CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP043421	Vibrio parahaemolyticus strain MVP1 chromosome 1, complete sequence	0 crisprs	DEDDh,WYL,cas4,csa3,DinG,cas3,csx1	3
NZ_CP043422	Vibrio parahaemolyticus strain MVP1 chromosome 2, complete sequence	1 crisprs	cas3,csa3,WYL,DEDDh	1
NZ_CP043423	Vibrio parahaemolyticus strain MVP1 plasmid pVa, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

647026 : 664208

uncultured_Mediterranean_phage(20.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455581.1\|647026_648667_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4
WP_005455579.1\|648745_650047_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455577.1\|650459_650741_+	cell division protein FtsB	NA	NA	NA	NA
WP_005455574.1\|650742_651447_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	3.4e-05	22.9
WP_005455572.1\|651464_651941_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_077672094.1\|651987_653031_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_077672095.1\|653030_653807_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.1e-65	52.4
WP_005455562.1\|653806_654433_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_005455560.1\|654447_655371_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005478546.1\|656519_659081_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-33	23.7
WP_021450025.1\|659165_659648_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.9e-27	48.7
WP_005478550.1\|659848_660892_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_077672096.1\|661015_661483_+	recombination regulator RecX	NA	NA	NA	NA
WP_005455546.1\|661625_664208_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9

DBSCAN-SWA_2

1807548 : 1816565

Vibrio_phage(90.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029847876.1\|1807548_1807935_+	phage protein	A0A1W6UG37	Vibrio_phage	2.7e-52	81.5
WP_077672917.1\|1808532_1809957_-	toxin	Q64EV0	Vibrio_phage	9.1e-122	51.0
WP_025788705.1\|1809960_1810293_-	DUF2523 domain-containing protein	Q64EV1	Vibrio_phage	1.4e-17	36.4
WP_077672918.1\|1810292_1811750_-	chemotaxis protein	NA	NA	NA	NA
WP_029792117.1\|1811883_1812099_-	hypothetical protein	G8IRU8	Vibrio_phage	3.2e-07	55.1
WP_029803953.1\|1812127_1812373_-	hypothetical protein	R9TMT7	Vibrio_phage	7.0e-06	40.4
WP_077672919.1\|1812369_1812696_-	hypothetical protein	G8IRU6	Vibrio_phage	1.1e-17	46.4
WP_077672920.1\|1812701_1813958_-	replication protein	G8IRU5	Vibrio_phage	2.2e-148	62.2
WP_077672921.1\|1813950_1814175_-	hypothetical protein	G8IRU4	Vibrio_phage	3.5e-12	54.4
WP_077672922.1\|1814309_1814666_+	hypothetical protein	Q9MCC3	Vibrio_phage	1.0e-42	73.6
WP_077672854.1\|1814834_1816565_-	response regulator	A0A1V0SGX0	Hokovirus	6.6e-42	30.8

DBSCAN-SWA_3

2760035 : 2766737

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005440184.1\|2760035_2760506_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3
WP_020840184.1\|2760675_2761785_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.0e-63	39.6
WP_045545485.1\|2761954_2762608_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.3e-34	38.0
WP_077672218.1\|2762620_2763745_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	6.9e-48	35.3
WP_005482986.1\|2763752_2764202_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_077672217.1\|2764329_2765580_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.8e-98	47.9
WP_024703709.1\|2765597_2766737_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-62	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP043422

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043422_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043422_1

710360-710457

Orphan

Consensus_repeat	Method
TTTTTGAAAAGGCGTTTTAAAAATA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP043422_1

>merge|NZ_CP043422|1|710360-710457|CRISPRCasFinder
TTTTTGAAAAGGCGTTTTAAAAATATTGATTGCGATCTTGTTTTTCTGGATTCTTTAATTGCGCGGTTTCAAATTTTTGAAAAGGCATTTTAAAAATA

>NZ_CP043422|1|1|710360-710457|CRISPRCasFinder
TTTTTGAAAAGGCGTTTTAAAAATA	TTGATTGCGATCTTGTTTTTCTGGATTCTTTAATTGCGCGGTTTCAAA
TTTTTGAAAAGGCATTTTAAAAATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043422.1\|WP_005482916.1\|709498_710260_-\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP043422.1\|WP_005482845.1\|702568_703246_-\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP043422.1\|WP_077672787.1\|706962_707874_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP043422.1\|WP_005460834.1\|705299_705923_-\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP043422.1\|WP_077672378.1\|720078_720483_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043422.1\|WP_065787529.1\|713252_713963_+\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP043422.1\|WP_005497702.1\|710500_711298_+\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP043422.1\|WP_077672790.1\|714913_715720_-\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP043422.1\|WP_077672786.1\|705934_706864_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP043422.1\|WP_023584387.1\|721488_722376_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP043422.1\|WP_077672788.1\|711381_713250_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP043422.1\|WP_005467181.1\|708627_708948_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP043422.1\|WP_069539389.1\|700324_702553_-\|exopolygalacturonate-lyase	unknown	unknown	unknown
NZ_CP043422.1\|WP_077672789.1\|713963_714833_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP043422.1\|WP_077672785.1\|703375_705115_+\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP043422.1\|WP_069504870.1\|707951_708587_-\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP043422.1\|WP_005497706.1\|708955_709480_-\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP043422.1\|WP_078224588.1\|717223_718063_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP043422.1\|WP_005464962.1\|716013_717162_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP043422.1\|WP_005497695.1\|720589_721393_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792

Protein	Function_ID	Function_description	E-value
NZ_CP043422.1\|WP_005482916.1\|709498_710260_-\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP043422.1\|WP_005482845.1\|702568_703246_-\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.08357e-24
NZ_CP043422.1\|WP_077672787.1\|706962_707874_-\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	2.98122e-18
NZ_CP043422.1\|WP_005460834.1\|705299_705923_-\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP043422.1\|WP_065787529.1\|713252_713963_+\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	4.69512e-40
NZ_CP043422.1\|WP_005497702.1\|710500_711298_+\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP043422.1\|WP_077672790.1\|714913_715720_-\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.1097e-97
NZ_CP043422.1\|WP_077672786.1\|705934_706864_-\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	4.42667e-102
NZ_CP043422.1\|WP_023584387.1\|721488_722376_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.79896e-78
NZ_CP043422.1\|WP_077672788.1\|711381_713250_+\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	7.13216e-138
NZ_CP043422.1\|WP_005467181.1\|708627_708948_-\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP043422.1\|WP_077672789.1\|713963_714833_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.06725e-108
NZ_CP043422.1\|WP_077672785.1\|703375_705115_+\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	1.39004e-109
NZ_CP043422.1\|WP_069504870.1\|707951_708587_-\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	3.11146e-144
NZ_CP043422.1\|WP_005497706.1\|708955_709480_-\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50
NZ_CP043422.1\|WP_078224588.1\|717223_718063_+\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	4.25742e-143
NZ_CP043422.1\|WP_005464962.1\|716013_717162_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP043422.1\|WP_005497695.1\|720589_721393_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	1.38628e-72

>NZ_CP043422.1|WP_005482916.1|709498_710260_-|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP043422.1|WP_005497706.1|708955_709480_-|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP043422.1|WP_005467181.1|708627_708948_-|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP043422.1|WP_069504870.1|707951_708587_-|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIEEYVKSLLD
>NZ_CP043422.1|WP_077672787.1|706962_707874_-|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFDITHPEMVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRRLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSLVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLTEKARR
>NZ_CP043422.1|WP_077672786.1|705934_706864_-|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISYDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP043422.1|WP_005460834.1|705299_705923_-|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP043422.1|WP_077672785.1|703375_705115_+|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVIVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAYTTPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATNRQQLMVGKIATIVSGVLATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSLPLTPRESKDLSVVATLAVHLLVTGGFFLLTRVFYAKESPSIQQSRTALAIQLATPISDEELSPINHKQGLYVGSITALAGMLLILVGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP043422.1|WP_005482845.1|702568_703246_-|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP043422.1|WP_069539389.1|700324_702553_-|exopolygalacturonate-lyase
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGDVVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNGKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDLATAVELLPAGGTIILKDGDYQGMEIPLTASGSADKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKMLAPLKQASVIDTQQAIPGKQEAMQLKQLIH
>NZ_CP043422.1|WP_005497702.1|710500_711298_+|DNA-binding-transcriptional-regulator-KdgR
MKGATMEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP043422.1|WP_077672788.1|711381_713250_+|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVKSIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALREERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP043422.1|WP_065787529.1|713252_713963_+|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVVDDWPMVLKDYLQQPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAKINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP043422.1|WP_077672789.1|713963_714833_-|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPFLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP043422.1|WP_077672790.1|714913_715720_-|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQIFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP043422.1|WP_005464962.1|716013_717162_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP043422.1|WP_078224588.1|717223_718063_+|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGADIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP043422.1|WP_077672378.1|720078_720483_+|hypothetical-protein
MMRKFMQILLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLLTSDQFIRMEQTGDNTLSVTVNGRIYQYNNDLWVPKSDGKLQHFLVSATANYVR
>NZ_CP043422.1|WP_005497695.1|720589_721393_-|Cof-type-HAD-IIB-family-hydrolase
MSQVRIKFIASDMDGTLLDQYGRLDPEFFDLFLQLEEQGILFSAASGRQYYSLRDTFAPIKDRVLYVAENGTLVMYQDKELYSCTIPKAEVAEIVQAAREIDGANIVLCGKRSAYIETHDQQSLEEFQKYYHRCETVTDLLEVEDEFIKVAICHFDGSEELLFPTMNAKFGATHKVVVSAKIWLDVMNAEASKGAAIKHLQETMNFTPAETMTFGDYLNDLEMLQVSEHSYAVANAHEEIKKIARYSAPSNQEAGVLKVIKEKVLAK
>NZ_CP043422.1|WP_023584387.1|721488_722376_-|LysR-family-transcriptional-regulator
MDRVTAAKVFVDVVYSGSFTATAERLDMSRPMVTRYVEAMENWLQTRLLHRTTRKVSLTTAGERSLPQIERWLKQADTLTSNIAVDGELSGKIRLASSTSFGFSQLIPAVNSFMQKHPKVHIDIDLQDSVSDLTEQRIDLAIRIASDPDPSLIGKPIAVCESVLVASPQYLQTHHAITHPRDLSSHDCLGYKNFERHVWHLSQGDQFESVGIECRLTSNEATALLHGALQGMGISMLPTYLSNIYLQSGQLESVLPNWKPNDLNIYALYSSRKHLSPAVRAFIDHSEDYFKLHPW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1748422 : 1809562

Vibrio_phage(66.67%)

protease,integrase,transposase

attL 1765941:1765959|attR 1801836:1801854

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010446562.1\|1748422_1749343_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7
WP_149144408.1\|1750192_1750744_-	OmpA family protein	NA	NA	NA	NA
WP_010446562.1\|1751348_1752269_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7
WP_011106336.1\|1753212_1753806_-	pilus assembly protein TadF	NA	NA	NA	NA
WP_077673168.1\|1753780_1754323_-	pilus assembly protein	NA	NA	NA	NA
WP_072828633.1\|1756277_1757147_-	pilus assembly protein TadB	NA	NA	NA	NA
WP_005454188.1\|1757188_1758454_-	CpaF family protein	NA	NA	NA	NA
WP_077673121.1\|1758450_1759650_-	AAA family ATPase	NA	NA	NA	NA
WP_005454289.1\|1759653_1760103_-	hypothetical protein	NA	NA	NA	NA
WP_025638420.1\|1760102_1761446_-	general secretion pathway protein GspD	NA	NA	NA	NA
WP_005481305.1\|1761448_1762201_-	hypothetical protein	NA	NA	NA	NA
WP_011106334.1\|1762259_1762544_-	Flp family type IVb pilin	NA	NA	NA	NA
WP_005454057.1\|1763210_1764119_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.4e-06	36.8
WP_010446562.1\|1764958_1765879_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.6e-175	98.7
1765941:1765959	attL	NA	NA	NA	NA
WP_078232806.1\|1766823_1769886_-\|protease	M6 family metalloprotease domain-containing protein	NA	NA	NA	NA
WP_077673082.1\|1770248_1772351_+	collagenase	NA	NA	NA	NA
WP_077673080.1\|1772521_1773268_+	EAL domain-containing protein	NA	NA	NA	NA
WP_021452744.1\|1773785_1775021_+\|integrase	tyrosine-type recombinase/integrase	A0A1V0E8G8	Vibrio_phage	2.2e-79	40.1
WP_140251920.1\|1775092_1775959_-	purine NTPase	NA	NA	NA	NA
WP_149144409.1\|1776011_1777454_-	AAA family ATPase	NA	NA	NA	NA
WP_021452742.1\|1777404_1778094_-	hypothetical protein	NA	NA	NA	NA
WP_149144410.1\|1778086_1778359_-	hypothetical protein	NA	NA	NA	NA
WP_149144411.1\|1778348_1779383_-	DUF4297 domain-containing protein	NA	NA	NA	NA
WP_077673064.1\|1779706_1781236_+	dGTPase	NA	NA	NA	NA
WP_077673065.1\|1781331_1782669_-	DNA-processing protein DprA	NA	NA	NA	NA
WP_024702883.1\|1782668_1784798_-	RecQ family ATP-dependent DNA helicase	F2NZ48	Diadromus_pulchellus_ascovirus	3.0e-36	30.3
WP_024702880.1\|1786263_1787439_-	YibE/F family protein	NA	NA	NA	NA
WP_024702879.1\|1787530_1789726_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_031855223.1\|1791407_1792310_+	aldose 1-epimerase	NA	NA	NA	NA
WP_017447668.1\|1792385_1793813_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_077673103.1\|1793892_1797207_-	DUF5107 domain-containing protein	NA	NA	NA	NA
WP_078232775.1\|1797566_1797851_+	hypothetical protein	NA	NA	NA	NA
WP_149144412.1\|1803437_1803776_-	hypothetical protein	NA	NA	NA	NA
1801836:1801854	attR	NA	NA	NA	NA
WP_108744649.1\|1808209_1809562_-\|transposase	ISNCY family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043421

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP043422

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection