CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP023728	Lactiplantibacillus plantarum strain 10CH chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh,WYL	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP023728_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023728_1

2763684-2763769

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023728_1

>merge|NZ_CP023728|1|2763684-2763769|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>NZ_CP023728|1|1|2763684-2763769|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023728.1\|WP_003643401.1\|2770139_2770652_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP023728.1\|WP_003642347.1\|2762190_2763669_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP023728.1\|WP_047674095.1\|2757744_2758782_+\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP023728.1\|WP_013355194.1\|2764460_2765723_-\|ISL3-like-element-ISP1-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP023728.1\|WP_003642350.1\|2767113_2767908_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP023728.1\|WP_013355935.1\|2768899_2769895_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP023728.1\|WP_013355931.1\|2761182_2761374_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023728.1\|WP_003642345.1\|2758930_2759497_-\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP023728.1\|WP_003643398.1\|2763786_2764386_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP023728.1\|WP_011102039.1\|2755666_2756032_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP023728.1\|WP_013355932.1\|2761620_2761860_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023728.1\|WP_047674097.1\|2759717_2760671_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP023728.1\|WP_003642340.1\|2755098_2755383_+\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP023728.1\|WP_011102040.1\|2757051_2757618_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP023728.1\|WP_003643400.1\|2767904_2768903_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP023728.1\|WP_047674092.1\|2756164_2756893_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP023728.1\|WP_046947578.1\|2765947_2766829_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP023728.1\|WP_047674104.1\|2771819_2772566_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP023728.1\|WP_013355936.1\|2770632_2771526_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP023728.1\|WP_003642356.1\|2772582_2773038_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047

Protein	Function_ID	Function_description	E-value
NZ_CP023728.1\|WP_003643401.1\|2770139_2770652_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP023728.1\|WP_003642347.1\|2762190_2763669_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.62212e-72
NZ_CP023728.1\|WP_047674095.1\|2757744_2758782_+\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	8.1236e-94
NZ_CP023728.1\|WP_013355194.1\|2764460_2765723_-\|ISL3-like-element-ISP1-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.4786e-56
NZ_CP023728.1\|WP_003642350.1\|2767113_2767908_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP023728.1\|WP_013355935.1\|2768899_2769895_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.35687e-78
NZ_CP023728.1\|WP_003642345.1\|2758930_2759497_-\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
NZ_CP023728.1\|WP_003643398.1\|2763786_2764386_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP023728.1\|WP_011102039.1\|2755666_2756032_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP023728.1\|WP_047674092.1\|2756164_2756893_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.11748e-88
NZ_CP023728.1\|WP_047674097.1\|2759717_2760671_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	7.97295e-131
NZ_CP023728.1\|WP_003642340.1\|2755098_2755383_+\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP023728.1\|WP_011102040.1\|2757051_2757618_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP023728.1\|WP_003643400.1\|2767904_2768903_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP023728.1\|WP_046947578.1\|2765947_2766829_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.58356e-56
NZ_CP023728.1\|WP_047674104.1\|2771819_2772566_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	3.19662e-91
NZ_CP023728.1\|WP_013355936.1\|2770632_2771526_-\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.70513e-130
NZ_CP023728.1\|WP_003642356.1\|2772582_2773038_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	9.94104e-53

>NZ_CP023728.1|WP_003642347.1|2762190_2763669_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP023728.1|WP_013355932.1|2761620_2761860_-|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLLLEFVLLFVVKGSIDHYNQLPYDWFAYLTTLIHYFLGTFAFFGIILVIECVWNKFK
>NZ_CP023728.1|WP_013355931.1|2761182_2761374_+|hypothetical-protein
MAAFSEKQLKKAPITDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>NZ_CP023728.1|WP_047674097.1|2759717_2760671_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVCLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP023728.1|WP_003642345.1|2758930_2759497_-|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP023728.1|WP_047674095.1|2757744_2758782_+|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPTVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKVQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP023728.1|WP_011102040.1|2757051_2757618_-|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP023728.1|WP_047674092.1|2756164_2756893_+|SDR-family-oxidoreductase
MKPLVVITGASSGLGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP023728.1|WP_011102039.1|2755666_2756032_-|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP023728.1|WP_003642340.1|2755098_2755383_+|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP023728.1|WP_003643398.1|2763786_2764386_+|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP023728.1|WP_013355194.1|2764460_2765723_-|ISL3-like-element-ISP1-family-transposase
MSQDHSTKVLLQIKDPNITDLVVQEATNGSLQVLAKLTYPVTVCARCGKRSMVKNGFKTVHIRIPRISERVTILNLKKQRFICKNCGKSSLTTTTLVKKHHQISENSLHAIDLSLTEDRTMASIAAQYNVSTNTISRRIKLLGQGTQPAFNGLPTMLCIDEFRSTGKQMSFIAVDAQTHDIITILPGRKNADIKDFFLNHYSKRHRDRVTRVVMDFNSQYQPAIRTLFPHAKLVADNFHLVQMALRSLNQTRVQLMKRFNPKSREYRVLKYYWRLYLKDYDSLEKRKPQWFAHLKDRMTPEQLVVAGLNLDQQFRQTYQAAHALVKAFQKRDYRSFKAALGHVENVSPQLMTNIKSFIKNRQLIKNMTTGRLSNGPVEGVNRKIKQIKRTAYGYKNWQNFIYRIQIEFKIKIEKKNPIRK
>NZ_CP023728.1|WP_046947578.1|2765947_2766829_-|ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSTVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP023728.1|WP_003642350.1|2767113_2767908_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP023728.1|WP_003643400.1|2767904_2768903_+|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP023728.1|WP_013355935.1|2768899_2769895_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP023728.1|WP_003643401.1|2770139_2770652_+|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP023728.1|WP_013355936.1|2770632_2771526_-|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP023728.1|WP_047674104.1|2771819_2772566_-|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGHVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP023728.1|WP_003642356.1|2772582_2773038_-|acetyltransferase
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

329884 : 414999

Bacillus_virus(16.67%)

protease,tRNA,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033608274.1\|329884_330448_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003641929.1\|330641_331310_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_047672623.1\|331467_332973_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|333237_333606_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|333718_334228_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_013355174.1\|334258_335455_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|335564_336035_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|336053_336509_+	hypothetical protein	NA	NA	NA	NA
WP_047672626.1\|336612_337185_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003646441.1\|337350_338271_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_047672629.1\|338407_339319_+	oxidoreductase	NA	NA	NA	NA
WP_003641939.1\|340208_340655_-	hypothetical protein	NA	NA	NA	NA
WP_003641940.1\|340892_342419_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|342419_343391_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|343468_344800_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|345265_346783_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|346797_348627_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|348641_349364_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_047672635.1\|349950_353646_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_047672638.1\|355482_355791_+	hypothetical protein	NA	NA	NA	NA
WP_021356072.1\|356207_356486_+	hypothetical protein	NA	NA	NA	NA
WP_074161480.1\|356549_356666_+	hypothetical protein	NA	NA	NA	NA
WP_047672641.1\|356789_357707_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|357713_357887_+	hypothetical protein	NA	NA	NA	NA
WP_016511577.1\|358431_358974_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_011100988.1\|358988_359252_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|359367_359571_+	hypothetical protein	NA	NA	NA	NA
WP_047672644.1\|359695_359935_+	hypothetical protein	NA	NA	NA	NA
WP_047672646.1\|359952_360339_+	hypothetical protein	NA	NA	NA	NA
WP_112297220.1\|361181_361328_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_047672648.1\|361404_361812_+	immunity 63 family protein	NA	NA	NA	NA
WP_011100991.1\|363082_363361_+	hypothetical protein	NA	NA	NA	NA
WP_077726969.1\|363687_364305_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_021356659.1\|364308_365463_-	MFS transporter	NA	NA	NA	NA
WP_047672651.1\|365466_366258_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|366328_367201_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|367360_368176_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_047672657.1\|368701_370078_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|370122_371307_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|371691_371895_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|372306_372975_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|372971_373145_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|373175_373343_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|374204_374405_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|374532_374700_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641976.1\|374817_376017_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_047672663.1\|376047_376794_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641979.1\|377671_377818_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_011100998.1\|378008_379337_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_011100999.1\|379337_380081_+	LytTR family transcriptional regulator DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003641982.1\|380199_380943_+	response regulator transcription factor	NA	NA	NA	NA
WP_003646470.1\|381247_382021_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|382119_382278_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|382302_382473_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003641986.1\|382739_384890_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641987.1\|384905_386282_+	HlyD family secretion protein	NA	NA	NA	NA
WP_003641990.1\|387128_387797_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|387883_388564_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_047672670.1\|388657_389344_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_075060682.1\|389459_389747_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_003646479.1\|389758_390052_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_047672673.1\|390341_392651_-	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_021356643.1\|392909_393686_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003643815.1\|394125_395142_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003641997.1\|395547_396258_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003641998.1\|396330_397692_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641999.1\|397698_397887_+	hypothetical protein	NA	NA	NA	NA
WP_003642000.1\|397876_398299_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643816.1\|398521_399877_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_027821494.1\|399894_401331_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.3e-30	25.5
WP_003642003.1\|401411_402308_+	ROK family protein	NA	NA	NA	NA
WP_047672678.1\|402457_403204_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011101007.1\|403316_404330_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_047672680.1\|404783_405917_+	hypothetical protein	NA	NA	NA	NA
WP_003643820.1\|405921_406716_+	hypothetical protein	NA	NA	NA	NA
WP_003642008.1\|406884_407802_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_033608308.1\|407847_409122_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642010.1\|409114_410074_+	hypothetical protein	NA	NA	NA	NA
WP_003642011.1\|410095_410800_+	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_047672684.1\|410799_411642_+	DUF72 domain-containing protein	NA	NA	NA	NA
WP_024971611.1\|412236_412626_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_077726970.1\|412947_414999_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.0e-90	35.8

DBSCAN-SWA_2

577168 : 585792

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644909.1\|577168_578866_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|578887_579196_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|579211_579811_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|579825_580077_+	YaaL family protein	NA	NA	NA	NA
WP_011101140.1\|580474_581140_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|581136_581466_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|581482_582502_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|582526_582874_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_013355239.1\|582972_583869_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640969.1\|583872_584658_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|584796_585792_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5

DBSCAN-SWA_3

995292 : 1096003

109

Lactobacillus_phage(63.46%)

tRNA,holin,capsid,transposase,integrase,terminase,protease,tail,portal,head

attL 1044177:1044193|attR 1097847:1097863

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641341.1\|995292_995613_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_003644129.1\|995612_997076_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003641343.1\|997075_998500_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003641344.1\|998604_999627_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5
WP_003644130.1\|999960_1001334_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.2e-124	50.0
WP_003641346.1\|1001787_1002366_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_047673001.1\|1002632_1004972_+	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	4.2e-39	24.4
WP_003644132.1\|1005212_1006529_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641349.1\|1006521_1007406_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644133.1\|1007530_1008409_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003641351.1\|1008433_1009210_+	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1
WP_003641352.1\|1009365_1009731_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_003638174.1\|1010074_1010275_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641353.1\|1010461_1011469_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_003641354.1\|1011481_1012816_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-37	30.9
WP_047673006.1\|1013057_1014239_-\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	4.1e-59	37.9
WP_003641356.1\|1014406_1014721_-	hypothetical protein	NA	NA	NA	NA
WP_047673009.1\|1015042_1015915_-	hypothetical protein	NA	NA	NA	NA
WP_047673011.1\|1016041_1016713_-	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	5.7e-42	56.3
WP_027821294.1\|1016905_1017121_+	helix-turn-helix transcriptional regulator	A0A2H4JBV7	uncultured_Caudovirales_phage	5.9e-17	71.0
WP_047673014.1\|1017225_1017477_-	hypothetical protein	NA	NA	NA	NA
WP_047673017.1\|1017542_1018250_+	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	2.1e-63	59.5
WP_015825325.1\|1018261_1018471_+	hypothetical protein	NA	NA	NA	NA
WP_172436368.1\|1018484_1018649_+	hypothetical protein	NA	NA	NA	NA
WP_003641365.1\|1018874_1019123_+	hypothetical protein	NA	NA	NA	NA
WP_025015699.1\|1019117_1019339_-	hypothetical protein	NA	NA	NA	NA
WP_003641367.1\|1019396_1019657_+	hypothetical protein	NA	NA	NA	NA
WP_003641368.1\|1020250_1020541_-	hypothetical protein	NA	NA	NA	NA
WP_003641369.1\|1020706_1020910_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003641370.1\|1020922_1021171_+	hypothetical protein	E9LUT6	Lactobacillus_phage	2.7e-29	76.1
WP_047673021.1\|1021173_1021374_+	hypothetical protein	E9LUT7	Lactobacillus_phage	3.8e-26	87.9
WP_165274443.1\|1021385_1021538_+	hypothetical protein	E9LUT8	Lactobacillus_phage	2.3e-07	63.3
WP_013355644.1\|1021659_1021830_+	hypothetical protein	NA	NA	NA	NA
WP_033098960.1\|1021829_1022087_+	hypothetical protein	NA	NA	NA	NA
WP_052098025.1\|1022162_1022720_+	HNH endonuclease	X2KXT0	Enterococcus_phage	1.1e-22	51.4
WP_047673024.1\|1023509_1024295_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	5.9e-131	90.0
WP_047673027.1\|1024430_1024739_+	hypothetical protein	E9LUN7	Lactobacillus_phage	2.8e-44	88.2
WP_047673033.1\|1025075_1025405_+	hypothetical protein	NA	NA	NA	NA
WP_075060688.1\|1025417_1025819_+	hypothetical protein	O03921	Lactobacillus_phage	1.3e-36	63.4
WP_047673036.1\|1025815_1026253_+	hypothetical protein	E9LUP3	Lactobacillus_phage	4.8e-50	71.7
WP_047674698.1\|1026303_1026627_+	hypothetical protein	A0A1S5SGD5	Streptococcus_phage	6.4e-15	47.4
WP_047673039.1\|1026623_1026791_+	hypothetical protein	E9LUP4	Lactobacillus_phage	2.3e-13	87.2
WP_047673042.1\|1026972_1027398_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	5.5e-67	87.2
WP_033098961.1\|1028074_1028887_+	hypothetical protein	NA	NA	NA	NA
WP_013355638.1\|1029046_1029217_+	hypothetical protein	E9LUP6	Lactobacillus_phage	3.3e-23	96.4
WP_013355637.1\|1029227_1029698_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	4.8e-80	91.0
WP_047673045.1\|1029703_1029973_+	hypothetical protein	NA	NA	NA	NA
WP_047673048.1\|1029990_1030248_+	hypothetical protein	NA	NA	NA	NA
WP_003644530.1\|1030436_1030895_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	5.8e-78	94.0
WP_047673051.1\|1030897_1032796_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	95.7
WP_003644528.1\|1032785_1032980_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	7.4e-27	98.4
WP_047673054.1\|1032982_1034176_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	7.6e-223	98.0
WP_003644526.1\|1034153_1034897_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	3.5e-125	95.1
WP_077727022.1\|1034911_1036144_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.0e-201	87.2
WP_025015703.1\|1036216_1036549_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.2e-46	88.0
WP_047673058.1\|1036538_1036886_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	6.6e-42	71.3
WP_047673061.1\|1036888_1037296_+	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	9.4e-64	90.9
WP_047673064.1\|1037295_1037676_+	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.2e-60	92.9
WP_003641402.1\|1037691_1038345_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.5e-111	94.0
WP_003644520.1\|1038421_1038796_+\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
WP_003644519.1\|1038834_1039026_+	hypothetical protein	NA	NA	NA	NA
WP_047673067.1\|1039057_1044088_+	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	53.0
WP_047673070.1\|1044161_1045931_+\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	89.6
1044177:1044193	attL	NA	NA	NA	NA
WP_077727023.1\|1045995_1048353_+\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	95.3
WP_047673076.1\|1048354_1051015_+	hypothetical protein	A0A1I9KK49	Lactobacillus_phage	2.6e-21	54.6
WP_047673079.1\|1051007_1051247_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	5.5e-32	96.1
WP_003641410.1\|1051250_1051412_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	4.7e-19	96.2
WP_047673082.1\|1052226_1053399_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.7e-198	88.7
WP_003644510.1\|1053398_1053662_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_047673085.1\|1053674_1054205_+\|holin	holin	E9LUS0	Lactobacillus_phage	2.5e-40	97.9
WP_154566808.1\|1054443_1054614_+	hypothetical protein	NA	NA	NA	NA
WP_047673088.1\|1055031_1055472_-	universal stress protein	NA	NA	NA	NA
WP_003643302.1\|1055605_1056913_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003643303.1\|1056905_1057772_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643304.1\|1057921_1058122_-	hypothetical protein	NA	NA	NA	NA
WP_003643305.1\|1058321_1058762_+	hypothetical protein	NA	NA	NA	NA
WP_003646269.1\|1059195_1059759_+	hypothetical protein	NA	NA	NA	NA
WP_172436367.1\|1059842_1061198_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_011101277.1\|1061456_1062632_+	serine hydrolase	NA	NA	NA	NA
WP_003646267.1\|1062820_1063939_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.7e-20	31.2
WP_015825371.1\|1064325_1065255_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_003643315.1\|1065444_1066161_+	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_046947837.1\|1066310_1067426_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	8.8e-173	79.3
WP_077727024.1\|1067716_1068382_+	hypothetical protein	NA	NA	NA	NA
WP_046947835.1\|1068386_1068977_+	AAA family ATPase	NA	NA	NA	NA
WP_046947834.1\|1068981_1070103_+	hypothetical protein	NA	NA	NA	NA
WP_046947845.1\|1070162_1070945_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_052098027.1\|1070965_1071967_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.3e-10	30.4
WP_046947833.1\|1071974_1072976_+	stealth conserved region 3 domain-containing protein	NA	NA	NA	NA
WP_129021584.1\|1072980_1074012_+	sugar transferase	NA	NA	NA	NA
WP_046947832.1\|1074076_1075396_+	oligosaccharide repeat unit polymerase	NA	NA	NA	NA
WP_046947831.1\|1075638_1077057_-	polysaccharide biosynthesis C-terminal domain-containing protein	NA	NA	NA	NA
WP_047673097.1\|1077227_1078427_-	hypothetical protein	NA	NA	NA	NA
WP_046947829.1\|1078632_1079637_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.0e-67	41.5
WP_047673100.1\|1079694_1080297_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	8.2e-32	41.9
WP_052098029.1\|1080653_1081424_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_011101299.1\|1081435_1082164_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_027822000.1\|1082150_1082924_+	tyrosine protein phosphatase	NA	NA	NA	NA
WP_046947827.1\|1082941_1083889_+	GDP-mannose 4,6-dehydratase	A0A1V0SAI6	Catovirus	1.8e-41	34.9
WP_047673109.1\|1083869_1084547_+	sugar transferase	NA	NA	NA	NA
WP_077727077.1\|1084772_1085948_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_186268762.1\|1086075_1087005_+	glycosyltransferase	NA	NA	NA	NA
WP_011101305.1\|1088056_1089196_+	EpsG family protein	NA	NA	NA	NA
WP_011101306.1\|1089202_1090753_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_047673112.1\|1090827_1091919_+	glycosyltransferase	NA	NA	NA	NA
WP_011101308.1\|1092043_1092244_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_047673115.1\|1093403_1094072_+	hypothetical protein	NA	NA	NA	NA
WP_047673118.1\|1094049_1094940_+	hypothetical protein	NA	NA	NA	NA
WP_141640159.1\|1095127_1096003_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.7e-20	28.1
1097847:1097863	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1294822 : 1307944

Lactobacillus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047673267.1\|1294822_1295794_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.4e-179	98.1
WP_047673270.1\|1295948_1296926_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
WP_003643097.1\|1297269_1297884_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_047673273.1\|1297886_1300325_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_003643095.1\|1300412_1300973_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_047673276.1\|1301043_1301484_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.8e-76	98.6
WP_052098033.1\|1301828_1302296_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	6.1e-83	99.4
WP_052098034.1\|1302270_1303245_+	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	2.3e-31	92.0
WP_047673279.1\|1303348_1303558_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003640226.1\|1305670_1307944_-	HAD-IC family P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	1.3e-37	23.5

DBSCAN-SWA_5

2171495 : 2212281

Lactobacillus_phage(55.17%)

holin,capsid,transposase,terminase,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047673679.1\|2171495_2171873_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	7.9e-17	66.2
WP_047673681.1\|2171859_2172156_-	prophage P1 protein 59	A0A1I9KK55	Lactobacillus_phage	3.4e-39	76.5
WP_047673683.1\|2172156_2173329_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.1e-200	89.2
WP_075060706.1\|2174258_2174393_-	XkdX family protein	NA	NA	NA	NA
WP_047673684.1\|2174385_2174655_-	hypothetical protein	NA	NA	NA	NA
WP_077727029.1\|2174666_2177048_-	hypothetical protein	Q597U3	Lactobacillus_virus	8.1e-200	60.9
WP_047673686.1\|2177048_2177339_-	hypothetical protein	NA	NA	NA	NA
WP_047673688.1\|2177335_2177557_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_047673690.1\|2177549_2178677_-\|tail	phage tail protein	O03938	Lactobacillus_phage	4.0e-72	42.0
WP_047673692.1\|2178688_2179507_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_052098044.1\|2179507_2185138_-\|tail	phage tail tape measure protein	U5U708	Lactobacillus_phage	8.0e-113	59.0
WP_052098045.1\|2185153_2185795_-	hypothetical protein	U3PFU8	Lactobacillus_phage	4.8e-06	28.2
WP_047673694.1\|2185791_2186310_-	hypothetical protein	NA	NA	NA	NA
WP_047673696.1\|2186429_2187050_-	hypothetical protein	NA	NA	NA	NA
WP_047673698.1\|2187067_2187493_-	hypothetical protein	NA	NA	NA	NA
WP_041153366.1\|2187492_2187894_-	hypothetical protein	NA	NA	NA	NA
WP_047673700.1\|2187890_2188280_-	hypothetical protein	NA	NA	NA	NA
WP_052098046.1\|2188280_2188685_-	hypothetical protein	A5GYM1	Lactococcus_phage	1.8e-06	28.2
WP_075060707.1\|2188695_2188956_-	hypothetical protein	NA	NA	NA	NA
WP_047673702.1\|2189044_2190007_-\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	2.8e-90	60.2
WP_052098047.1\|2190020_2190632_-	hypothetical protein	NA	NA	NA	NA
WP_052098048.1\|2190695_2191781_-	hypothetical protein	A0A1B1P858	Bacillus_phage	6.9e-37	35.7
WP_141640162.1\|2191773_2193369_-\|portal	phage portal protein	B5LPR1	Bacillus_virus	2.2e-84	37.5
WP_047673706.1\|2193371_2194697_-\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	2.6e-139	55.9
WP_047673708.1\|2194677_2195238_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	3.9e-52	78.1
WP_100140003.1\|2195278_2195611_-	DUF2829 domain-containing protein	A0A0K2FLC4	Brevibacillus_phage	1.5e-11	44.3
WP_047673712.1\|2195607_2196270_-	hypothetical protein	A0A090DC14	Clostridium_phage	5.0e-06	29.4
WP_077727032.1\|2196271_2197210_-	DUF4868 domain-containing protein	NA	NA	NA	NA
WP_024971546.1\|2197873_2198335_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.2e-38	56.3
WP_047673728.1\|2198626_2199103_-	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	8.4e-48	60.8
WP_047674766.1\|2199095_2199461_-	hypothetical protein	A0A1I9KKG9	Lactobacillus_phage	5.0e-32	56.9
WP_172436375.1\|2199475_2199634_-	hypothetical protein	O03920	Lactobacillus_phage	5.3e-15	78.8
WP_047673732.1\|2199785_2200166_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_047673734.1\|2200162_2200681_-	hypothetical protein	O03915	Lactobacillus_phage	5.0e-54	67.8
WP_033607985.1\|2200959_2202609_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.5e-93	41.5
WP_172436376.1\|2202590_2202740_-	hypothetical protein	NA	NA	NA	NA
WP_047673741.1\|2202736_2203645_-	DnaD domain protein	NA	NA	NA	NA
WP_047674769.1\|2203723_2204476_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	1.2e-72	51.0
WP_033611994.1\|2204507_2205395_-	recombinase RecT	E9LUM3	Lactobacillus_phage	1.9e-61	47.7
WP_075060709.1\|2205391_2205778_-	hypothetical protein	NA	NA	NA	NA
WP_047673749.1\|2206148_2206661_-	transcriptional regulator	D6PST4	Lactobacillus_phage	1.6e-28	43.5
WP_047673751.1\|2206728_2207034_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_047673753.1\|2207045_2207216_-	hypothetical protein	NA	NA	NA	NA
WP_047673755.1\|2207212_2207467_-	helix-turn-helix transcriptional regulator	A0A2H4JFN1	uncultured_Caudovirales_phage	1.5e-06	41.3
WP_047673757.1\|2207608_2208127_+	helix-turn-helix domain-containing protein	S6C481	Thermus_phage	2.1e-15	34.1
WP_047673759.1\|2208141_2208564_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	1.3e-12	35.1
WP_161938666.1\|2208664_2209588_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_047673763.1\|2209751_2210471_+	hypothetical protein	NA	NA	NA	NA
WP_016511204.1\|2210749_2210926_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.9e-11	53.4
WP_047673765.1\|2211087_2212281_+	hypothetical protein	A0A141E0C6	Streptococcus_phage	5.4e-19	25.9

DBSCAN-SWA_6

2415075 : 2423586

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2415075_2415654_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_027821845.1\|2415646_2416672_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.3e-60	41.3
WP_003642591.1\|2416668_2418123_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_047673854.1\|2418107_2420327_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.1
WP_011101895.1\|2420319_2421000_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2420999_2421254_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2421255_2421987_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_076657629.1\|2421989_2423120_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2423103_2423586_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage