51.5
WP_002359404.1\|2594902_2595967_-	FUSC family protein	NA	NA	NA	NA
WP_077143774.1\|2596222_2596420_-	hypothetical protein	NA	NA	NA	NA
WP_002404586.1\|2596974_2597424_-	hypothetical protein	NA	NA	NA	NA
WP_002404585.1\|2597423_2597798_-	hypothetical protein	NA	NA	NA	NA
WP_010708026.1\|2597800_2598325_-	hypothetical protein	NA	NA	NA	NA
WP_002404583.1\|2599074_2600313_-	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	1.2e-175	74.5
WP_002404582.1\|2600313_2600547_-\|holin	phage holin	D2J020	Enterococcus_phage	3.7e-33	97.3
WP_002374005.1\|2600539_2600761_-	hypothetical protein	D2J019	Enterococcus_phage	3.0e-32	97.3
WP_002404581.1\|2600794_2600932_-	XkdX family protein	NA	NA	NA	NA
WP_002404580.1\|2600931_2601306_-	hypothetical protein	NA	NA	NA	NA
WP_002404579.1\|2601324_2601852_-	hypothetical protein	NA	NA	NA	NA
WP_002404578.1\|2601851_2602139_-	hypothetical protein	NA	NA	NA	NA
WP_002404577.1\|2602135_2602732_-	hypothetical protein	NA	NA	NA	NA
WP_002404576.1\|2602724_2603606_-\|plate	phage baseplate upper protein	Q9AYV5	Lactococcus_phage	4.0e-11	26.6
WP_002389156.1\|2603624_2606417_-	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	1.8e-145	38.7
WP_002403868.1\|2606413_2607148_-\|tail	tail protein	NA	NA	NA	NA
WP_010708023.1\|2607137_2610083_-	tape measure protein	A0A249XUP8	Enterococcus_phage	2.4e-76	59.1
WP_002357039.1\|2610303_2610654_-	hypothetical protein	A0A2H4JAA8	uncultured_Caudovirales_phage	2.9e-05	33.3
WP_002384363.1\|2610706_2611555_-\|tail	tail protein	A0A288TYF3	Enterococcus_phage	3.2e-05	42.5
WP_010708022.1\|2611555_2611930_-	hypothetical protein	NA	NA	NA	NA
WP_010708021.1\|2611933_2612332_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_010708020.1\|2612324_2612693_-	hypothetical protein	NA	NA	NA	NA
WP_010708019.1\|2612689_2613034_-	hypothetical protein	NA	NA	NA	NA
WP_002387281.1\|2613047_2613230_-	hypothetical protein	NA	NA	NA	NA
WP_002357030.1\|2613258_2614146_-	DUF5309 domain-containing protein	NA	NA	NA	NA
WP_077143734.1\|2614159_2614783_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_010708017.1\|2615117_2615438_-	hypothetical protein	NA	NA	NA	NA
WP_002397460.1\|2615496_2615742_-	hypothetical protein	NA	NA	NA	NA
WP_010708016.1\|2615746_2617441_-\|head	SPP1 gp7 family phage head morphogenesis protein	NA	NA	NA	NA
WP_010708015.1\|2617418_2618903_-\|portal	phage portal protein	A0A0A7AQF2	Bacillus_phage	2.5e-29	25.5
WP_029656821.1\|2618914_2620204_-\|terminase	PBSX family phage terminase large subunit	D2J001	Enterococcus_phage	1.7e-231	94.7
WP_010708013.1\|2620175_2620970_-	hypothetical protein	D2J000	Enterococcus_phage	7.1e-108	81.6
WP_010708012.1\|2621022_2621247_-	hypothetical protein	NA	NA	NA	NA
WP_002357362.1\|2622357_2622774_-	autolysin	D2IZL7	Enterococcus_phage	1.7e-68	99.3
WP_010708011.1\|2623163_2623367_-	hypothetical protein	D2IZL5	Enterococcus_phage	4.2e-33	100.0
WP_010708010.1\|2623528_2624095_-	DUF1642 domain-containing protein	D2IZL3	Enterococcus_phage	8.1e-106	100.0
WP_002365172.1\|2624087_2624348_-	hypothetical protein	D2IZL2	Enterococcus_phage	7.3e-46	100.0
WP_115252349.1\|2624371_2624734_-	hypothetical protein	D2IZL1	Enterococcus_phage	1.9e-63	100.0
WP_010708008.1\|2624730_2625102_-	hypothetical protein	D2IZL0	Enterococcus_phage	2.6e-68	100.0
WP_010708007.1\|2625122_2625443_-	hypothetical protein	D2IYU7	Enterococcus_phage	1.1e-56	100.0
WP_025191277.1\|2625444_2625909_-	class I SAM-dependent methyltransferase	D2IYU6	Enterococcus_phage	3.0e-90	97.4
WP_025191638.1\|2625962_2626169_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	7.6e-22	88.7
WP_010708004.1\|2626188_2626518_-	hypothetical protein	NA	NA	NA	NA
WP_010708003.1\|2626529_2627057_-	single-stranded DNA-binding protein	A0A2H4J1H8	uncultured_Caudovirales_phage	1.2e-42	53.7
WP_010708002.1\|2627061_2627913_-	helix-turn-helix domain-containing protein	U5U793	Lactobacillus_phage	6.2e-25	29.9
WP_002414632.1\|2627916_2628558_-	hypothetical protein	U5U4M2	Lactobacillus_phage	3.7e-30	35.1
WP_002365157.1\|2628562_2629579_-	AAA family ATPase	A0A0S2SY47	Bacillus_phage	9.2e-60	43.2
WP_010708001.1\|2629590_2630070_-	siphovirus Gp157 family protein	E5DV79	Deep-sea_thermophilic_phage	3.5e-33	47.8
WP_002395693.1\|2630374_2630548_-	hypothetical protein	A0A0S2MY96	Enterococcus_phage	1.2e-23	96.5
WP_077143735.1\|2630559_2630745_-	hypothetical protein	D2IZW5	Enterococcus_phage	4.6e-18	83.3
WP_010707997.1\|2630928_2631318_+	DUF2513 domain-containing protein	A0A1S5SCT1	Streptococcus_phage	5.3e-24	46.0
WP_010707996.1\|2631289_2631442_-	hypothetical protein	NA	NA	NA	NA
WP_010707995.1\|2631452_2632163_-	rha family phage regulatory protein	D2IYT0	Enterococcus_phage	8.0e-119	92.8
WP_002404538.1\|2632240_2632690_+	hypothetical protein	NA	NA	NA	NA
WP_002404537.1\|2632836_2632977_-	hypothetical protein	NA	NA	NA	NA
WP_002404536.1\|2633015_2633285_-	hypothetical protein	NA	NA	NA	NA
WP_002404535.1\|2633297_2633480_-	hypothetical protein	NA	NA	NA	NA
WP_002404534.1\|2633775_2634096_+	helix-turn-helix transcriptional regulator	R4IH08	Staphylococcus_phage	3.5e-13	40.2

DBSCAN-SWA_13

2953009 : 2993096

Enterobacteria_phage(14.29%)

holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354830.1\|2953009_2953693_-\|holin	antiholin-like protein LrgB	NA	NA	NA	NA
WP_002354829.1\|2953689_2954109_-\|holin	antiholin-like murein hydrolase modulator LrgA	NA	NA	NA	NA
WP_002358985.1\|2954260_2954989_-	response regulator	NA	NA	NA	NA
WP_002358984.1\|2954969_2956739_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	3.2e-60	28.5
WP_002354826.1\|2956830_2957649_-	membrane protein	NA	NA	NA	NA
WP_002354825.1\|2957661_2958333_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002354824.1\|2958329_2959052_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.2e-22	33.7
WP_011109588.1\|2959413_2959806_-	OsmC family protein	NA	NA	NA	NA
WP_002354822.1\|2960012_2960282_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_002354818.1\|2960392_2960542_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_002379001.1\|2960557_2961532_+	GTP-binding protein	NA	NA	NA	NA
WP_002354815.1\|2961547_2961688_+	hypothetical protein	NA	NA	NA	NA
WP_010708369.1\|2961708_2963244_+	zinc ABC transporter substrate-binding protein AdcA	NA	NA	NA	NA
WP_002413934.1\|2963301_2964276_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_002354811.1\|2964464_2965235_-	ABC transporter permease	NA	NA	NA	NA
WP_002354809.1\|2965227_2966163_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.4e-22	29.4
WP_002354802.1\|2966420_2966840_+	PTS mannose transporter subunit IIA	NA	NA	NA	NA
WP_002354800.1\|2966852_2967344_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002365419.1\|2967360_2968176_+	PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC	NA	NA	NA	NA
WP_002358979.1\|2968172_2969000_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002358978.1\|2969147_2971667_+	PRD domain-containing protein	NA	NA	NA	NA
WP_002354788.1\|2971813_2972374_-	hypothetical protein	NA	NA	NA	NA
WP_002354786.1\|2972552_2972945_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_002365424.1\|2972958_2973402_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_011109590.1\|2973463_2973571_+	hypothetical protein	NA	NA	NA	NA
WP_002354782.1\|2973623_2974091_-	DNA starvation/stationary phase protection protein	C1KFH1	Lactobacillus_virus	1.0e-05	25.9
WP_002358977.1\|2974218_2974938_-	DUF5105 domain-containing protein	NA	NA	NA	NA
WP_002358976.1\|2975021_2976542_-	gluconokinase	NA	NA	NA	NA
WP_002358975.1\|2976650_2977343_+	prepilin peptidase	NA	NA	NA	NA
WP_002354777.1\|2977392_2981046_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.4e-65	24.8
WP_002354775.1\|2981212_2984836_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	2.0e-48	24.5
WP_002354774.1\|2985197_2985539_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	5.5e-17	42.5
WP_002354773.1\|2985538_2985769_-	hypothetical protein	NA	NA	NA	NA
WP_002358974.1\|2986175_2986391_-	DNA-binding protein	NA	NA	NA	NA
WP_002358973.1\|2986529_2987522_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_002358972.1\|2987588_2988221_-	RloB domain-containing protein	NA	NA	NA	NA
WP_002396787.1\|2988229_2989525_-	AAA family ATPase	NA	NA	NA	NA
WP_002358969.1\|2989550_2989685_-	hypothetical protein	NA	NA	NA	NA
WP_011109591.1\|2989859_2989952_+	hypothetical protein	NA	NA	NA	NA
WP_002358967.1\|2989986_2991603_+	phosphatase PAP2/LCP family protein	NA	NA	NA	NA
WP_002404776.1\|2991957_2992080_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002358966.1\|2992265_2992463_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_077143780.1\|2992581_2992722_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002396786.1\|2992952_2993096_+\|holin	putative holin-like toxin	NA	NA	NA	NA

DBSCAN-SWA_14

3076641 : 3094164

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000420682.1\|3076641_3076956_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|3076971_3077358_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|3077386_3078772_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000879507.1\|3078774_3078927_+	hypothetical protein	NA	NA	NA	NA
WP_000398284.1\|3078949_3080155_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_001009056.1\|3080197_3080419_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000342539.1\|3080535_3081033_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_000506270.1\|3081007_3081514_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000331160.1\|3081497_3083945_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000804748.1\|3083947_3086125_+	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000769868.1\|3086121_3087123_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_001224318.1\|3087119_3088052_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_012386611.1\|3088326_3088413_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000691736.1\|3088428_3090348_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_011058338.1\|3090448_3090634_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_001227347.1\|3090693_3091047_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_013670292.1\|3091251_3091323_+	hypothetical protein	NA	NA	NA	NA
WP_000804885.1\|3091551_3091974_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_000857133.1\|3091970_3092201_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_001845478.1\|3092426_3092678_-	hypothetical protein	NA	NA	NA	NA
WP_000814511.1\|3092661_3092865_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001291561.1\|3092946_3094164_+\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP019513

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14112 : 51052

Streptococcus_phage(53.33%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002354485.1\|14112_14799_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002365956.1\|15442_15748_-	hypothetical protein	NA	NA	NA	NA
WP_002365954.1\|16329_16686_-	hypothetical protein	NA	NA	NA	NA
WP_011109599.1\|17253_17322_-	sex pheromone inhibitor determinant	NA	NA	NA	NA
WP_002365953.1\|17504_18464_+	conjugal transfer protein TraA	NA	NA	NA	NA
WP_002365951.1\|18464_20096_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002365950.1\|20122_21289_-	TraB family protein	NA	NA	NA	NA
WP_002365949.1\|21332_22343_-	replication initiator protein A	NA	NA	NA	NA
WP_000239313.1\|22814_23660_+	ParA family protein	F0PIG8	Enterococcus_phage	3.1e-53	42.5
WP_000049959.1\|23652_24024_+	replication-associated protein RepC	NA	NA	NA	NA
WP_002365947.1\|24127_24418_-	hypothetical protein	NA	NA	NA	NA
WP_002365946.1\|24588_25050_-	hypothetical protein	NA	NA	NA	NA
WP_107164701.1\|25388_25499_-	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_002365943.1\|25749_26100_-	hypothetical protein	NA	NA	NA	NA
WP_002387639.1\|26096_27425_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	5.7e-94	42.6
WP_002365939.1\|27851_28154_-	hypothetical protein	NA	NA	NA	NA
WP_011109612.1\|28165_28414_-	hypothetical protein	NA	NA	NA	NA
WP_010708492.1\|28435_28660_-	hypothetical protein	NA	NA	NA	NA
WP_010708491.1\|28653_28941_-	hypothetical protein	NA	NA	NA	NA
WP_010713026.1\|28957_29554_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.4e-21	37.6
WP_000245205.1\|29754_30018_+	PbsX family transcriptional regulator	NA	NA	NA	NA
WP_000241511.1\|30011_30374_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_002367770.1\|30438_31401_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.0e-20	27.3
WP_002367771.1\|31402_32842_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.6e-09	22.6
WP_002370258.1\|33032_34964_+	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002367773.1\|35196_35466_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	3.3e-17	46.5
WP_002367774.1\|35455_35800_-	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|36054_36741_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_155119278.1\|36810_36981_+	hypothetical protein	NA	NA	NA	NA
WP_000195429.1\|37087_38260_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_001028144.1\|38389_39829_-	aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A1X9I6C2	Streptococcus_phage	3.8e-285	100.0
WP_000393259.1\|39829_40222_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	6.9e-72	100.0
WP_002354485.1\|41239_41926_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_010730188.1\|42368_42692_+	quaternary ammonium compound efflux SMR transporter QacH	NA	NA	NA	NA
WP_011109600.1\|43504_44392_-	replication protein	NA	NA	NA	NA
WP_002354485.1\|44502_45189_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000868795.1\|45435_45933_+	trimethoprim-resistant dihydrofolate reductase DfrG	G3MBI7	Bacillus_virus	4.0e-40	49.1
WP_154081274.1\|46468_46633_-	hypothetical protein	NA	NA	NA	NA
WP_077143782.1\|47276_48596_+	plasmid recombination enzyme	NA	NA	NA	NA
WP_010708518.1\|48712_48922_-	hypothetical protein	NA	NA	NA	NA
WP_025193054.1\|49259_49604_+	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|49637_50324_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_010708488.1\|50355_50874_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_010708487.1\|50917_51052_-\|bacteriocin	LsbB family leaderless bacteriocin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP019514

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019514_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019514_1

60882-61013

Orphan

Consensus_repeat	Method
GTTGGTTTTTCCCACTTTCGAACA	CRISPRCasFinder

2 spacers

WYL

The CRISPR arrays of NZ_CP019514_1

>merge|NZ_CP019514|1|60882-61013|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACAAAGTACTGGTATTATTGGATTCTTCTGGACGTTGGTTTTTCCCACTTTCGAAAGAAATGCCGATTTTATCATGTTTATCCGAAGGTTGGTTTTTCCCACTTTCGGGAA

>NZ_CP019514|1|1|60882-61013|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACA	AAGTACTGGTATTATTGGATTCTTCTGGAC
GTTGGTTTTTCCCACTTTCGAAAG	AAATGCCGATTTTATCATGTTTATCCGAAG
GTTGGTTTTTCCCACTTTCGGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019514.1\|WP_002354485.1\|58610_59297_+\|IS6-like-element-IS1216-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP019514.1\|WP_012881081.1\|63636_63723_-\|type-I-toxin-antitoxin-system-Fst-family-toxin	unknown	unknown	unknown
NZ_CP019514.1\|WP_010708530.1\|59330_59582_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP019514.1\|WP_002369746.1\|62045_62828_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP019514.1\|WP_001255866.1\|53589_54498_+\|aminoglycoside-nucleotidyltransferase-ANT(6)-Ia	unknown	unknown	gnl\|CDD\|377357
NZ_CP019514.1\|WP_078154339.1\|56556_56772_+\|WYL-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NZ_CP019514.1\|WP_002334978.1\|57069_57966_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|366743
NZ_CP019514.1\|WP_002379942.1\|65137_65824_+\|IS6-like-element-ISEnfa1-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP019514.1\|WP_002387528.1\|63081_63378_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019514.1\|WP_000527318.1\|58064_58274_+\|peptide-binding-protein	unknown	unknown	gnl\|CDD\|311623
NZ_CP019514.1\|WP_002383592.1\|59624_60293_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP019514.1\|WP_002360663.1\|61696_62053_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019514.1\|WP_077143784.1\|58290_58563_+\|antitoxin	unknown	unknown	gnl\|CDD\|370234
NZ_CP019514.1\|WP_001096887.1\|55129_55924_+\|aminoglycoside-O-phosphotransferase-APH(3')-IIIa	unknown	unknown	gnl\|CDD\|270699
NZ_CP019514.1\|WP_077143785.1\|64451_65105_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP019514.1\|WP_000627290.1\|54494_55037_+\|streptothricin-N-acetyltransferase-Sat4	unknown	unknown	gnl\|CDD\|366181

Protein	Function_ID	Function_description	E-value
NZ_CP019514.1\|WP_002354485.1\|58610_59297_+\|IS6-like-element-IS1216-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.80773e-92
NZ_CP019514.1\|WP_010708530.1\|59330_59582_-\|hypothetical-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.4221e-09
NZ_CP019514.1\|WP_002369746.1\|62045_62828_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	2.16992e-71
NZ_CP019514.1\|WP_001255866.1\|53589_54498_+\|aminoglycoside-nucleotidyltransferase-ANT(6)-Ia	gnl\|CDD\|377357	pfam04439, Adenyl_transf, Streptomycin adenylyltransferase. Also known as Aminoglycoside 6- adenylyltransferase (EC:2.7.7.-), this protein confers resistance to aminoglycoside antibiotics.	6.0678e-163
NZ_CP019514.1\|WP_002334978.1\|57069_57966_+\|ParA-family-protein	gnl\|CDD\|366743	pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyze amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family.	1.86042e-45
NZ_CP019514.1\|WP_002379942.1\|65137_65824_+\|IS6-like-element-ISEnfa1-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.27566e-90
NZ_CP019514.1\|WP_000527318.1\|58064_58274_+\|peptide-binding-protein	gnl\|CDD\|311623	pfam07764, Omega_Repress, Omega Transcriptional Repressor. The omega transcriptional repressor regulates expression of involved in copy number control and stable maintenance of plasmids. The omega protein belongs to the structural superfamily of MetJ/Arc repressors featuring a ribbon-helix-helix DNA-binding motif with the beta-ribbon located in and recognising the major groove of operator DNA.	1.28898e-35
NZ_CP019514.1\|WP_002383592.1\|59624_60293_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.62815e-13
NZ_CP019514.1\|WP_078154339.1\|56556_56772_+\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	1.212e-11
NZ_CP019514.1\|WP_077143784.1\|58290_58563_+\|antitoxin	gnl\|CDD\|370234	pfam08998, Epsilon_antitox, Bacterial epsilon antitoxin. The epsilon antitoxin, produced by various prokaryotes, forms part of a postsegregational killing system which is involved in the initiation of programmed cell death of plasmid-free cells. The protein is folded into a three-helix bundle that directly interacts with the zeta toxin, inactivating it.	1.37524e-41
NZ_CP019514.1\|WP_001096887.1\|55129_55924_+\|aminoglycoside-O-phosphotransferase-APH(3')-IIIa	gnl\|CDD\|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	7.26961e-101
NZ_CP019514.1\|WP_077143785.1\|64451_65105_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.77552e-88
NZ_CP019514.1\|WP_000627290.1\|54494_55037_+\|streptothricin-N-acetyltransferase-Sat4	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.87292e-21

>NZ_CP019514.1|WP_002383592.1|59624_60293_-|CPBP-family-intramembrane-metalloprotease
MEYIKRFFIVIGLFLLSQIGMFTYGTLKQSSLQVGQGTMPLLSTLILIVIFIMNIGLLLVLANKLELLNFDSKFLNKKNILIIVIGVVIARLVAILGTILLNNQGIDSTANDAAINNLFTGENPLLIILILGISAPIMEEIVFRAGIIGYFLKDWPILGIALSSISFGLVHGPTDIISFFMYALIGLVLSIAYFKTSRLEVSILIHFFNNLIPAIVIAFGLI
>NZ_CP019514.1|WP_010708530.1|59330_59582_-|hypothetical-protein
MKKTEKILFLGFSALMFILIGCSNKDNLQENKKSSAVEQTANLTAATPIQSLDPATAVDQTSITLLANVMEGLYRLDGSVAKF
>NZ_CP019514.1|WP_002354485.1|58610_59297_+|IS6-like-element-IS1216-family-transposase
MTMNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
>NZ_CP019514.1|WP_077143784.1|58290_58563_+|antitoxin
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYSKQILGSVAKF
>NZ_CP019514.1|WP_000527318.1|58064_58274_+|peptide-binding-protein
MGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
>NZ_CP019514.1|WP_002334978.1|57069_57966_+|ParA-family-protein
MIQYYYTKKEWGVVMEKEKLKILEELRRILNNKNEAIIILNNYFKGGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTFEVELPRVNFYEGLKNGNLASSIIHLTDNLDLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSATIKSNLEELYKEHKEDNLVFRNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYENVFFEMIERIIQLENEKE
>NZ_CP019514.1|WP_078154339.1|56556_56772_+|WYL-domain-containing-protein
MENSINVYSTSGQKNTLADNVIAAIQTAICNKRVISIQYPASGGQEPESRMIEPISLGFYEQNWYLIGFAG
>NZ_CP019514.1|WP_001096887.1|55129_55924_+|aminoglycoside-O-phosphotransferase-APH(3')-IIIa
MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF
>NZ_CP019514.1|WP_000627290.1|54494_55037_+|streptothricin-N-acetyltransferase-Sat4
MITEMKAGHLKDIDKPSEPFEVIGKIIPRYENENWTFTELLYEAPYLKSYQDEEDEEDEEADCLEYIDNTDKIIYLYYQDDKCVGKVKLRKNWNRYAYIEDIAVCKDFRGQGIGSALINISIEWAKHKNLHGLMLETQDNNLIACKFYHNCGFKIGSVDTMLYANFENNFEKAVFWYLRF
>NZ_CP019514.1|WP_001255866.1|53589_54498_+|aminoglycoside-nucleotidyltransferase-ANT(6)-Ia
MRSEKEMMDLVLSLAEQDERIRIVTLEGSRANINIPKDEFQDYDITYFVSDIEPFISNDDWLNQFGNIIMMQKPEDMELFPPEEKGFSYLMLFDDYNKIDLTLLPLEELDNYLKGDKLIKVLIDKDCRIKRDIVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHFNQIVRHELLRMISWKVGIETGFKLSVGKNYKFIERYISEDLWEKLLSTYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMYKKYTGKTGCLDSTYAADIEERREQ
>NZ_CP019514.1|WP_002360663.1|61696_62053_-|hypothetical-protein
MSNNRGKSAAERLLGAGKEDTNPTKATTSNEKELKTTHEHIVMNKKNIEKLIKQQGNSKRNADSIRINPILANALKYWTSIGEPEKSKPDVIEETLLKSIPEEYLIKGYEMAKKQNKI
>NZ_CP019514.1|WP_002369746.1|62045_62828_-|ParA-family-protein
MARIISVANQKGGVSKTTTSINLGAALHFTFNKSVLVIDMDPQGNATDNFGFDIDGTNVPTIYEVLKDEASITEAILNYKGIDVIPADIALSSAEREFTQVGSEHRLKRVLQPIEENYDYIIIDCPPSLGILTVNAFTVSDEIIIPVEAAYFSLKGLVKLNETIETVKEYTNESLIIRGVLFTKYNERFNISKEMNKTANQISDALHVNIFDTYIRRTITVDEAQAAGSDLISFNKTSTAEDDYIQFTKEFLEKVGDLNE
>NZ_CP019514.1|WP_002387528.1|63081_63378_-|hypothetical-protein
MPRKTFVYPHPINAYIIKHLGITVEEFCELHAFSQGTVSSWITRNKKIETLPISFIYSLSLSASKTMDQVYSDLLKLQDDYLLHLERHRRTKKIIDEE
>NZ_CP019514.1|WP_012881081.1|63636_63723_-|type-I-toxin-antitoxin-system-Fst-family-toxin
MAEKLISLIIAPLLVGLVLLLVDRWLDD
>NZ_CP019514.1|WP_077143785.1|64451_65105_+|IS6-family-transposase
MTMNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSLRTASTTIKGMEAIRGLYKKTRGSVAKFPISSF
>NZ_CP019514.1|WP_002379942.1|65137_65824_+|IS6-like-element-ISEnfa1-family-transposase
MKMTQFKGKQFQKDVIIVAVGYYLRYNLSYREVQEILYDRGIHVCHTTIYRWVQEYGKILYQIWKKKNKQSFYSWKMDETYIKIKGKWHYLYRAIDVDGLTLDIWLRKKRDTQAAYAFLKRLKNQFGEPKVLVTDKAPSIKSAFRKLQKNGLYITTEHRTIKYLNNLIEQDHRPIKRRNKFYQSLRTASTTIKGMEAIRGIYKKSRKEGSLFGFSVCTEIKGLLGIPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5073-5102	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	602-631	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	515-544	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33709-33738	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	503-532	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	503-532	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5526-5555	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83505-83534	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9536-9565	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	827-856	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7643-7672	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66171-66200	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12176-12205	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60906-60935	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92754-92783	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43889-43918	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4944-4973	0	1.0
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7697-7726	0	1.0
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12230-12259	0	1.0
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60960-60989	0	1.0
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92808-92837	0	1.0
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	748-777	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43943-43972	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4998-5027	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	548-577	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	461-490	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33655-33684	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	449-478	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5472-5501	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83451-83480	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	773-802	1	0.967
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66225-66254	2	0.933
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	449-478	2	0.933
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	NC_023573	Staphylococcus phage phiSA012 DNA, complete genome	31963-31992	6	0.8
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	44093-44122	6	0.8
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	85626-85655	6	0.8
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	MT711976	Streptomyces phage Coruscant, complete genome	87401-87430	7	0.767
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	31080-31109	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP045813	Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence	22357-22386	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP041758	Bacillus sp. KBS0812 plasmid unnamed, complete sequence	54635-54664	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP010015	Bacillus sp. YP1 plasmid pBUYP1, complete sequence	19043-19072	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NC_021809	Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence	25434-25463	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP020103	Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence	16845-16874	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NC_015149	Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631	65777-65806	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP034485	Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence	65216-65245	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP045923	Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence	22456-22485	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP035412	Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence	75658-75687	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP028216	Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence	14293-14322	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP035398	Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence	81874-81903	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_CP030938	Bacillus sp. DM2 plasmid unnamed, complete sequence	50467-50496	8	0.733
NZ_CP019514_1	1.2\|60960\|30\|NZ_CP019514\|CRISPRCasFinder	60960-60989	30	NZ_AP019715	Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence	53778-53807	8	0.733
NZ_CP019514_1	1.1\|60906\|30\|NZ_CP019514\|CRISPRCasFinder	60906-60935	30	JQ660954	Clostridium phage PhiS63, complete genome	22890-22919	9	0.7

1. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

2. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

3. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

4. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

5. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

6. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

7. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

8. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

9. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

10. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

11. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

12. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

13. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

14. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

15. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

16. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

17. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

18. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

19. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

20. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

21. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

22. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.967

aagtactggtattattggattcttctggac	CRISPR spacer
aagtcctggtattattggattcttctggac	Protospacer
**** *************************

23. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

24. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

25. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

26. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

27. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

28. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

29. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

30. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

31. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

32. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.933

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
***.**.***********************

33. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
***.**.***********************

34. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to NC_023573 (Staphylococcus phage phiSA012 DNA, complete genome) position: , mismatch: 6, identity: 0.8

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattaaaggattcttcaaaat	Protospacer
**************  ********* ..*.

35. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.8

aaatgccgattttatcatgtttatccgaag---	CRISPR spacer
aaatgacgattttatcatcttta---gaaagca	Protospacer
***** ************ ****   ***.

36. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

aaatgccgattttatcatgtttatccgaag---	CRISPR spacer
aaatgacgattttatcatcttta---gaaagca	Protospacer
***** ************ ****   ***.

37. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to MT711976 (Streptomyces phage Coruscant, complete genome) position: , mismatch: 7, identity: 0.767

aagtactggtattattggattcttctggac	CRISPR spacer
acagagtggttttattggcttcttctggat	Protospacer
* . * **** ******* **********.

38. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

39. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP045813 (Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

40. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP041758 (Bacillus sp. KBS0812 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

41. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP010015 (Bacillus sp. YP1 plasmid pBUYP1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

42. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NC_021809 (Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

43. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP020103 (Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

44. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NC_015149 (Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

45. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP034485 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

46. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP045923 (Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

47. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP035412 (Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

48. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP028216 (Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

49. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP035398 (Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

50. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_CP030938 (Bacillus sp. DM2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

51. spacer 1.2|60960|30|NZ_CP019514|CRISPRCasFinder matches to NZ_AP019715 (Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

52. spacer 1.1|60906|30|NZ_CP019514|CRISPRCasFinder matches to JQ660954 (Clostridium phage PhiS63, complete genome) position: , mismatch: 9, identity: 0.7

aagtactggtattattggattcttctggac	CRISPR spacer
ttgtactgatattattggtttcttcgtttt	Protospacer
  ******.********* ******    .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

43485 : 62828

Streptococcus_phage(76.47%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001224538.1\|43485_44103_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
WP_000366408.1\|44143_44443_+	hypothetical protein	NA	NA	NA	NA
WP_000824191.1\|44476_44644_+	hypothetical protein	NA	NA	NA	NA
WP_002321606.1\|44688_45294_-	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-19	33.2
WP_000343406.1\|45418_48406_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	7.3e-206	38.3
WP_002368882.1\|49095_49365_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	7.6e-22	81.5
WP_001814874.1\|49385_49469_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001038792.1\|49593_50331_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	7.0e-134	99.2
WP_000085862.1\|50335_50467_+	hypothetical protein	E4ZFP9	Streptococcus_phage	7.9e-17	100.0
WP_000567888.1\|51624_51870_+	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_000228166.1\|51972_52842_+	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	4.3e-159	95.8
WP_000662263.1\|52822_53557_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_001255866.1\|53589_54498_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000627290.1\|54494_55037_+	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001096887.1\|55129_55924_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_078154339.1\|56556_56772_+	WYL domain-containing protein	E4ZFP5	Streptococcus_phage	3.4e-33	98.6
WP_002334978.1\|57069_57966_+	ParA family protein	A0A1X9I765	Streptococcus_phage	9.0e-152	97.2
WP_000527318.1\|58064_58274_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	1.4e-31	98.6
WP_077143784.1\|58290_58563_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
WP_002354485.1\|58610_59297_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_010708530.1\|59330_59582_-	hypothetical protein	NA	NA	NA	NA
WP_002383592.1\|59624_60293_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002387529.1\|60423_61437_-	replication initiator protein A	NA	NA	NA	NA
WP_002360663.1\|61696_62053_-	hypothetical protein	NA	NA	NA	NA
WP_002369746.1\|62045_62828_-	ParA family protein	H7BUL8	unidentified_phage	3.8e-21	32.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019512

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP019513

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP019514

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection