CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019882	Mycobacterium litorale strain F4 chromosome, complete genome	3 crisprs	DinG,DEDDh,csa3,WYL,cas4,cas3,RT	5	18	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019882_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019882_1

244471-244859

Orphan

Consensus_repeat	Method
GGTNACGGNGGCNACGGNGG	CRT

7 spacers

The CRISPR arrays of NZ_CP019882_1

>merge|NZ_CP019882|1|244471-244859|CRT
GGTGACGGCGGCGGCGGTGGTGCCGGTGCGGGTTCGGCCAAGGGCGGTGATGGTGGCGACGGTGGCGCCGGCGGGGCCCTCGGCCGGGGCGGCAATGGCGGTGCCGGCGGCGCCGGGTCCGGCGCCGGTCGCGGTGGCGACGGCGGTGCGGGCGGCAACGCGGGCGTGAACGCCGGGCCGGACGGCAACGGCGGCAACGGCGGTGGTGGTGGTGACGGCGGCGGCAGCGGTAACGGCGGCAACGGTGGCAAGGGCGGGAACGCCGGCGCCGAGGGCACTGGAGGTAACGGAGGCAACGGCGGCGCCGGGCGGAGCCGGGGCGGCGACGGGGGTAACGGCGGCAACGGCGGCAGCACGTCGGGCTACGGCGGCACCGGCGGCACCGGCGG

>NZ_CP019882|1|1|244471-244859|CRT
GGTGACGGCGGCGGCGGTGG	TGCCGGTGCGGGTTCGGCCAAGGGC
GGTGATGGTGGCGACGGTGG	CGCCGGCGGGGCCCTCGGCCGGGGCGGCAATGGCGGTGCCGGCGGCGCCGGGTCCGGCGCC
GGTCGCGGTGGCGACGGCGG	TGCGGGCGGCAACGCGGGCGTGAACGCCGGGCCGGAC
GGCAACGGCGGCAACGGCGG	TGGTGGTGGTGACGGCGGCGGCAGC
GGTAACGGCGGCAACGGTGG	CAAGGGCGGGAACGCCGGCGCCGAGGGCACTGGA
GGTAACGGAGGCAACGGCGG	CGCCGGGCGGAGCCGGGGCGGCGACGGG
GGTAACGGCGGCAACGGCGG	CAGCACGTCGGGCTACGGC
GGCACCGGCGGCACCGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019882.1\|WP_078017376.1\|240506_242141_-\|PE-PPE-domain-containing-protein	unknown	unknown	gnl\|CDD\|369775
NZ_CP019882.1\|WP_078017383.1\|252943_253282_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|197713
NZ_CP019882.1\|WP_078017374.1\|238366_239707_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP019882.1\|WP_078017386.1\|255880_256471_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017372.1\|235230_237450_-\|molybdopterin-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|239163
NZ_CP019882.1\|WP_078017382.1\|250199_251642_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223700
NZ_CP019882.1\|WP_078017379.1\|247332_247623_+\|metal-sensitive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197385
NZ_CP019882.1\|WP_078017377.1\|244922_246659_-\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|234861
NZ_CP019882.1\|WP_078017380.1\|247707_248946_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NZ_CP019882.1\|WP_078017384.1\|253283_253799_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380316
NZ_CP019882.1\|WP_078017369.1\|233230_233980_+\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP019882.1\|WP_078017371.1\|234470_235136_+\|O-methyltransferase	unknown	unknown	gnl\|CDD\|226607
NZ_CP019882.1\|WP_078017375.1\|239706_240501_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375542
NZ_CP019882.1\|WP_078017370.1\|233976_234474_+\|TIGR04338-family-metallohydrolase	unknown	unknown	gnl\|CDD\|275137
NZ_CP019882.1\|WP_078017385.1\|253812_255798_-\|peptidase-M13	unknown	unknown	gnl\|CDD\|226118
NZ_CP019882.1\|WP_078017373.1\|237513_238275_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP019882.1\|WP_078017368.1\|230190_231186_-\|RNA-polymerase-subunit-sigma-70	unknown	unknown	gnl\|CDD\|236196
NZ_CP019882.1\|WP_078017378.1\|246738_247332_+\|DUF305-domain-containing-protein	unknown	unknown	gnl\|CDD\|367619
NZ_CP019882.1\|WP_078017381.1\|249089_250145_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341130
NZ_CP019882.1\|WP_078021708.1\|232125_233154_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP019882.1\|WP_078017376.1\|240506_242141_-\|PE-PPE-domain-containing-protein	gnl\|CDD\|369775	pfam08237, PE-PPE, PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.	1.18703e-10
NZ_CP019882.1\|WP_078017383.1\|252943_253282_+\|transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	3.50674e-08
NZ_CP019882.1\|WP_078017374.1\|238366_239707_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	2.99402e-36
NZ_CP019882.1\|WP_078017372.1\|235230_237450_-\|molybdopterin-binding-oxidoreductase	gnl\|CDD\|239163	cd02762, MopB_1, The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_CP019882.1\|WP_078017382.1\|250199_251642_+\|hypothetical-protein	gnl\|CDD\|223700	COG0627, COG0627, Predicted esterase [General function prediction only].	8.99973e-07
NZ_CP019882.1\|WP_078017379.1\|247332_247623_+\|metal-sensitive-transcriptional-regulator	gnl\|CDD\|197385	cd10148, CsoR-like_DUF156, Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This superfamily includes various transcriptional regulators that respond to stressors including Cu(I), Ni(I), sulfite, and formaldehyde. It includes CsoR (copper-sensitive operon repressor) from Mycobacterium tuberculosis (MtCsoR), Bacillus subtilis (BsCsoR), Thermus thermophilus (TthCsoR), and Staphylococcus aureus (SaCsoR), Mycobacterium tuberculosis RicR (regulated in copper repressor, MtRicR), Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), Alcaligenes xylosoxidans NreA (nickel-sensitive), E. coli FrmR (formally known as YaiN, formaldehyde sensitive), and Staphylococcus aureus CstR (CsoR-like sulfur transferase repressor, NWMN_0026.5, SaCstR). CsoR is Cu(I)-inducible, and regulates the expression of genes involved in copper homeostasis. For example, TthCsoR binds the promoter region of the copZ-csoR-copA operon, and represses expression of these genes, which encode the copper chaperone CopZ, CsoR, and the copper efflux P-type ATPase CopA, respectively. In the presence of excess Cu(I), TthCsoR binds this ion, and is released from the DNA, allowing expression of the downstream genes. TthCsoR also senses other metal ions such as Cu(II), Zn(II), Ag(I), Cd(II) and Ni(II). CsoRs form a homotetramer (dimer of dimers). In the case of MtCsoR, two Cys residues on opposite subunits within each dimer, along with a His residue, bind the Cu(I) ion. These residues are conserved in the majority of members of this superfamily. Exceptions include the functionally uncharacterized Bacillus subtilis YrkD where there is an Asn instead of His (C-N-C), E.coli RcnR where there is a Thr instead of the second Cys (C-H-T), or TthCsoR and E.coli FrmR where there is a His instead of the second Cys and which have an additional N-terminal His (not found in those family members having C-H-C) that may also be involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue facilitate allosteric regulation of DNA binding. SaCstR regulates genes predicted to function in sulfur metabolism; it is thought that oxidation of the intersubunit Cys pair to a mixture of disulphide and trisulphide linkages by sulfite, results in a reduced affinity of SaCstR for the operator DNA. SaCstR exists as a mixture of oligomeric states, including dimers, tetramers and octamers. The sequence of SaCstR was not available at the time this hierarchy was curated and therefore was not included. Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA. The gene encoding Alcaligenes xylosoxidans NreA is part of the nre nickel resistance locus located on the pTOM9 plasmid from thisbacteria. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon.	2.88796e-32
NZ_CP019882.1\|WP_078017377.1\|244922_246659_-\|dihydroxy-acid-dehydratase	gnl\|CDD\|234861	PRK00911, PRK00911, dihydroxy-acid dehydratase; Provisional.	0
NZ_CP019882.1\|WP_078017380.1\|247707_248946_+\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	1.12824e-67
NZ_CP019882.1\|WP_078017384.1\|253283_253799_-\|nitroreductase	gnl\|CDD\|380316	cd02139, nitroreductase, nitroreductase family protein. A subfamily of the nitroreductase family containing uncharacterized proteins. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer.	6.68149e-35
NZ_CP019882.1\|WP_078017369.1\|233230_233980_+\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	5.46476e-08
NZ_CP019882.1\|WP_078017371.1\|234470_235136_+\|O-methyltransferase	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	5.42934e-54
NZ_CP019882.1\|WP_078017375.1\|239706_240501_+\|hypothetical-protein	gnl\|CDD\|375542	pfam18089, DAPG_hydrolase, DAPG hydrolase PhiG domain. This domain is found in 2,4-diacetylphloroglucinol hydrolase PhiG present in Pseudomonas fluorescens. 2,4-diacetylphloroglucinol hydrolase is the gene product of PhiG that is responsible for cleaving toxic 2,4-diacetylphloroglucinol (DAPG). The small N-terminal region of the domain is involved in dimerization through hydrogen bonding of the dimer interface. The C-terminal catalytic region resembles the tetracenomycin aromatase/cyclase and has a Bet v1-like fold. DAPG PhiG is the first discovered hydrolase whose catalytic domain belongs to the Bet v1-like fold, rather than the classical alpha/beta-fold hydrolases.	5.50945e-81
NZ_CP019882.1\|WP_078017370.1\|233976_234474_+\|TIGR04338-family-metallohydrolase	gnl\|CDD\|275137	TIGR04338, hypothetical_protein, putative metallohydrolase, TIGR04338 family. This protein family is restricted to the Actinomycetales, including Mycobacterium, Rhodococcus, Nocardia, Gordonii, and others. The invariant motif HEXXH, at the core of the best conserved region in the protein, suggests metallohydrolase activity, as does local sequence similarity in this region to other metallohydrolases.	1.81677e-78
NZ_CP019882.1\|WP_078017385.1\|253812_255798_-\|peptidase-M13	gnl\|CDD\|226118	COG3590, PepO, Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP019882.1\|WP_078017373.1\|237513_238275_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.87652e-45
NZ_CP019882.1\|WP_078017368.1\|230190_231186_-\|RNA-polymerase-subunit-sigma-70	gnl\|CDD\|236196	PRK08241, PRK08241, RNA polymerase subunit sigma-70.	0
NZ_CP019882.1\|WP_078017378.1\|246738_247332_+\|DUF305-domain-containing-protein	gnl\|CDD\|367619	pfam03713, DUF305, Domain of unknown function (DUF305). Domain found in small family of bacterial secreted proteins with no known function. Also found in Paramecium bursaria chlorella virus 1. This domain is short and found in one or two copies. The domain has a conserved HH motif that may be functionally important. This domain belongs to the ferritin superfamily. It contains two sequence similar repeats each of which is composed of two alpha helices.	1.4436e-52
NZ_CP019882.1\|WP_078017381.1\|249089_250145_+\|hypothetical-protein	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	4.02097e-26

>NZ_CP019882.1|WP_078017376.1|240506_242141_-|PE-PPE-domain-containing-protein
MFNSVQDGGFRRTRQGRAQARNLIAATAVAAAAAVGLASTEATVPAARADGASTINITVDPTFTAGIIAGLLDVLGVDDIPIPINQEIPVPIIGPITIGTLELVLHNVPSNPASIYNAINGYSGWSTTGSTRYRFPATVGIGNGAFDLVNAYRAQLDSVHGNTPSGYTPFVPGPGGQVNFTSQVLIYGQNPYRPNGGILTRFGPLLNLFGVDTTLPPVGRHTDATGKIVLNTATLDLTWAYDPLSDFPVTLNPFSLANSALAALPTNLLGGVEIDPAFQEQLVDAGLNIAGTLGVLYNLSGGVLTPPDGQAWYATLIPKDLPLLEPLRLPVRVINAVSSLIGHPLNLGTPLADALQPALSILVNTGYTDVRTPTDGGTYNRTFDQSATDVPFLSQAPLTPAEWAQVPGDVVRALIVGFQDSFPVLRFGQPAPTLVVDGNHLAISYDSTPVTAGATVPTAAAAPDASTEADSATPAVPKVATSGHRSAVGGAVQTRASSAASRPGAQRTTSRAEVHRASSPDSTSKASASARKSTADRSATRSGR
>NZ_CP019882.1|WP_078017375.1|239706_240501_+|hypothetical-protein
MAGLHGEAYLGYRAGDADTAWGRYFNPQMQPLPGHVVVALDHGPQADQTLLGFDSAATLLDEGYQQTENGYGTLRGGGFQVSVRTDMPGVTPAMWDWWFGWHGSDSRRYKLWHPRAHASARWGDEDADGRWVGRTSIIEEYLGSSYAKAAIQFLEPSALGLDADRLGDSVAVCARLGSSEVPVDIGWFIHHIRATADGAEMRSRFWMGGPYTGVRRGNRLADSVIRPIAAHQLPDPRDLLVHCAQEMNHLAAFLPALHAEFADS
>NZ_CP019882.1|WP_078017374.1|238366_239707_+|FAD-binding-oxidoreductase
MGSLPEGRHFFHGDDGYEVARRATVWNQRVPDRYPDVIVQAVDADDVVATIRYAKAHDKKVSIKSGGHSWAASHLRDGAVLLDMSRLDQTSVDAEKMVAVAGPGKGGSVLAGELDALGLFFPAGHCKGVRIGGYLLQGGYGWNSRVYGPACESVIGLDVVTADGEQLYIDADNHPDLYWAARGAGPGFFAVVTAFHLKLYPKPPVLGSSFYAYPIECADDIYTWARQISADVDRRVELQIVASSSVPNAGIDQPAIVLASPVFADTEAEAKEAFGILDRCPVVDKALIAMPYVPMALPDWYTAVMSNYLEDHRYTADNMWTSASADDLLPGIRRIIETMPPHPSHFLWLNWGPSPQRQDMAYSLEDPIYLALYAGWRDAADDEKYGDWPRSNMAAMAPLASGIQLADENLGARPARFVSDENMAKLDRVRADYDPDGRFHSWMGRV
>NZ_CP019882.1|WP_078017373.1|237513_238275_-|IclR-family-transcriptional-regulator
MADPKISVVADTRSSSTRDDGIQVLRRAAAALDEIATAPGRLRLVDLHSRLGLAKSTARRLLVGLVEVGFAAVDDDGRISLGDRLLGLASANAAHITSAFRPTLERVAEATGETVDLSVYRGGQMLFIDQIESPHRLRAVSAIGGRFTLWDTANGKATLALLDDSDVEAVLAPLEASVADRVRAEIREIRTSRVAYDRDEHTSGISAAGIAGRAAGGNIVAISVPAPTERFTAHRDRIVDALRGALESSAWCS
>NZ_CP019882.1|WP_078017372.1|235230_237450_-|molybdopterin-binding-oxidoreductase
MTRTALRICPICEATCGLVLTVDDGRVTSARGDRDDVFSHGFICPKGASFPELDNDPDRLRNPLVRRDGELVETSWAEAFAAAAHGLQRVIGQTGGSSVAMYLGNPNAHTIAGSLYAPVVIKSLGTRQVYSASTLDQMPKHVSCGYLYGNPVAFTIPDLDRTDYLVILGGNPLVSNGSLATAADFGGKLKALRRRGGTLVVIDPSRTRTAELADRHLAPRPGTDAALLFAIVHVLFDEDLVNLGRLADQVTGIEQVRAVAADFPPTAVAGHCGIDADEIRTLAREIAAAPSAAVYGRIGTSTVGFGTVTSWLVDVVNILTGNLDRAGGVMFTSSPIAAAPRPPRPGRGFATGRWHSRVAKHPEVLSELPTVALAEEIETPGDGQVRAVITIAGNPVLSAPDGARLGDALDSVDFMVSVDPYLNETTRHADVILPPPPPSYAAHFDIALSAAAVRNNARYSPPVLELPAGRPDECEILSRLALIVLGMGPDADPKLVDDQVIGAALGKEVADANSPVHGRSVEELAAMLPDAPGYERRLDMMLRLGPFGDAFGTKPDGLTLQRLRETPHGVDLGALTPRIPEVLRTPSGTVELAPEPILADIPRLLASLTDEPGLLLIGRRHLRSNNSWMHNLPALSGGTNRCTLQIHPDDAARLGLGELAVITGPGGKLEVPVEITDTIRPGVVSLPHGWGHDEPGTRMRVAARHPGVNVNNLNDGTLLDPLSGTAVLNALPVEVAPAG
>NZ_CP019882.1|WP_078017371.1|234470_235136_+|O-methyltransferase
MNDSIGPHDWRPVDELFDRLLLDDDPALAAALADSAAAGLPAIEVSPQSAQLLYLLTRIRGARRVLEIGTLGGYSTICLARGVGAEGSVVTLEFEPRHAVVAQRNLERAGVADRVDIVVGAALDSLPGLTGHFDLVFIDADKENNSAYLRWAIELGRPGTVIVVDNVVRHGRILNPADGDRQARGVRDMLEMMSTHPRLDSAAIQTVGLKGWDGVAIALVT
>NZ_CP019882.1|WP_078017370.1|233976_234474_+|TIGR04338-family-metallohydrolase
MTTRDSQRSRVYAAEEFVRTLFDRAAQHSSRSIDFFGTQLTLPPEGRFASMPSAQRYVDEVLALPAVTDRWPGPGPLRVRGRRSATAAHYERQEGTGVIAVPDRDSADWAMRELVVLHEIAHHLTPDGPAHGPEFTATFCELATMVMGPEVGHVLRVVYTKEGVR
>NZ_CP019882.1|WP_078017369.1|233230_233980_+|DUF2786-domain-containing-protein
MSDDKMLARIAALLRQAEGTDNAHEAEAFMAAAQRLATATSIDLAVARAHSATRTAAQAPTQRTITIGEPGSRGLRTYVQLFAGIAAANDVQCDVASNSTFVYAYGFAEDIDASHALYASLVVQMVRACDAYLATGAHRPTPTITARLNFQLAFGARVAQRLAEAREQARAEATADRKTAPGTALALRNKDIELRTYYRQTSKARGTWQASRASAGYSSAARRAGDRAGKQARLGASPELPGARSRLPR
>NZ_CP019882.1|WP_078021708.1|232125_233154_+|hypothetical-protein
MRCLAALTLALLLVVGCSSNGATQHAWVEDEVTFDADGLTVHGTYRHQHGSPQGPAALLISESGRTDRNGDNNVAGPIGNMRQLAEYLSDHGIATLRYDKVGTGRTGLGPYVGRPADVGSAVYTTGAKAAVRFLADQSGTDKNRISVYALGEGTIHAMALADDTSAGAPKIHSLGLLQPLAGRYLDLITNRVNADVAAAVKSGQKNQQQADQVIAEWNAAVAEARTKGTVPAKLPEGLSAILNPGNVKAVVEADAIDPLELAARLPAGMPVLMTCSDSDAQANCADAKPLSAALGHTALTLVELKGVNHVLRDDPTDNVGNYAKPAPLSPQLTAALDQFVTK
>NZ_CP019882.1|WP_078017368.1|230190_231186_-|RNA-polymerase-subunit-sigma-70
MSVLAQSLDEGDGDFLAQAEPYRRELLAHCYRMTGSLHDAEDLVQETFLRAWKSFDRFEGKSSVRTWLHRIATNTCLTALEGRQRRPLPTGLGAPSSHPADELVERTEVAWLEPLPASFHDDPADPLTIVGSRESVRLAFVAALQHLSPRQRAVLVLRDVLQWRAAEVADAVGTSTAAVNSLLQRARAQLDEVGPSQDDQLAPPESAQARDQLARYIAAFEDYDIERLVEMFTAEAIWEMPPFVGWYQGGPAIGALIHQNCPANAAGDMRLLPLTANGQPAAAMYMRLPESGGRHVPFQLHVLDMGPDGISHVVAFLDTSLFAKFGLPEVL
>NZ_CP019882.1|WP_078017377.1|244922_246659_-|dihydroxy-acid-dehydratase
MSQTPDLKPRSRDVTDGLEKAAARGMLRAVGMGDEDFAKPQIGVASSWNEITPCNLSLDRLAKAAKDGVYAAGGYPLEFGTISVSDGISMGHEGMHFSLVSREVIADSVETVMMAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAKLSDGTEMDVTIIDAFEAVGACARGLMSREDVDTIERAICPGEGACGGMFTANTMASAAEALGMSLPGSAAPPATDRRRDGYARRSGEAVVELLRRGITARDIMTKEAFENAIAVVMAFGGSTNAVLHLMAIAHEAGVKLDLADFTRIGAKVPHLADVKPFGKHVMFDVDRIGGVPVVMKALLDAGLLHGDVMTVTGETMAANLAHIAPPDPDGKVLRALSNPIHPTGGITILHGSLAPEGAVVKSAGFDSDVFEGTARVFDGERAAMDALEDGTIVAGDVVVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDGGPIAFVNDGDRIRLDVGNGTLDVLVDEAEFDSRRAGFTPPAPKYTTGVLAKYRKLVGSAAQGPSAASRRPSFRRRSAAT
>NZ_CP019882.1|WP_078017378.1|246738_247332_+|DUF305-domain-containing-protein
MTSISSRIVAVAATFAVAVVLPACSSSQDHAEHPTSTTTSVTVAAHNADDVMFAQMMIPHHQQALELSALVPDRSSNPAVVDLAAKIAAEQQPEINTMKALLLQWDVDPNAAADHGGHGMGMAGMVDDATMTRLDSLKGPDFDTLWLQSMIGHHQGAIEMAKAEVANGQSADMTTLAKSIITAQQAEIDQMKQMLGG
>NZ_CP019882.1|WP_078017379.1|247332_247623_+|metal-sensitive-transcriptional-regulator
MTGAHGYSARKDNYAKRLRRIEGQVRGIAKMIDEDKYCIDVLTQISAVNSALQSVALGLLEEHLNHCVSHAVAEGGDEAEKKLAEASAAIARLVRS
>NZ_CP019882.1|WP_078017380.1|247707_248946_+|MFS-transporter
MPSVPNRTGPWTPRVTAALAVLAAAAFIYVTAEIMPVGALPAIARDLHVSEAMVGTLLATYALVAALATMPLVRWTADWPRRRTLLCTLACLSVSQLISALAPTFAVLAVGRVLCAVTHGLMWSVIAPIGVRLVPPSHAGRATMAVYVGTGLALVVGSPLTAAMSELWGWRLAVGAIAAVSLAVLAAARLALPFMAAFPRTAPANAAQARRIGHRHNSPLVILSALTLVGVTGHFISYTFIVVIIRDVVGVRGPHLAWLLAGYGIAGLTAMAVLARPGDRRPKGAVMGCLAGTSVAFVVLATLGWAGQHTAAAVAAGAAAVVLWGATVTAMPPMLQAAAMRHAPDDPDGASGLYVAAFQVGIMAGSLAGGLLYQRAGLPVMLAASAALMLSALVSVVASRGLFALAPATSEK
>NZ_CP019882.1|WP_078017381.1|249089_250145_+|hypothetical-protein
MALRVKGAVAAALCVVGVVAGISLGSGSALADPDQAPVDPAVVDVPPVEVPAEPPAPLPGPDPAAMPAPDPALPGPPPDPNAPPAPIDPLAAQQAAAAAGPVKGQNPLPYSGDPVFAPPSFNPVNGALVGVAKPIIINFARPIANRPLAESAIHISSVPPVPGAFYWTTDTQVRWRPYSFWPSGTVVNIDASGAKSNFRVGDALVATVDDKTHQMTVTRNGKVEKTFPVSMGKPDGKHETKNGTYYVLEKFPDIIMDSSTYGVPVNSAEGYKLKVQWAVRIDNSGAFVHSAPWSVADQGKRNVSHGCINLAPDNAKWFYDNFGSGDPIVVKNSVGTYNNPDGADDWQWQLA
>NZ_CP019882.1|WP_078017382.1|250199_251642_+|hypothetical-protein
MPPTPSPTPSPADPTPPLPQLPAPDFHQYAHGISLLGGWLPLTVEIVAAIAVVAVVSRRTRRWWLLWFPVSVAVGVLGALAARTYVNSEGLASDPAPFGLWIWIGVFAAGIAVVVVGWRGSPWWRRSLSIVAIPLTLLSALLALNQWVGYYPSVQTAWGALTAGPLPNQVDAADLPALRNTVQSAGKLVEVDIGSQASGFKHRSEYVYLPPAWFAGATPPRLPVIMMVAGEFNTPADWIRTGNAMPIIDGYAKSHGGQAPIFVFVDSGGSFNNDTECVNGPRGNAADHLTKDVRPYVIKNFGAADQAADWAVVGWSMGGTCAIDLTVMHPELFSTFEDIAGDHGPTAGTKEQTISRLYGGDAAAWDEFDPRTVMLRHGPYVGVAGWFEDTVKPAAGASPYGGGHRPQSDAPLGFGGHDEFRDSDEAGAADDLCGVAHTVDIACSVHRIISYHTWQFAERAFSDALPWLAAQIKTPGSAPG
>NZ_CP019882.1|WP_078017383.1|252943_253282_+|transcriptional-regulator
MAESDNALEADCHPVGAVHQVLAALQDPVRLEMIRRLRNAGIPLQCSALYDGINKSTATHHFKILREAGIIERQVTGGLIYQRLRTAEVDEALPGLLASVVEGANREASTRA
>NZ_CP019882.1|WP_078017384.1|253283_253799_-|nitroreductase
MDAWDAIRARRNVRSYTAEPIPDDVVDRILEAGWRSPSARNNQHWDFVIVTDPAVLQDLSTVWVGAGHIAGARAAIALVLPDAPDERTRLMDQYDLGQATMAMAVAATDAGVGTGHSAVGDQERARAILGVPEDHTVAYLLGLGYPADRPLAPIRKPNRRPFTEVVHRGRW
>NZ_CP019882.1|WP_078017385.1|253812_255798_-|peptidase-M13
MTVETVRSGLDLSHVEADIRPQDDLFGHVNGRWLTEYAIPADRATDGAFRTLYDRAEEQVRELITAAAESGSGTPGDEQRIGDLYASFLDEDAVEQRGVQPLLDELARIDAATDPAALAAVIGTLQRTGVGGGVGLYIDTDSKNSTRYLVHLTQSGLGLPDESYYRDEQHAAILGAYPQHIAAMFALVLGGTPDEQAERAGRIVALETRLAAAHWDVVKRRDADLTYNLRTFADLPTEAPGFDWTGWINALGSSPQAVSELVVRQPDYLTAFADLWSGADFADWQDWARWRLIHSRAAVLSRAVVDENFAFYGRTLSGTEENRERWKRAVSLVESLMGDAVGRLYVDRHFPPDAKARMDVLVDNLREAYRVSINDLAWMTPATRQRALAKLDKFTAKIGYPKKWRDYSELVIDRDDLYGNAIRGAELEFKREFGKLGGPVDRDEWFMTPQTVNAYYNPGMNEIVFPAAILQPPFFDAEADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWTDEDRAEFGSRTKQLIAQYDEYVPRGLDDDAHVNGAFTVGENIGDLGGLSIALLAYRLSLGGKEAPVIDGLTGVQRVLFGWAQVWRTKSRAAEALRRLAVDPHSPPEFRCNGVIRNIDSFYEAFDVSENDALYLEPERRVRIWN
>NZ_CP019882.1|WP_078017386.1|255880_256471_+|hypothetical-protein
MPEVQRSQEGAHRGVFSGYGVASAVLGLVAVAALILGAMIWTSHRSATAERAYQTRVMAAAADWTGVLINMNVDNVDASLQKLHDGTVGELNSDFEGSIKPYREVVRTLQARTTGHIESVSFETSHRDPEPQNGQRPPAPAALPPELAQRTDTVLVIATSVSENSGNKPTTVRWNLRLGVSDVDGKLMISRLESMR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019882_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019882_2

471861-472118

Orphan

Consensus_repeat	Method
GGGCCGCCGCCAGGGCCG	CRT

5 spacers

The CRISPR arrays of NZ_CP019882_2

>merge|NZ_CP019882|2|471861-472118|CRT
GGGCCGCCGCCAGGGCCGCCGCCGGGGCCGCCGCCAGGGCCGCCGCCGGGGCCGCCGCCAGGGCCGCCGCCGGGGCCGCCGCCAGGGCCGCCGCCAGGGCCGCCGCCAGGGCCGCCGCCAGGGCCGCCGCCAGGGCCGCCGCCAGGGACGCCGCCAGGGCCGCCGCCAGGGCCGCCGCCGGGGCCGCCGCCAGGGCCGCCGCCAGGGACGCCGCCAGGGCCGCCGCCAGGGACGCCGCCAGGGCCGCCGTGGTCGCTG

>NZ_CP019882|2|2|471861-472118|CRT
GGGCCGCCGCCAGGGCCG	CCGCCGGGGCCGCCGCCAGGGCCGCCGCCGGGGCCGCCGCCAGGGCCGCCGCCG
GGGCCGCCGCCAGGGCCG	CCGCCAGGGCCGCCGCCA
GGGCCGCCGCCAGGGCCG	CCGCCAGGGCCGCCGCCAGGGACGCCGCCA
GGGCCGCCGCCAGGGCCG	CCGCCGGGGCCGCCGCCA
GGGCCGCCGCCAGGGACG	CCGCCAGGGCCGCCGCCAGGGACGCCGCCA
GGGCCGCCGTGGTCGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019882.1\|WP_078017499.1\|462943_463933_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224195
NZ_CP019882.1\|WP_078017507.1\|472884_473064_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017512.1\|474714_475155_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017506.1\|472549_472873_+\|DUF732-domain-containing-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017498.1\|462255_462978_+\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NZ_CP019882.1\|WP_078017510.1\|473895_474516_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017501.1\|467120_469319_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
NZ_CP019882.1\|WP_078017502.1\|469851_470025_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376540
NZ_CP019882.1\|WP_078017508.1\|473199_473454_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017503.1\|470791_471079_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078021727.1\|475911_477090_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236628
NZ_CP019882.1\|WP_078017500.1\|464075_465293_-\|DNA-polymerase-domain-containing-protein	unknown	unknown	gnl\|CDD\|240135
NZ_CP019882.1\|WP_078017497.1\|461377_462241_+\|type-VII-secretion-protein-EccE	unknown	unknown	gnl\|CDD\|274857
NZ_CP019882.1\|WP_078017495.1\|458616_460017_+\|type-VII-secretion-integral-membrane-protein-EccD	unknown	unknown	gnl\|CDD\|274855
NZ_CP019882.1\|WP_078017509.1\|473647_473899_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017511.1\|474512_474722_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017504.1\|471075_471408_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017513.1\|475087_476083_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378917
NZ_CP019882.1\|WP_078017505.1\|472220_472544_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078017496.1\|460013_461381_+\|type-VII-secretion-associated-serine-protease-mycosin	unknown	unknown	gnl\|CDD\|274856

Protein	Function_ID	Function_description	E-value
NZ_CP019882.1\|WP_078017499.1\|462943_463933_-\|hypothetical-protein	gnl\|CDD\|224195	COG1276, PcoD, Putative copper export protein [Inorganic ion transport and metabolism].	3.19025e-08
NZ_CP019882.1\|WP_078021727.1\|475911_477090_+\|hypothetical-protein	gnl\|CDD\|236628	PRK09846, recT, recombination protein RecT.	4.51963e-96
NZ_CP019882.1\|WP_078017495.1\|458616_460017_+\|type-VII-secretion-integral-membrane-protein-EccD	gnl\|CDD\|274855	TIGR03920, T7SS_EccD, type VII secretion integral membrane protein EccD. Members of this family are EccD, a component of actinobacterial type VII secretion systems (T7SS) with ten to eleven predicted transmembrane helix regions. [Protein fate, Protein and peptide secretion and trafficking].	5.54968e-64
NZ_CP019882.1\|WP_078017500.1\|464075_465293_-\|DNA-polymerase-domain-containing-protein	gnl\|CDD\|240135	cd04865, LigD_Pol_like_2, LigD_Pol_like_2: Polymerase (Pol) domain of bacterial LigD proteins similar to Pseudomonas aeruginosa (Pae) LigD, subgroup 2. The LigD Pol domain belongs to the archaeal/eukaryal primase (AEP) superfamily. In prokaryotes, LigD along with Ku is required for non-homologous end joining (NHEJ)-mediated repair of DNA double-strand breaks (DSB). NHEJ-mediated DNA DSB repair is error-prone. It has been suggested that LigD Pol contributes to NHEJ-mediated DNA DSB repair in vivo, by filling in short 5'-overhangs with ribonucleotides; the filled in termini would then be sealed by the associated LigD ligase domain, resulting in short stretches of RNA incorporated into the genomic DNA. The Pol domains of PaeLigD and Mycobacterium tuberculosis (Mt)LigD are stimulated by manganese, are error-prone, and prefer adding rNTPs to dNTPs in vitro; however PaeLigD and MtLigD belong to other subgroups, proteins in this subgroup await functional characterization.	2.23912e-113
NZ_CP019882.1\|WP_078017497.1\|461377_462241_+\|type-VII-secretion-protein-EccE	gnl\|CDD\|274857	TIGR03923, T7SS_EccE, type VII secretion protein EccE. This model represents the transmembrane protein EccB of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccE1, EccE2, etc. This model represents a conserved core region, and many members have 200 or more additional C-terminal residues. [Protein fate, Protein and peptide secretion and trafficking].	1.3831e-27
NZ_CP019882.1\|WP_078017498.1\|462255_462978_+\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	3.43079e-47
NZ_CP019882.1\|WP_078017501.1\|467120_469319_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	2.32781e-142
NZ_CP019882.1\|WP_078017513.1\|475087_476083_+\|hypothetical-protein	gnl\|CDD\|378917	pfam12684, DUF3799, PDDEXK-like domain of unknown function (DUF3799). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are typically between 265 and 420 amino acids in length. It appears that these proteins are distantly related to the PDDEXK superfamily and so these domains are likely to be nucleases. This family has a C-terminal cysteine cluster similar to that found in pfam01930.	1.31526e-19
NZ_CP019882.1\|WP_078017502.1\|469851_470025_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	1.22873e-06
NZ_CP019882.1\|WP_078017496.1\|460013_461381_+\|type-VII-secretion-associated-serine-protease-mycosin	gnl\|CDD\|274856	TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin. Members of this family are subtilisin-related serine proteases, found strictly in the Actinobacteria and associated with type VII secretion operons. The designation mycosin is used for members from Mycobacterium. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair].	7.61417e-91

>NZ_CP019882.1|WP_078017504.1|471075_471408_+|hypothetical-protein
MSAPVPPAVSRQVFADMARLVDQFVDGATDDHRQQLVQLSRLLHKSSDYAAALAGELAETSAEYARAWQELDHYAVAAQQAREERDRALARVTDLEDELAELNSTKAAED
>NZ_CP019882.1|WP_078017503.1|470791_471079_+|hypothetical-protein
MTTTDPLRDPAAAWDSPIAVVPECAPSAFFGALAAANTAIEIQARAVELMNAAAAQLETWRGRPAIPMVEAWRVDYLAQLITELRSTAEALAVPR
>NZ_CP019882.1|WP_078017502.1|469851_470025_+|XRE-family-transcriptional-regulator
MARSQRTQAVLAKAIDMKQQALSRRLSGQTSFTIDELGKIAVALDVPLAALVGEAVA
>NZ_CP019882.1|WP_078017501.1|467120_469319_-|acyl-CoA-dehydrogenase
MPIAITPEHNDLADSVRSLVARVAPSEVLHDALENPVPTPPPYWKAAAEQGLHGVHLAESVDGQGFGLLELAIVIAEFGYGAVPGPFVPSAIASALISAHDPGAALLSRLASGEVVATCALESGLTATRQDNVLVIRGEARSVLAGAEASILVLPVAIESGAEWVILDAAQLEIEPVKSVDLLRPVAHVRANGVEVTDDRVLSNLSQAAGRAILTTLLSAEAVGIARWSTDTAASYAKIREQFGRPIGQFQAIKHKCAEMIATTERATAAVWDAARALDEAAGKAWDDGETAYQFAAAVAASLAPSAAQHCAQDCIQVHGGIGFTWEHDTNVYYRRTLGLVAAFGRSSEYPQKVFDTATSTGMRAINIDLDPETEQLRAEIRAEVAALKAIPREDRKAAIAEAGWVQPHLPKPWGRAAKPIEQIIIAQEFTTGQVKRPQMGIAAWLIPSIVAFGTDEQKQRFLPPTFRGEMIWCQLFSEPGAGSDLASLTTKATKVDGGWRITGQKIWTTGAQYAQWGALLARTNPSAPKHAGITYFLLDMKAEGVEVKPLRELTGHAMFNTVFIDDVFVPDELVLGEVDRGWEVSRNTLTAERVSIGSSEPGFLANLDGFVDFVSGGHFDQVGHHRAGELIAEGHAAKLLNLRSTLLTLAGGDAMPSAAISKLLSMRTGQGYAEFAVSSFGIDGAIGDPSELQGKWAEYLLGSRSTTIYGGTSEVQLNIIAERLLGLPRDP
>NZ_CP019882.1|WP_078017500.1|464075_465293_-|DNA-polymerase-domain-containing-protein
MAGSPDGFLDVEGRHVTISHPDKVVFPAARGREPVTKMDLVTYYLAVADGALRAVADRPMILKRFVKGITEEAIFQKRAPEKRPEWIDVAELRYARGTSAKEAVIHEPAGLAWAVNLGCVDLNPHPVRSGDLDHPDELRIDLDPMPGVEWPQILEVAQVAREVLEDHGLTAWPKTSGSRGFHIYARIAPRWPFTQVRLAAETVAREVQRRAPELATSQWWKEERRGVFVDFNQNAKDRTVASAYSVRAVPDARVSTPLTWDEVPGCRADEFTIATVPARFAERGDPWAAMDDAAGSLEALLRLAEELGPAEKPPKGNKPLIEIARTKTRDEAMAALDTWRARHPEAAQVLHPTDILVDGMRGPSSIWYRIRINLEHVPADRRPPQEELIADYSPWEGYSGRQVRQ
>NZ_CP019882.1|WP_078017499.1|462943_463933_-|hypothetical-protein
MTEVTYYLSLALPLGIAMTVGHLATPEGRGGLVSREARRLALPVAAFVTAAAILRWFTSVSTGPARVQFAGFVLIVAGLVLMRRSASRRLAAGVAAVAVIVAVLPEVPLRWPTADTMARDVLTAVHILAALSWVGGLVSLAAVGLVWRQHRGDDRRDADAAATDWARTWERFSVVALVAVAALIVTGVWQAWVHVGTPGQLLTTPYGRYLAIKLVLVMALLAAGGYNTRVVLPEIRARQRSGDTRGVLRLAAQHFPLVVSAEAALGVGVLIVVPFLHGSARSQAGWPSAGPFDLSVFGTGAVLLALIVAAMWAGSRRPLRRSEPSTLAP
>NZ_CP019882.1|WP_078017498.1|462255_462978_+|siderophore-interacting-protein
MTENKPSRGWQGAVLKLFRAGDYQLTVTGREQISTHYLRVSFDAGGLLAGRCVHPTMWIRMWFPDGAKLHQRGYTLVNPDAAADAVDIEFALHDGIASRWAQTARPGDTISATVLGSSFALPRPAPAGYVIVGDTASLPAINSLLDSIDDSPATVFLSAAHDDDRTLPVARDTGVVWVDRGGSGEELVEVVRAAAHNAEDHFGWVASDNRTTRAVARVLRENYRIPRGAIKAQAYWAQSA
>NZ_CP019882.1|WP_078017497.1|461377_462241_+|type-VII-secretion-protein-EccE
MTGVPSPGTGRLAVVLSAIVAAVLAHPWRTETERWVLGVAAAVAVVSLVWWRGRYLTTIARQRVRIALGGTSIRQGEARTDATTTVLLRMSESDRQVPLRLLVGYLDRYGLVCDSVRLTTRTTAAGTTTWIGLTFDAARNLAALQARAQELPLQQTAAAAARRLVGELDEIGCTTTLVDDAPTAVADGARERWRAVSDSQGYVAVYGVGEATEEALAAVRASAPGESWTVLEIDGTPALPRLSAAAAIRTDAAPSAAVPVPGLVPVPGRQAAALSALHPRSGARLIA
>NZ_CP019882.1|WP_078017496.1|460013_461381_+|type-VII-secretion-associated-serine-protease-mycosin
MIRAAALIAVVLLAGAAPAGAVSPPAVDPAIPPPPGIAGPTTAMSQRAECVTTGIRPGSDPAGVSPNQVMLNLAGALSYSQGDGQTVAVIDTGVRPGPRLPNVIGGGDYLSGGDGLTDCDGHGTAVAGIIGGQPGADGFVGVAPGVRLLSIRQTSPRFAPNAGGKDPASVQAAVDIQTLARAIVRAADAGATVINISTVSCVAPDALGDQQALGAALRYAAVDKDVVIVAAAGNSGATTAGAPGSRCAANPLGDPRTAGDPRNWAGVTSVSVPSWWQPYVLSVGALTADGQPTGFTMPGPWVGIAAPGQDIVSLSNDADGGLADGVPDGRGAMAPMDGTSYAAAYVAGVAALVRSRYPALHADEVVHRLIATAHNGAQAPSNVVGAGALDPVGALTWTIDPAGDAAPLTKRVPAPAPPPAADHTTRTAAFTVTAGLAIAVVAAAVITRRRKEEPK
>NZ_CP019882.1|WP_078017495.1|458616_460017_+|type-VII-secretion-integral-membrane-protein-EccD
MTETPVLPIVRVAVLAHGRITDVALPTELPLREILPAVQRLVPPPEPDDADADHGPTPMTLAPIAGAPFSVEASLDTVGVVDGDLLTLQPIPLGPASPGVVEDVADAAVIFSAARKRPWGPQRLQLGARLAVILFALALSGTAAVHRLVSTSPVGLYAVGALALVTVLAGLLLRARSPRIATEISAAALVPIACAFWLAVPGAIGPEHVMLAAAGVAAWSVIVLIQSDDGVALFTAATVVAVTALLVAAASTLWQLPALTVGCAVLIVGLLVTVSTPQLAAAWARLPLPVIPAPGDPTPTAPSARVLADLPRRVRRGEGHQNGVIAGAVLISVVGSLFVAGRSEDPGPWGWYLVAATAAAAVLRARVWDTAACKAWLLAQPFGVSTGLLVLYAADHRFVPALWVLVVLGGLTAAWVVVAVNPETAVAERYSLPVRRLVGFVAAALDASLIPVAAYLVGLFTWILER
>NZ_CP019882.1|WP_078017505.1|472220_472544_+|hypothetical-protein
MREIHSPDSMGDVGELMRAIYATHPNLSVAIKLNRHSDSDYASVEVLGLPGHFADLDEERDGEYIWTSMTPGRYGIHLNGFRVDGDLAAMLATALAFITARSTAVAS
>NZ_CP019882.1|WP_078017506.1|472549_472873_+|DUF732-domain-containing-protein
MRARKVRRLAACALSGAVLAACGLAWAQESKADPVGEAAAAVCSSLDRDPTVANVSRMVTVLVEQGLTPSQAGLFIAGSISELCTRNAPVWEAFVDRYAVAVPKAVA
>NZ_CP019882.1|WP_078017507.1|472884_473064_-|hypothetical-protein
MSGTDHADTATRNPQQELHRHRRSCARTDASDADPVNNDAEPAAPNPSPAQRTDQHPRQ
>NZ_CP019882.1|WP_078017508.1|473199_473454_+|hypothetical-protein
MRAIDFSPDPNLDRVGRITSGLGERIREEDPREMFDELVSLCAWHPAKAAQIIMCFAVWFDPLEDTPTLVGRARAVSASRLAAS
>NZ_CP019882.1|WP_078017509.1|473647_473899_+|hypothetical-protein
MVFVALALFCASWWVLFLSFWAWLVLLVASMVGVVVAGYLDQDRSDCGYRDTPFGHGPHPSAAPVVELSERRAVWPNDAGSPE
>NZ_CP019882.1|WP_078017510.1|473895_474516_+|hypothetical-protein
MSVTSVQPTLREWLHGLVSRRPHQVIGGVDDPYLLRWHLIPRNPVLNIYLHKFLRSDDDRALHDHPWWFVSLILRGQYDEITDAGTKRRRAGSIAYRPATWRHRVALLWKSCASCEGTGIGYGQVPDSRWMETDCGACDGSGNGRTLPCWTIIVTGRRARTWGFWCRKVQPLNFINPDDDNYTATSVAERFIPWTEFGDAGCGEAQ
>NZ_CP019882.1|WP_078017511.1|474512_474722_+|hypothetical-protein
MSYDRRAELRETSEAAAERAAGDRVEYSSARRSSGGTCPPGRHRPVPTRNGGGVCACGFVVDRDEVADV
>NZ_CP019882.1|WP_078017512.1|474714_475155_+|hypothetical-protein
MSDRITDTIATALGRHSIERSLRIGGGERKEWWNCIECDWVSEIFEIGSVSGESLQRDHHAAVIVAALKAQRIAVVELPQDVIIPTGWGDDCLGAWPTTSETDPVSAWPGHQVVTPDDRWMPSRDARSLEAALLAAADAAEAVSGG
>NZ_CP019882.1|WP_078017513.1|475087_476083_+|hypothetical-protein
MRARWRQPYWLPLTLPRRCLVAEQRNDGRYNGIPDEQYHADRSSLSVSGAKLLLPPSCPAKFRHYMDNPKPTKKVWDFGHVAHRLILGKGVEIAVLDPAVHGLTKDGDAASNPAATTSWKQAAAEARERGATPIHIDEYRRAEAMANAVLNDPIAGPTFEQGEAEQSFYCMDAITGVQLRGRTDWWCGDNVDDVKTSVTANPAELDRAFWKLGYWMQAAWYRDLLIALGISENPRFRFVVVEKDPPHIVQVVEYDDDALAEGRRVNRQAIETFARCRDSGRWPAYADGVVTLSPPRWWRNADGLTAYEIDQAATQAEADALIAELEGIYTK
>NZ_CP019882.1|WP_078021727.1|475911_477090_+|hypothetical-protein
MPGFRTVAGLCRWGGDVESSAVVAQRRRPHRLRDRPGRYAGRSRCTDRRIGRDLHQVTSTEVVRQTPKQKTLAKLITDMTPELAKALPRHVTPERMARIAVTVVRATPKLAECDPASFLGALLTASQLGLEPGPTGEAYFVPYKTTCTFIPGYRGLIKLARQSGQVSDIYAELVYANDTYKVTLGLHRDIEHTVNDRNDRGEVTDVYAVAKFKDGTTTFVTMTRNEVEAIRKRSMAANNGPWVTDWNAMAKKTAVRQLSKWLPLSPEFNTATALDGSVRTDIGPLDAYQPEFVDGEVVADAQAIESPTESDSPVESSAGESVVADGGTGKPRMATKTQLAQLKNIREQEKYDTDDEWFGYMADVAGVGATRESEITFDDATRVIALFQGQES

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019882_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019882_3

1736672-1737691

Orphan

Consensus_repeat	Method
CGCCGTTGCCGCCGNNNC	CRT
CGAAAAGCCCGCCGTTGCCGCCGTTGCCGCCGTTGAAGCCCTTGCCACCGTT	PILER-CR

19 spacers

The CRISPR arrays of NZ_CP019882_3

>merge|NZ_CP019882|3|1736672-1737691|CRT,PILER-CR
CGCCGTTGCCGCCCTTGCCGCCGTTGATCGCGCTCGCGCCGCCGTCAGCTCCGTTGCCGCCCTTGCCGCTCGCACCCGTGGTCGGACTGCTTCCACCGGTGCCGCCGTTTCCGCCTGCTCCACCGCTGATGGCGCCGAAGCCACCGGTGCCGCCGGCACCGCCGGTGCCGCCGGTTGCACCCGCGGCGCCCTTGCCGCCGCTGCCGCCGGCCCCGCCGTTGTTGCCGCCGAAGGCACCGTGACCGCCGGTACCGCCAGCACCGCCGGTGGTGGCGCCGGTCCCGCCGTCACCACCGGCTGCACCTGCGCCGCCGTTGCCGGTCAACCCGCCGGCCCCGCCGCTGCCACCGTTACCGCCGTTGCCGCCCGCTCCGGTGCCGGAAGCGCCGCCGCTGCCGCCGGTGCCGCCCACTCCGCCGTTGCCCGCGATCGTGCCGCCGGTGCCGCCGTTGCCACCGGCACCGCCGTTGCCGCCGGTTGCGACGCCGGCTCCGCCGTTGCCACCGACCCCGCCGGCGCCGCCGGCCGCGCTGCCGTAGTACCCGCCGTTGCCGCCCGCACCGCCGTTGCCGCCGTCGGTTCCGGCCGCTCCGCCGCCGAATCCGTTGCCGCCGTTGCCGCCCGCGCCAGCGCTGCCGCCGCCGAGGATCGGCAGGCCGGCCGCGTTGCCGCCGTTGCCGCCGTTGCCGCCCGCGGTGCCCGCCGCCGTGCTGGCGCCGCCGTCACCGCCCTTGCCGCCGCTTCCGGCGAACAGCCCGGAGCTGCCGCCGTTGCCGCCGTTGCCGCCGTTGATTCCCTTGCCGCCGTTGCCGCCGCCGCCGCCGAACAGAGCGCCGGAGCTGGAGCTGCCGGCGAAAAGCCCGCCGTTGCCGCCGTTGCCGCCGTTGACGGTGGCATTCACGGCGTCGCCGCCGTTGCCGCCGTTGCCGAACAGCCCGGCGTTGCCGCCGTTGCCGCCGTTGTAGCCGTTGCCACCGTTACCGAACAGCAGACCGCCGGTGCCGCCGTTGCAGGCCGCAC

>NZ_CP019882|3|3|1736672-1737691|CRT
CGCCGTTGCCGCCCTTGC	CGCCGTTGATCGCGCTCGCGCCGCCGTCAG
CTCCGTTGCCGCCCTTGC	CGCTCGCACCCGTGGTCGGACTGCTTC
CACCGGTGCCGCCGTTTC	CGCCTGCTCCACCGCTGATGGCGCCGAAGC
CACCGGTGCCGCCGGCAC	CGCCGGTGCCGCCGGTTGCACCCGCGGCGCCCTTGC
CGCCGCTGCCGCCGGCCC	CGCCGTTGTTGCCGCCGAAGGCACCGTGACCGCCGGTACCGCCAGCACCGCCGGTGGTGG
CGCCGGTCCCGCCGTCAC	CACCGGCTGCACCTGCGCCGCCGTTGCCGGTCAACCCGCCGGCCC
CGCCGCTGCCACCGTTAC	CGCCGTTGCCGCCCGCTCCGGTGCCGGAAGCGC
CGCCGCTGCCGCCGGTGC	CGCCCACTCCGCCGTTGCCCGCGATCGTGCCGCCGGTGC
CGCCGTTGCCACCGGCAC	CGCCGTTGCCGCCGGTTGCGACGCCGGCTC
CGCCGTTGCCACCGACCC	CGCCGGCGCCGCCGGCCGCGCTGCCGTAGTACCCGCCGTTGCCGCCCGCAC
CGCCGTTGCCGCCGTCGG	TTCCGGCCGCTCCGCCGCCGA
ATCCGTTGCCGCCGTTGC	CGCCCGCGCCAGCGCTGCCGCCGCCGAGGATCGGCAGGCCGGCCGCGTTGC
CGCCGTTGCCGCCGTTGC	CGCCCGCGGTGCCCGCCGCCGTGCTGGCGC
CGCCGTCACCGCCCTTGC	CGCCGCTTCCGGCGAACAGCCCGGAGCTGC
CGCCGTTGCCGCCGTTGC	CGCCGTTGATTCCCTTGC
CGCCGTTGCCGCCGCCGC	CGCCGAACAGAGCGCCGGAGCTGGAGCTGCCGGCGAAAAGCC
CGCCGTTGCCGCCGTTGC	CGCCGTTGACGGTGGCATTCACGGCGTCGC
CGCCGTTGCCGCCGTTGC	CGAACAGCCCGGCGTTGC
CGCCGTTGCCGCCGTTGT	AGCCGTTGCCACCGTTACCGAACAGCAGACCGCCGGTGC
CGCCGTTGCAGGCCGCAC

>NZ_CP019882|3|1|1737436-1737650|PILER-CR
CCGCCGTTGCCGCCGTTGCCGCCGTTGATTCCCTTGCCGCCGTTGCCGCCGC	CGCCGCCGAACAGAGCGCCGGAGCTGGAGCTGCCGGCGAAAAGC
CCGCCGTTGCCGCCGTTGCCGCCGTTGACGGTGGCATTCACGGCGTCGCCGC	CGTTGCCGCCGTTGCCGAACAGCCCGGCGTTGCCGCCGT
TGCCGCCGTTGTAGCCGTTGCCACCGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019882.1\|WP_078021872.1\|1734815_1735514_-\|MspA-protein	unknown	unknown	gnl\|CDD\|370360
NZ_CP019882.1\|WP_078018479.1\|1739033_1739819_-\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|236210
NZ_CP019882.1\|WP_078018472.1\|1730412_1730958_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
NZ_CP019882.1\|WP_078018473.1\|1730954_1731521_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
NZ_CP019882.1\|WP_078018485.1\|1749717_1750464_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078018478.1\|1738753_1739047_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078018486.1\|1750639_1751047_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078018483.1\|1743519_1744665_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|238383
NZ_CP019882.1\|WP_078018474.1\|1731513_1732503_-\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|197225
NZ_CP019882.1\|WP_078018471.1\|1727936_1730306_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP019882.1\|WP_078018476.1\|1735895_1736471_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378826
NZ_CP019882.1\|WP_078021870.1\|1725997_1727863_-\|peptidase	unknown	unknown	gnl\|CDD\|273375
NZ_CP019882.1\|WP_078018482.1\|1742297_1743503_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NZ_CP019882.1\|WP_078021869.1\|1725155_1725857_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP019882.1\|WP_078018481.1\|1740130_1742080_-\|acetoacetate--CoA-ligase	unknown	unknown	gnl\|CDD\|235134
NZ_CP019882.1\|WP_078018477.1\|1738229_1738685_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078018480.1\|1739820_1740081_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078018484.1\|1745595_1749573_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078021871.1\|1732593_1733190_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019882.1\|WP_078018475.1\|1733916_1734603_-\|MspA-protein	unknown	unknown	gnl\|CDD\|370360

Protein	Function_ID	Function_description	E-value
NZ_CP019882.1\|WP_078021872.1\|1734815_1735514_-\|MspA-protein	gnl\|CDD\|370360	pfam09203, MspA, MspA. MspA is a membrane porin produced by Mycobacteria, allowing hydrophilic nutrients to enter the bacterium. The protein forms a tightly interconnected octamer with eightfold rotation symmetry that resembles a goblet and contains a central channel. Each subunit fold contains a beta-sandwich of Ig-like topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel.	3.14752e-55
NZ_CP019882.1\|WP_078018479.1\|1739033_1739819_-\|short-chain-dehydrogenase	gnl\|CDD\|236210	PRK08267, PRK08267, SDR family oxidoreductase.	1.66368e-123
NZ_CP019882.1\|WP_078018472.1\|1730412_1730958_-\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	2.20043e-22
NZ_CP019882.1\|WP_078018473.1\|1730954_1731521_-\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	1.68918e-24
NZ_CP019882.1\|WP_078018483.1\|1743519_1744665_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	9.03789e-174
NZ_CP019882.1\|WP_078018474.1\|1731513_1732503_-\|cardiolipin-synthase	gnl\|CDD\|197225	cd09127, PLDc_unchar1_1, Putative catalytic domain, repeat 1, of uncharacterized phospholipase D-like proteins. Putative catalytic domain, repeat 1, of uncharacterized phospholipase D (PLD, EC 3.1.4.4)-like proteins. PLD enzymes hydrolyze phospholipid phosphodiester bonds to yield phosphatidic acid and a free polar head group. They can also catalyze transphosphatidylation of phospholipids to acceptor alcohols. Members of this subfamily contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characterizes the PLD superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	8.91741e-45
NZ_CP019882.1\|WP_078018471.1\|1727936_1730306_-\|hypothetical-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	1.43069e-22
NZ_CP019882.1\|WP_078018476.1\|1735895_1736471_+\|hypothetical-protein	gnl\|CDD\|378826	pfam12200, DUF3597, Domain of unknown function (DUF3597). This family of proteins is found in bacteria, eukaryotes and viruses. Proteins in this family are typically between 126 and 281 amino acids in length. The function of this domain is unknown. The structure of this domain has been found to contain five helices with a long flexible loop between helices one and two.	0.00162831
NZ_CP019882.1\|WP_078021870.1\|1725997_1727863_-\|peptidase	gnl\|CDD\|273375	TIGR00976, Hypothetical_protein_Rv1835c/MT1883/Mb1866c., putative hydrolase, CocE/NonD family. This model represents a protein subfamily that includes the cocaine esterase CocE, several glutaryl-7-ACA acylases, and the putative diester hydrolase NonD of Streptomyces griseus (all hydrolases). This family shows extensive, low-level similarity to a family of xaa-pro dipeptidyl-peptidases, and local similarity by PSI-BLAST to many other hydrolases. [Unknown function, Enzymes of unknown specificity].	4.40969e-123
NZ_CP019882.1\|WP_078018482.1\|1742297_1743503_+\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	3.98955e-129
NZ_CP019882.1\|WP_078021869.1\|1725155_1725857_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	1.18791e-60
NZ_CP019882.1\|WP_078018481.1\|1740130_1742080_-\|acetoacetate--CoA-ligase	gnl\|CDD\|235134	PRK03584, PRK03584, acetoacetate--CoA ligase.	0
NZ_CP019882.1\|WP_078018475.1\|1733916_1734603_-\|MspA-protein	gnl\|CDD\|370360	pfam09203, MspA, MspA. MspA is a membrane porin produced by Mycobacteria, allowing hydrophilic nutrients to enter the bacterium. The protein forms a tightly interconnected octamer with eightfold rotation symmetry that resembles a goblet and contains a central channel. Each subunit fold contains a beta-sandwich of Ig-like topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel.	5.49432e-47

>NZ_CP019882.1|WP_078018476.1|1735895_1736471_+|hypothetical-protein
MRSSLWCGRALAAALLMSGSALFAIPTASADPDAQTVSPAPAPDPAPANVAAPEPVPLAAPDGPDIGAVTDACRQFGAALDFAATNYEDFAYNSAGSGNDVNYQDPNVASSNVIGRTALREAASAGMSAASTPGLPDDVAAPMRSWSLRAAKLLVLMGIRGGGDSLNATANDMNVDAKNAQMACAQNGGRA
>NZ_CP019882.1|WP_078021872.1|1734815_1735514_-|MspA-protein
MLKRFAALAGVCLLVQTGAAPLALADPPADPNVAPAANAVPAPDGPAGPVPSGAPGVLKTPDGWVLNVSGKDESIEPVASLTNSPWSREFLVDGTFNGAITGSGSTKLAGGSLEAGYQIGCGIIQDDLESITSGGITPGVGIPFVNGSLLPITLGLSLSEQIKIDLKPGTVNIVPVGKKSFKGTNPRVSITGFRVKIDGCAGQAFIRSYATLTSSTDNTDDVVTYLGVTKAV
>NZ_CP019882.1|WP_078018475.1|1733916_1734603_-|MspA-protein
MLHRFATAAAVCMLIPIGAAPLAAADPADPAAPAAADPGAPPPPPDNGAVASEVPGIAKTPDGRTLTVVAKDETQLPVAPLTTSLSSRDWLVGGTFTGSAPGSVQGGTLEAGYQIGCGVEMDKVKLNGSIGATLGNGSLTTAGVSLPGSISFPIQGQVEVEPRPGTITNVVVDKKSFKGNSARVTLKDIHIKVDNCVGASSLRSYAVLTSSGTDADDIVAYYGVTKVF
>NZ_CP019882.1|WP_078021871.1|1732593_1733190_-|hypothetical-protein
MGRGLATALGVSVLLVSTATAVPAAADPDPLVADPADPAAPATVGPPPGIGSALAQSGAPAAGPLGLPDLSSYAAGLLLAQNAVPSAPGGPAAVTAANLNAFDSQYLLPQNVAPAAPGEGVADVGLGPTTEDPSAGRLAFLRRVHEMYQAGALRGALLGQVDDHQLGQPLPGTAPGPDIHLPPGLGPAIADPAAAPTP
>NZ_CP019882.1|WP_078018474.1|1731513_1732503_-|cardiolipin-synthase
MPANAPYLIVEPDDGLDPVREFILSAQTSLLIKQFTFTEASLLEAAIDRKKAGVDVRVMLNPQRSGGDRANDESYEQLKAAGIDVQWSSPKFYVTHEKSIVVDERAAMVATFNLMIKYFTLTRDYGIITHDPLHVAQIIDVFNADWQHRDFTPPKYEGLLWSNSNSRYHMARFIDTAQRRLYIQHPKYVDAVILDHIAAAAHRGVKVKVLCGGKHGISEWDILDTFASLRTLSRFGVKVRKQKNLRVHAKLLIVDNTSALVGSMNIDRSAFDLRRELGITITEPDVVGRLRDVFKSDWDISHHYVPPDPLEQNRPVEDEFPHDDDLVHE
>NZ_CP019882.1|WP_078018473.1|1730954_1731521_-|chromate-transporter
MSESGPTLQKVSLLQIALTFNHIALASFGGGLSAWSREVIVVQKQWMGEEEFLSAMTMCRIVPGANQVNLAVFVGAKLKGIPGAIAALVGLCTVPVAIVLALAFVYFTFKEIPAVKGALHGASAAAVALTLTMVIQTGKKCLTGVVPVVFFGAAFVLNGVLRWPLLETLAILAPLSLLWAWPRKRAQA
>NZ_CP019882.1|WP_078018472.1|1730412_1730958_-|chromate-transporter
MKTYLALLSMFGSLSLLSIGGGNTVLPDMHLQAVTGHHWLTNSQFADIFSISQAAPGPSILIVALVGYAAGLGTAGVIGGIVGGVLATVAMIVPAATLMYLITVSWQKAEKSKLRLAVQKGFAPLTVGLIMASSLVMSRAADHDWRAYLITAVATVIFLRTNTNPLIVVGAAALLGYIGFV
>NZ_CP019882.1|WP_078018471.1|1727936_1730306_-|hypothetical-protein
MRVDRREIAVSGNVLQPLTRRTNDIVRLGLATVVLVVVVTSSLITRNDWVGLEKSVSRIVGVLTPTQSNLVYLAYGLAILALPFMILIGLIAARQWKLFAAYAAAGFLAVLSLSITGNGIAAPRWHFDLSERLSTTLSQFLDDPRWIAMLAAVLTVSGPWLPSRWRRWWWTLLLAFVPIHLVVSAVVPARSLLGLAVGWFVGALTVWVVGTPALEVPLDGAVRALSRRAFLVTALTVVRPAGQGPLELSATDDTGARVVVEMYGPNQRSGGALRQFWRWLILRDAETAPLQASMRRAVEHRALMTIAVGDLGVSNTTTMAVAALERGWTLYAHTAPVGTPIDGSADGLVTPVWGALGVLHRHQISHGDLRFKEMTVDAGKVLFGGFGNSEYGATDEQLQSDIAQLLVTTTHRFGAEAAVGAAVEALGKDTVLNASRRLTRAAVPARIRKTVDDPKAVMAAARDEVKRQTGAEEIKTETITRFTRKQVIQLVLLVALVYVAYPFISTVPTFFSELRNANWWWALLGLSVSALTYVGAAAALWACASGLVSFRNLVIMQFANTFAATTTPAGVGGLALSTRFLQKGGLGTLRATAAVALQQSVQVITHVALLIFFSVAAGASADLSHFVPNATLLYLIGGIALGALGTFLFVPKLRRWLGTAVRPRLKEVGGELLELMREPKRLALIVLGCAATTLGAALALWASVEAFGGGTTFVTVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLAAFGVPAAVGVPSVLLYRVLTCWLPVFAGWPIMRWLTAKEMI
>NZ_CP019882.1|WP_078021870.1|1725997_1727863_-|peptidase
MFILTMVLTGCAQPAQPGVSAQWPPAGDRGPCTVGKQTDVAARMRDGTVLRADVYRPATADPVPVILMRTQYGKSGAQVEPMRYQSPDWFASHCYLVVIQDVRGQGTSGGTFSEFTHDRDDGYDSVEWAAALPGSNGKVGMYGSSYVGATQWLAATTTPPHLVTIVPSNTASDYYDGWMYEGGEFRLAFVLPWAIGLATTAATNRHDGATATALTSAAADPTRWLNFRPYRALPVLQPGNPAVAPWYFDWLSHWTRDAFWRQWSIRDRYPAVRVPVLDVEGWYDAFLAGGIENFTGMVDSAGTPTARANQRLVIGPWDHLDWGRPGSTPTPLLKDIGPVGDSPINELMLAWYDHFLKGVDNGVSGAPRVDYFLMGANTWKSAPSWPLPQTRWSRYFLGGDGRLGSRTGTLSGTPPPIGQAPDRYSYDPTDPVPSLGGHSCCGARSGPQGPFDQSPAEQRSDVLVYSSDPLAADTEVTGPTTVDLWAASSAVDTDFTAKLAVVKPDGDVINLNNGILRTAFAESLSDPQPAPPNQPREYRIAIWPTSYLFKAGDRIRLEISSSDYPQFAPNPNTGAPFGSSAATVVADQTILHDAAHPSAVTIPVIPDSGPGSDHVPTRAQS
>NZ_CP019882.1|WP_078021869.1|1725155_1725857_-|SDR-family-NAD(P)-dependent-oxidoreductase
MARGLRDAGATVVIWGTNAAKNTSAVEELTSGGAGAPIGSFTVDVSDEDAVAAGMEATLARFGRVDSCFANAGVSPQPSAIDALSTEEWRRVLAVNLDGVFYTVRPVVAHMKSRGGGGSLVVTSSVSISDGMAFSTQYAAAKGALVAMARALAVELARDGIRVNALVPGWTEATMSDALLESPVAQAKILPRIPLRRWGNPHDFEAVAVWLAGAGSAYVTGQTLVIDGGYTVF
>NZ_CP019882.1|WP_078018477.1|1738229_1738685_-|hypothetical-protein
MPRWIAPTALLVSLIAAAAAGWALLKPSPPAAAPAPESQGVYTKATTCSAFQTVSTAVSLQTHGDPGADPAAIQGVAANARLAMSAGATYLLAHLDSATPADLAEAVRTFASGLQDISMYALAGVPNSDEQQSARLRDAEAANNRIAELCK
>NZ_CP019882.1|WP_078018478.1|1738753_1739047_+|hypothetical-protein
MTMVMQLGVRVARLTGVAALAWAVLGLAPAAAADSCPPGHVNNQYSGQCYLEGSAPTINGVPCVASNLGLCQSFRQNQQPPRKPYTSIGAAGWVSSG
>NZ_CP019882.1|WP_078018479.1|1739033_1739819_-|short-chain-dehydrogenase
MPTRTVFITGAAAGIGRATALAFARHGYRVGAYDIDLGGLGVLRDEITDHGGEIVIGRLDVTDADEWSQCLAEFTGESKQLDILVNNAGVLTTGAFADVPLATHRLMVDINFYGALAGLHAAFPYLRDTAGAQVVNMCSASAIYGQPELATYSATKFALRALTEALELEWRRHGIRVLAMWPLFVKTAMTDGVETGSTKSLGVNLKPEDVAAAVYSATHSGRSRLPKVHYPVGRQTRVFAAMSQVTPNWVQRLITKTVTRS
>NZ_CP019882.1|WP_078018480.1|1739820_1740081_-|hypothetical-protein
MIKLELPYITVMVDDRFRKRLAYAGERLRVTVTAYLRNAADDVDGMGRKATAACQTAAARVDTAMAAANTRIAAERDIAPPTLKVV
>NZ_CP019882.1|WP_078018481.1|1740130_1742080_-|acetoacetate--CoA-ligase
MPHADEPDEGADPQWRRFARTTAAQHGAPDGGYPELWRWSVDHPAQFWRAVWEYFDVRADVGPGPGDSAVLADASMPGAQWFPGVRLNYVEQILRHATRPGAAIVGVDEDGSRTEIGWAELEGRVGAVAAELRRLGVGPGDCVAGYLPDVAEAMVAFLATAAIGAVWSACGQDYAPQGAAARLAQLEPKALFSADGYRLGGRWIDKRADTQDLLALLPGSPHLLVLGGDDYRALVAEPVDLEVTAVAFDHPLWVLFSSGTTGKPKGIVHGHGGVVLEHLKAAALHADLGPGDVFFWQTALSWMMWNFRVAGLMCGATVVCYSGHPLYPDADRLWQLLQDEKVTYFGTSPGHLLASRKAGLHPGTDHDLHRLATIGSTGSPLPADLFDWVHDEVGTHVTVSSISGGTDVVTAFAGGTAGVPGVAGELSTRYLGVALHSWSPQREELIGEVGEMVITAPMPSMPVGFWNDEDGTRYRAAYFDHHWADGPAPQVWRHGDWVTVTDTGSLIIHGRSDATLNRHGIRMGSADIYEVVEGIDAVAEAFVLGIDGPDGAYWMPLFVTLAPGRSLDDELVATIRSAIRTKLSPRHVPDDVIEAPGIPHTRTGKKLEVPVTAIMAGHTEVSLDPRSIDNPDLIDWYREQGQAHRWADG
>NZ_CP019882.1|WP_078018482.1|1742297_1743503_+|CoA-transferase
MDSADRPAAPLAGVTVVALEQAVAAPMCTRVLADFGARVIKVENLAGGDFARHYDDVVNGLAAHFVWVNRNKQSVALDLKTAAGIDVLHRLLDGADALVSNLAPGSTARLGVSPEQLRERHPDVIAVEIDGYGAGGPLSHKRAYDLLAQSESGSCAVTGHPGMPAKPGPPIADISTGLYAALSIMALLRSREHGGGRGGAVNVSLFDTMMDLMGYPLTYTQHSGVDQQPLGMSSPAVAPYGAYDTADGQTVVLGTTNDREWQRLAREVIERPDLADDPRLAGNAARVAHRAELDEAIQSWCVRHDFEHIQKTADTAGIGNARYNLPSDVVNHPQLTARDRWRTVQTTNGPIRAILPPPIIDGYEQPMGAVPGLGEHTDAVLTELGLSGNDIGRLREQGVIA
>NZ_CP019882.1|WP_078018483.1|1743519_1744665_+|acetyl-CoA-C-acyltransferase
MREAVIVKAVRTPVGKRNGGLSGVHAADLSAAVLGALVDRTGLDPSTVDDVVWGCVSQGGDQSSNVGRFAVLAAGWPESVPATTVNRACGSSQQALDFAAQAVMSGQQQVVVAGGVEVMSRVPLGSARATGMPYGPRVLERYDNFSFNQGISAEMIARRWGLSRTQLDEYSARSHELAAAAQDRGAFVDQIVPVPVDGAMVTADEGIRRGTTADKLATLKPAFTEDGVIHAGNSSQISDGAAALLVTSADYAAAQGWTPIARYVAGAVAGADPVLMLTGPIPATRKALAKAGLAIGDIGVFEVNEAFAPVPLAWLSDTGADADRLNPLGGAIALGHPLGGSGAVLMTRMVHHMRENNLRYGLQTMCEGGGTANATIVELVG
>NZ_CP019882.1|WP_078018484.1|1745595_1749573_+|hypothetical-protein
MAVFGASAIALAPIQVTPPDIHIASNRALSALADVSLSSLSDVIQALNGAWSGLQGGLNAINGAADTAITQLGDALQAALISGISSGNTALQSIVDGLLASGSALAKAVDNALAQFPTPQAFISALVQAFGSIDINLGLALQAALNVSIDGAVALANALAAGGAALAAAFQAAVAAFPTPADFAAAISGALAAINPTLGVVANALTTFTGQLATTIQAGIAAGLTGFQALLNALSDGGSALSAAFQAALAAFPSPQAFINALVQAFSNIDVNLGLALQAAINVSIDGLQGFVDALVSGGATLAAAFNAALAAFPTPAAFVAALNGALAAINPTLGVVANALTTFTGQLGATIQAGIAAGLTGFQALLNALSDGGSALSAAFQAALAAFPNPQAFINALVQAFSNIDVNLGLALQAALNVGIDGLQGFVDALVSGGATLAAAFNAALAAFPTPAAFVAALNGALAAINPTLGVVANALTTFTGQLATTIQAGIAAGLTGFQALLNALSDGGSALSAAFQAALAAFPNPQAFINALVQAFSNIDVNLGLALQAALNVGIDGLQGFVDALVSGGATLAAAFNAALAAFPTPAAFVAALNGALAAINPTLGVLANALTTFTGQLGATIQAGIAAGLTGFQALLNALSDGGSALSAAFQAALAAFPSPQAFINALVQAFSNIDVNLGLALQAALNVGIDGLQGFVDALVSGGATLAAAFNAALAAFPTPAAFVAALNGALAAINPTLGVVANALTTFTGQLATTIQAGIAAGLTGFQALLNALSDGGSALSAAFQAALAAFPSPQAFINALVQAFSNIDVNLGLALQAALNVGIDGLQGFVDALVSGGATLAAAFNAALKAFPTPAAFVAALNAALAGINPTLGILTGALTTLTGQIGTTIQAGIAAGQTAFQALIAGLSNGASALSAAFQAALAAFPNPAAFINALVNALGNIDINLGLALQAALNVSVDGLQGFVDALASGGAALAAAFNAAVAAFPSPAQFVAAASAALNTVTGALGGGFQAALHAGQEVLQTGAAALTAGLNAGLAAGSALIGALNNGLIVGGAALDTAIKAALSALPSPEAVVNALATAGAHISAQLTALAQSLNASLQASFNFNFGGIHLGGGLDAGVGGAAATLAAAGAAVTSAVKGVNDTVTSIAGNAPTVSLKVKDTTAPTASAGKAATDTDTVSPSAANSGTKASVPSVSTPSLPKLPAPPKLPSLSLPKLPSLSLPSLPKPSTTPAKDATDTKDGTDTKDSSPAPSPAKDSTKDSTDAKPSTKSPSSDAKGDGSPKAPGASKKSSAGAGPSAKKSSGSDSKSAKSGKAA
>NZ_CP019882.1|WP_078018485.1|1749717_1750464_-|hypothetical-protein
MPPGKPESEAPDADDADDLVTADAAEAAAAAAEARAEAARARANELRRKLDAATPAPTDSDVADSDGPEDGAATADEVAAPKRRLRPPSLKAVAATVAVLAIAGLSGGTGYLVWQHRKAESERHHTAEYSAAARQGVVNLMSMDYTKAKESVQRIIDDSTGKFKSNMEDSADDLVKALQDSKMSTKVTVNDAAVESMDADTAVVLVAATSHREGPDAPKEDQQPRVWRVVITLEHDNGQIKVSDVEFV
>NZ_CP019882.1|WP_078018486.1|1750639_1751047_+|hypothetical-protein
MRSTVPVLAALLAAGVLTPASAAADPAAAPVNASECNDAFCTPGIAAGMELGAPCNDTGYYVFAVDTRNNWGRLLFCGSPRRYEPRYFRSPPMVGVKEFNSNCTGYENYVAQAPDGLFLTCAIQGNESIWVRGDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP019882_2	2.1\|471879\|54\|NZ_CP019882\|CRT	471879-471932	54	NZ_CP019882.1	471855-471908	0	1.0
NZ_CP019882_2	2.4\|472035\|18\|NZ_CP019882\|CRT	472035-472052	18	NZ_CP019882.1	471855-471872	0	1.0
NZ_CP019882_3	3.18\|1737599\|18\|NZ_CP019882\|CRT	1737599-1737616	18	NZ_CP019882.1	3060228-3060245	0	1.0
NZ_CP019882_2	2.2\|471951\|18\|NZ_CP019882\|CRT	471951-471968	18	NZ_CP019882.1	471855-471872	1	0.944
NZ_CP019882_3	3.18\|1737599\|18\|NZ_CP019882\|CRT	1737599-1737616	18	NZ_CP019882.1	3064894-3064911	1	0.944
NZ_CP019882_3	3.18\|1737599\|18\|NZ_CP019882\|CRT	1737599-1737616	18	NZ_CP019882.1	4277026-4277043	1	0.944
NZ_CP019882_1	1.7\|244821\|19\|NZ_CP019882\|CRT	244821-244839	19	NZ_CP019882.1	2036028-2036046	2	0.895
NZ_CP019882_1	1.7\|244821\|19\|NZ_CP019882\|CRT	244821-244839	19	NZ_CP019882.1	4109068-4109086	2	0.895
NZ_CP019882_1	1.7\|244821\|19\|NZ_CP019882\|CRT	244821-244839	19	NZ_CP019882.1	5215287-5215305	2	0.895

1. spacer 2.1|471879|54|NZ_CP019882|CRT matches to position: 471855-471908, mismatch: 0, identity: 1.0

ccgccggggccgccgccagggccgccgccggggccgccgccagggccgccgccg	CRISPR spacer
ccgccggggccgccgccagggccgccgccggggccgccgccagggccgccgccg	Protospacer
******************************************************

2. spacer 2.4|472035|18|NZ_CP019882|CRT matches to position: 471855-471872, mismatch: 0, identity: 1.0

ccgccggggccgccgcca	CRISPR spacer
ccgccggggccgccgcca	Protospacer
******************

3. spacer 3.18|1737599|18|NZ_CP019882|CRT matches to position: 3060228-3060245, mismatch: 0, identity: 1.0

cgaacagcccggcgttgc	CRISPR spacer
cgaacagcccggcgttgc	Protospacer
******************

4. spacer 2.2|471951|18|NZ_CP019882|CRT matches to position: 471855-471872, mismatch: 1, identity: 0.944

ccgccagggccgccgcca	CRISPR spacer
ccgccggggccgccgcca	Protospacer
*****.************

5. spacer 3.18|1737599|18|NZ_CP019882|CRT matches to position: 3064894-3064911, mismatch: 1, identity: 0.944

cgaacagcccggcgttgc	CRISPR spacer
cgaacagcccggcgctgc	Protospacer
**************.***

6. spacer 3.18|1737599|18|NZ_CP019882|CRT matches to position: 4277026-4277043, mismatch: 1, identity: 0.944

cgaacagcccggcgttgc	CRISPR spacer
cgaacagcccggcgctgc	Protospacer
**************.***

7. spacer 1.7|244821|19|NZ_CP019882|CRT matches to position: 2036028-2036046, mismatch: 2, identity: 0.895

cagcacgtcgggctacggc	CRISPR spacer
cagcacgtcgggccccggc	Protospacer
*************. ****

8. spacer 1.7|244821|19|NZ_CP019882|CRT matches to position: 4109068-4109086, mismatch: 2, identity: 0.895

cagcacgtcgggctacggc	CRISPR spacer
cagcaagtcgggccacggc	Protospacer
***** *******.*****

9. spacer 1.7|244821|19|NZ_CP019882|CRT matches to position: 5215287-5215305, mismatch: 2, identity: 0.895

cagcacgtcgggctacggc	CRISPR spacer
cagcacgccgggccacggc	Protospacer
*******.*****.*****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	111129-111149	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	62878-62898	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	582553-582573	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	212318-212338	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	248698-248718	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	680667-680687	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	MT024866	Mycobacterium phage Willsammy, complete genome	24887-24907	1	0.952
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NC_041888	Mycobacterium phage Tortellini, complete genome	25223-25243	1	0.952
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_010553	Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence	44123-44147	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KC821626	Cellulophaga phage phi39:1, complete genome	15279-15303	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP035518	Escherichia coli strain U14A plasmid pU14A_B, complete sequence	40796-40820	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP014199	Escherichia coli strain MRE600 plasmid pMRE600-1, complete sequence	42701-42725	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP012632	Escherichia coli strain SF-173 plasmid pSF-173-1, complete sequence	41317-41341	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP015160	Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence	133519-133543	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP013834	Escherichia coli strain JJ2434 plasmid pJJ2434_2, complete sequence	30798-30822	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP024150	Escherichia coli strain 14EC033 plasmid p14EC033c, complete sequence	97125-97149	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP027536	Escherichia coli strain AR_0081 plasmid unnamed3, complete sequence	35870-35894	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP035722	Escherichia coli strain U15A plasmid pU15A_B, complete sequence	10149-10173	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP014112	Escherichia coli strain FDAARGOS_144 plasmid unnamed2, complete sequence	11960-11984	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP024918	Klebsiella pneumoniae strain NH54 plasmid pKPNH54.2, complete sequence	24134-24158	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP035479	Escherichia coli strain U13A plasmid pU13A_B, complete sequence	15507-15531	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP024888	Escherichia coli strain AR_0019 plasmid tig00000138_pilon, complete sequence	48850-48874	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP031852	Klebsiella pneumoniae strain 121 plasmid pKP121-3, complete sequence	8784-8808	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP035470	Escherichia coli strain U12A plasmid pU12A_C, complete sequence	15507-15531	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP051696	Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence	8784-8808	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_AP018785	Escherichia coli strain SK1144 plasmid pSK1144	20163-20187	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP051737	Escherichia coli strain SCU-108 plasmid pSCU-108-2, complete sequence	13739-13763	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	CP054381	Escherichia coli strain SCU-175 plasmid pSCU-175-2, complete sequence	13739-13763	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP013419	Burkholderia sp. MSMB0266 plasmid pMSMB0266, complete sequence	7772-7796	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP032262	Escherichia coli strain AR_0067 plasmid unnamed4, complete sequence	59108-59132	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_LR740760	Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202	35223-35247	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP028322	Escherichia coli O18:H1 strain CFSAN067215 plasmid p0.1229_2, complete sequence	59228-59252	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP054356	Escherichia coli strain SCU-172 plasmid pSCU-172-3, complete sequence	17619-17643	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	CP027377	Escherichia coli strain 2013C-4404 plasmid unnamed1, complete sequence	45964-45988	2	0.92
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	CP052261	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-3, complete sequence	8785-8809	2	0.92
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	1210-1239	2	0.933
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	1210-1239	2	0.933
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NC_008383	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence	53525-53545	2	0.905
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	493307-493327	2	0.905
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP022670	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence	10492-10512	2	0.905
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP022670	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence	178532-178552	2	0.905
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	554074-554094	2	0.905
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	63639-63659	2	0.905
NZ_CP019882_3	3.11\|1737251\|21\|NZ_CP019882\|CRT	1737251-1737271	21	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	313038-313058	2	0.905
NZ_CP019882_1	1.1\|244491\|25\|NZ_CP019882\|CRT	244491-244515	25	MG009575	Mycobacterium phage Kumao, complete genome	24294-24318	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_048792	Serratia phage Moabite, complete genome	33890-33914	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP017750	Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence	137356-137380	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1688157-1688181	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP009572	Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence	93276-93300	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	MN234219	Mycobacterium phage Mercurio, complete genome	24405-24429	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KX808131	Mycobacterium phage SuperGrey, complete genome	25211-25235	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP049750	Rhodococcus fascians A21d2 plasmid unnamed1	1323-1347	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	193287-193311	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	258550-258574	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	740433-740457	3	0.88
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP011383	Calothrix sp. 336/3 plasmid unnamed1	92346-92370	3	0.88
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	455967-455996	3	0.9
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	661171-661195	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KY385384	Mycobacterium phage SimranZ1, complete genome	24651-24675	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP032328	Azospirillum brasilense strain MTCC4035 plasmid p7, complete sequence	6463-6487	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP032328	Azospirillum brasilense strain MTCC4035 plasmid p7, complete sequence	153787-153811	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	230965-230989	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	15889-15913	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	334994-335018	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP049837	Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence	76954-76978	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	740409-740433	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	LR134127	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7	145936-145960	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP021405	Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence	33569-33593	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	MG944221	Mycobacterium phage Scowl, complete genome	29170-29194	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	MF285618	Serratia phage 2050HW, complete genome	242521-242545	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	AP013980	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S31-C4, * SEQUENCING IN PROGRESS *	8394-8418	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KU594606	Cyanophage S-RIM32 isolate RW_108_0702, complete genome	35177-35201	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	MK524500	Mycobacterium phage Kevin1, complete genome	19527-19551	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP010024	Paraburkholderia fungorum strain ATCC BAA-463 plasmid pBIL, complete sequence	229934-229958	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_014841	Pantoea sp. At-9b plasmid pPAT9B04, complete sequence	238410-238434	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP018813	Paraburkholderia sp. SOS3 plasmid unnamed1, complete sequence	12209-12233	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	392869-392893	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_015704	Runella slithyformis DSM 19594 plasmid pRUNSL02, complete sequence	45230-45254	4	0.84
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_025425	Enterobacteria phage GEC-3S complete genome	46035-46059	4	0.84
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	3765-3792	4	0.857
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1834472-1834499	4	0.857
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	257357-257384	4	0.857
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	256572-256601	4	0.867
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	512559-512588	4	0.867
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP034347	Roseovarius sp. MME-070 plasmid pMME07001, complete sequence	27433-27462	4	0.867
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	256572-256601	4	0.867
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	512559-512588	4	0.867
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP034347	Roseovarius sp. MME-070 plasmid pMME07001, complete sequence	27433-27462	4	0.867
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP053710	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed2, complete sequence	347462-347491	4	0.867
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1949022-1949051	4	0.867
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1678284-1678313	4	0.867
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	73270-73299	4	0.867
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019344	Serratia marcescens plasmid R830b, complete sequence	11335-11364	4	0.867
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KM406489	Serratia marcescens strain R471 plasmid R471, complete sequence	31935-31964	4	0.867
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP016890	Pantoea agglomerans strain C410P1 plasmid unnamed1, complete sequence	443817-443841	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KY385384	Mycobacterium phage SimranZ1, complete genome	24339-24363	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1687612-1687636	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP010957	Sphingobium sp. YBL2 plasmid 3pYBL2-3, complete sequence	290004-290028	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP046723	Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence	208501-208525	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	976282-976306	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1290652-1290676	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	18724-18748	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1176565-1176589	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_031257	Mycobacterium phage Mulciber, complete genome	1214-1238	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	AP014328	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S35-C113, * SEQUENCING IN PROGRESS *	16874-16898	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	MF140410	Mycobacterium phage Et2Brutus, complete genome	1214-1238	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KX752698	Mycobacterium phage Tonenili, complete genome	9735-9759	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	156509-156533	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_019018	Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence	67078-67102	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_011355	Mycobacterium liflandii 128FXT plasmid pMUM002, complete sequence	13833-13857	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	522889-522913	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	731805-731829	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	686197-686221	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	955817-955841	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP031650	Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence	319817-319841	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	147602-147626	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NZ_AP017625	Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence	13835-13859	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	84879-84903	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	454716-454740	5	0.8
NZ_CP019882_1	1.4\|244674\|25\|NZ_CP019882\|CRT	244674-244698	25	KC736071	Mycobacterium phage WIVsmall, complete genome	29995-30019	5	0.8
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2704655-2704682	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1792579-1792606	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	617673-617700	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	MK524490	Mycobacterium phage Donny, complete genome	33879-33906	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	JN699007	Mycobacterium phage Acadian, complete genome	33874-33901	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	MT889381	Mycobacterium phage Suigeneris, complete genome	33879-33906	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	483486-483513	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NC_010627	Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence	258680-258707	5	0.821
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	338439-338466	5	0.821
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	KR011061	Skermania phage SPI1, complete genome	42240-42269	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	256584-256613	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	452887-452916	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	512547-512576	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_009958	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI04, complete sequence	51319-51348	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_041918	Geobacillus phage TP-84, complete genome	6036-6065	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	94311-94340	5	0.833
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	354904-354933	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	KR011061	Skermania phage SPI1, complete genome	42240-42269	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	256584-256613	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	452887-452916	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	512547-512576	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_009958	Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI04, complete sequence	51319-51348	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_041918	Geobacillus phage TP-84, complete genome	6036-6065	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	94311-94340	5	0.833
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	354904-354933	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	685590-685619	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	685598-685627	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	385191-385220	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	385187-385216	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	704741-704770	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	671459-671488	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1616301-1616330	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1487812-1487841	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1599189-1599218	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	10462-10491	5	0.833
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP016290	Rhizobium leguminosarum strain Vaf10 plasmid unnamed3, complete sequence	55368-55397	5	0.833
NZ_CP019882_3	3.2\|1736738\|27\|NZ_CP019882\|CRT	1736738-1736764	27	NC_009508	Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence	128060-128086	5	0.815
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MH727545	Mycobacterium phage DismalStressor, complete genome	42607-42636	5	0.833
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_026598	Mycobacterium phage Milly, complete genome	42580-42609	5	0.833
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	KX688047	Mycobacterium phage Marcoliusprime, complete genome	42607-42636	5	0.833
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MF140408	Mycobacterium phage DismalFunk, complete genome	42607-42636	5	0.833
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MF140411	Mycobacterium phage Findley, complete genome	42600-42629	5	0.833
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	159694-159723	5	0.833
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP007144	Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence	50184-50213	5	0.833
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	125493-125522	5	0.833
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	110949-110978	5	0.833
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	279394-279423	5	0.833
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	58076-58105	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KY215945	Klebsiella pneumoniae subsp. pneumoniae strain Kp1210 plasmid pOXA-519, complete sequence	59513-59542	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KY200950	Klebsiella pneumoniae subsp. pneumoniae strain Kp1219 plasmid pOXA-517, complete sequence	30026-30055	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KY781949	Klebsiella pneumoniae isolate Kp41 plasmid pKp41M, complete sequence	4327-4356	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KY213890	Klebsiella pneumoniae strain 38_wz plasmid pOXA48_wz, complete sequence	4849-4878	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT838202	Escherichia coli isolate WI2 isolate plasmid pWI2-OXA48, complete sequence	59223-59252	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LN864821	Raoultella planticola plasmid pRA35, complete sequence, strain RA35	62272-62301	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014072	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed1	48975-49004	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP050846	Klebsiella pneumoniae strain Bckp206 plasmid pBckp206-1, complete sequence	24780-24809	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX524525	Klebsiella pneumoniae strain RAY plasmid pRAY, complete sequence	20420-20449	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX523901	Klebsiella pneumoniae strain Kpn-30715/15 plasmid pOXA-48_30715, complete sequence	64326-64355	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX523900	Klebsiella pneumoniae strain Kpn-04963/15 plasmid pOXA-48_4963, complete sequence	62404-62433	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX523902	Klebsiella pneumoniae strain Kpn-30891/15 plasmid pOXA-48_30891, complete sequence	64897-64926	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX636096	Klebsiella pneumoniae strain RJ119 plasmid pRJ119-2, complete sequence	28236-28265	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KT935445	Klebsiella pneumoniae strain Kp6411 plasmid 6411TF, complete sequence	9270-9299	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX009507	Escherichia coli strain 06K2206 plasmid LM6771, complete sequence	38295-38324	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019368	Enterobacter cloacae plasmid pEl1573, complete sequence	84309-84338	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KM406491	Klebsiella pneumoniae strain Kpn-E1.Nr7 plasmid pKpn-E1.Nr7, complete sequence	36655-36684	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KP659188	Klebsiella pneumoniae strain 153877-1 plasmid pOXA-48E1, complete sequence	4929-4958	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KP025948	Proteus mirabilis strain Pm-Oxa48 plasmid pOXA48-Pm, complete sequence	4850-4879	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KP061858	Enterobacter cloacae strain INSRA17313-1 plasmid pUR17313-1, complete sequence	59717-59746	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KM877517	Enterobacter cloacae strain CRE623 plasmid pIMP-HB623, complete sequence	78467-78496	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KP294351	Escherichia coli strain CZD1527 plasmid pIGT15, complete sequence	4623-4652	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KU315015	Serratia marcescens strain NCTC 50331 plasmid R1215, complete sequence	4854-4883	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	AP018454	Klebsiella pneumoniae plasmid pMRY13-133KPN_2 DNA, complete genome, strain: MRY13-133	24559-24588	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	AP018455	Klebsiella aerogenes plasmid pMRY13-134EAE_1 DNA, complete genome, strain: MRY13-134	33577-33606	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034041	Klebsiella pneumoniae subsp. pneumoniae strain CRK0298 plasmid p2, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011599	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-83, complete sequence	63885-63914	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP044032	Klebsiella pneumoniae strain FDAARGOS_631 plasmid unnamed1, complete sequence	1932-1961	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP048353	Raoultella ornithinolytica strain 23 plasmid p23_D-OXA48, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034283	Klebsiella pneumoniae strain I72 plasmid p72_LM_OXA48, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP037737	Citrobacter freundii strain CAV1857 plasmid pKPC_CAV1857-85, complete sequence	19039-19068	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_004464	Citrobacter freundii plasmid pCTX-M3, complete sequence	86046-86075	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP023419	Klebsiella pneumoniae strain 1050 plasmid pKp1050-3, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042501	Enterobacter sp. E76 plasmid pE76_002, complete sequence	41254-41283	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP048339	Escherichia coli strain 142 plasmid p142_B, complete sequence	5325-5354	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MK249855	Enterobacter cloacae strain 105 plasmid unnamed, complete sequence	60716-60745	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MK249856	Klebsiella pneumoniae strain 91 plasmid unnamed, complete sequence	60716-60745	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MK249858	Escherichia coli strain 46 plasmid unnamed, complete sequence	60716-60745	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042509	Leclercia adecarboxylata strain E1 plasmid pE1_004, complete sequence	26723-26752	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_021488	Klebsiella pneumoniae plasmid pKPoxa-48N1, complete sequence	29467-29496	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_021502	Klebsiella pneumoniae plasmid pKPoxa-48N2, complete sequence	29467-29496	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026194	Enterobacteriaceae bacterium ENNIH1 plasmid pKPC-825d, complete sequence	28042-28071	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP027039	Klebsiella pneumoniae strain 16_GR_13 plasmid IncLM, complete sequence	36721-36750	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP020530	Enterobacter cloacae strain 174 plasmid unnamed2, complete sequence	29489-29518	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP020844	Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-3, complete sequence	2420-2449	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP020844	Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-3, complete sequence	64167-64196	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019154	Klebsiella pneumoniae plasmid pOXA-48, complete sequence	60716-60745	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP041085	Klebsiella pneumoniae strain Kp202 plasmid pKp202_3, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP023251	Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_2	37562-37591	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT994838	Klebsiella variicola isolate CNR130 plasmid CNR130, complete sequence	46583-46612	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MK966141	Enterobacter cloacae strain GHZ8R11B plasmid pHNGDR11, complete sequence	59622-59651	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MK966142	Klebsiella pneumoniae strain GHP8R3B plasmid pHNGDR03, complete sequence	58229-58258	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP024878	Klebsiella pneumoniae strain NH25 plasmid pNH25.4, complete sequence	18692-18721	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_005246	Erwinia amylovora LebB66 plasmid pEL60, complete sequence	56723-56752	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042514	Serratia marcescens strain E28 plasmid pE28_002, complete sequence	32444-32473	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029138	Klebsiella pneumoniae strain AR376 plasmid unnamed3, complete sequence	22295-22324	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP031805	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed5, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC508263	Klebsiella pneumoniae A1-3 plasmid pA1-3 DNA, complete sequence	82775-82804	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040036	Klebsiella pneumoniae strain KPC160117 plasmid pOXA48-L117, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022153	Citrobacter freundii strain 705SK3 plasmid p705SK3_2, complete sequence	4335-4364	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029599	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-77, complete sequence	47188-47217	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017288	Klebsiella variicola strain GJ3 plasmid pKPGJ-3d, complete sequence	42608-42637	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019063	Escherichia coli plasmid pNDM-HK, complete sequence	33305-33334	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022150	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_2, complete sequence	4335-4364	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MG516907	Klebsiella aerogenes plasmid pEa1631, complete sequence	82067-82096	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LR025105	Escherichia coli isolate EC-1639 plasmid pOXA-48_1639, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP009857	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-d0d, complete sequence	18260-18289	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042532	Klebsiella aerogenes strain C9 plasmid pC9_002, complete sequence	32444-32473	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026385	Serratia sp. SSNIH1 plasmid pKPC-56ce, complete sequence	76004-76033	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017282	Klebsiella variicola strain GJ1 plasmid pKPGJ-1c, complete sequence	38997-39026	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022826	Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-3, complete sequence	16325-16354	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_AP019667	Klebsiella pneumoniae strain TA6363 plasmid pTMTA63632, complete sequence	29490-29519	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT994833	Klebsiella pneumoniae isolate CNR341 plasmid CNR341, complete sequence	45521-45550	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP031235	Escherichia coli strain Es_ST410_NW1_NDM_09_2017 plasmid pEsST410_NW_NDM, complete sequence	58690-58719	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	KP294350	Uncultured bacterium plasmid pARM26, complete sequence	4623-4652	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011614	Klebsiella oxytoca strain CAV1335 plasmid pCAV1335-92, complete sequence	53439-53468	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017932	Klebsiella oxytoca strain CAV1015 plasmid pCAV1015-76, complete sequence	44222-44251	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MN792918	Klebsiella aerogenes strain ST143 plasmid pLAU_KAM9_OXA48, complete sequence	40316-40345	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017936	Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-76, complete sequence	59187-59216	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018974	Escherichia coli strain Ecol_545 plasmid pEC545_KPC, complete sequence	45059-45088	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040031	Klebsiella pneumoniae strain KPC160121 plasmid pOXA48-L121, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018461	Klebsiella pneumoniae strain Kp_Goe_39795 plasmid pKp_Goe_795-2, complete sequence	41937-41966	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011640	Serratia marcescens strain CAV1492 plasmid pCAV1492-73, complete sequence	28937-28966	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP032174	Klebsiella pneumoniae strain AR_0160 plasmid unnamed2, complete sequence	9975-10004	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LR025095	Klebsiella pneumoniae isolate KP9201 plasmid pOXA-48_920, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP045017	Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-2, complete sequence	4327-4356	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP053283	Escherichia coli strain SCU-308 plasmid pSCU-308-2, complete sequence	7768-7797	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC545849	Escherichia coli Ec-MW04 plasmid pEc-MW04_OXA DNA, complete sequence	9700-9729	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC545850	Klebsiella variicola Kv-MW05 plasmid pKv-MW05_OXA DNA, complete sequence	9702-9731	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011632	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-84, complete sequence	64869-64898	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042574	Enterobacter hormaechei strain E5 plasmid pE5_003, complete sequence	31117-31146	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042542	Enterobacter hormaechei strain C4 plasmid pC4_002, complete sequence	32444-32473	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014698	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS2, complete sequence	10484-10513	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011593	Klebsiella oxytoca strain CAV1099 plasmid pCAV1099-69, complete sequence	63673-63702	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011656	Citrobacter freundii strain CAV1741 plasmid pKPC_CAV1741, complete sequence	64360-64389	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014298	Klebsiella pneumoniae strain KP38731 plasmid unnamed2, complete sequence	66922-66951	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042580	Enterobacter kobei strain C16 plasmid pC16_002, complete sequence	26723-26752	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	KU159085	Klebsiella pneumoniae plasmid pOXAAPSS1, complete sequence	58162-58191	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP011609	Citrobacter freundii strain CAV1321 plasmid pCAV1321-71, complete sequence	29288-29317	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP032193	Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed2, complete sequence	19917-19946	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_023027	Klebsiella pneumoniae strain E71T plasmid, complete sequence	62873-62902	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026497	Klebsiella pneumoniae strain 616 plasmid pKp616_2, complete sequence	4327-4356	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026188	Enterobacteriaceae bacterium ENNIH2 plasmid pKPC-ddab, complete sequence	29709-29738	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP044337	Enterobacter hormaechei strain AKB48 plasmid unnamed2, complete sequence	61094-61123	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LN864819	Klebsiella pneumoniae plasmid pKP112, complete sequence, strain KP112	83090-83119	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LN864820	Citrobacter freundii plasmid pCF29, complete sequence, strain CF29	47989-48018	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP031216	Escherichia coli strain Es_ST80_L1_NDM_10_2017 plasmid pEsST80_L1_NDM, complete sequence	81756-81785	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LR025091	Klebsiella pneumoniae isolate KP980 plasmid pOXA-48_980, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP038457	Escherichia coli strain EC-129 plasmid pEC129_4, complete sequence	4324-4353	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_011641	Klebsiella pneumoniae plasmid pCTXM360, complete sequence	34997-35026	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042526	Citrobacter freundii strain E11 plasmid pE11_002, complete sequence	32444-32473	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	197956-197985	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019346	Enterobacter cloacae plasmid pNE1280, complete sequence	39618-39647	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP031322	Escherichia coli strain ST2350 isolate Es_ST2350_SE1_NDM_03_2018 plasmid pEsST2350_SE_NDM, complete sequence	27289-27318	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP052472	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-4, complete sequence	4324-4353	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018700	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-3, complete sequence	19552-19581	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LR745044	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pOXA48_Kpn154	60599-60628	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_021078	Klebsiella pneumoniae strain Kp002 plasmid pJEG011, complete sequence	70284-70313	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP027699	Klebsiella pneumoniae strain KP30835 plasmid unnamed4, complete sequence	16214-16243	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT985264	Escherichia coli strain 717 plasmid RCS51TR717_p, complete sequence	83794-83823	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT985279	Escherichia coli strain 676 plasmid RCS60_p, complete sequence	60033-60062	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC505604	Klebsiella pneumoniae A1-1 plasmid pKp1-1 genomic DNA, complete sequence	82775-82804	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC508722	Klebsiella pneumoniae A2-1 plasmid pA2-4 DNA, complete sequence	82775-82804	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019889	Klebsiella pneumoniae strain 601 plasmid pNDM-OM, complete sequence	69976-70005	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MT193824	Escherichia coli strain 19-AB01443 plasmid pOX-48-EC1443, complete sequence	36678-36707	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_MK088079	Klebsiella pneumoniae strain 19 plasmid unnamed, complete sequence	40553-40582	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_MK370728	Klebsiella pneumoniae strain 69G1 plasmid pLimOXA-48, complete sequence	4323-4352	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_MF156266	Escherichia coli strain 24-S11 plasmid pCESC2, complete sequence	13028-13057	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP030135	Klebsiella pneumoniae strain 160111 plasmid pOXA48_L111, complete sequence	36762-36791	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042568	Enterobacter hormaechei strain C44 plasmid pC44_002, complete sequence	32444-32473	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018736	Klebsiella pneumoniae strain Kp_Goe_121641 plasmid pKp_Goe_641-2	6800-6829	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KX783441	Klebsiella pneumoniae strain KP4368 plasmid pKP4368, complete sequence	57029-57058	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP015071	Escherichia coli strain Ecol_743 plasmid pEC743_OXA48, complete sequence	1124-1153	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KM406488	Salmonella enterica subsp. enterica serovar Paratyphi B strain R69 plasmid R69, complete sequence	63842-63871	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KM406490	Salmonella enterica subsp. enterica serovar Typhimurium strain 202 plasmid pSEM, complete sequence	1130-1159	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_KP975075	Citrobacter freundii strain MRSN12115 plasmid pMRVIM1012, complete sequence	70416-70445	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP048042	Serratia liquefaciens strain JL02 plasmid unnamed1, complete sequence	64750-64779	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018443	Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-2, complete sequence	30791-30820	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034202	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L_2, complete sequence	67265-67294	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP035217	Klebsiella michiganensis strain M82255 plasmid pKOCBH-C, complete sequence	26724-26753	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029447	Serratia marcescens strain CAV1761 plasmid pCAV1761-73, complete sequence	30156-30185	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018717	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-3, complete sequence	30241-30270	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018723	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-3, complete sequence	27347-27376	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018706	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-3, complete sequence	43926-43955	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018694	Klebsiella pneumoniae strain Kp_Goe_821588 plasmid pKp_Goe_588-2, complete sequence	8693-8722	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556214	Escherichia coli CEX24 plasmid pCEX24 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556215	Escherichia coli CEX25 plasmid pCEX25 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556216	Escherichia coli CEX14 plasmid pCEX14 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556217	Escherichia coli CEX3 plasmid pCEX3 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556218	Enterobacter cloacae CEX5 plasmid pCEX5 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556219	Enterobacter cloacae CEX6 plasmid pCEX6 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556220	Enterobacter cloacae CEX4 plasmid pCEX4 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556221	Klebsiella pneumoniae CEX18 plasmid pCEX18 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC556222	Klebsiella pneumoniae CEX23 plasmid pCEX23 DNA, complete sequence	63304-63333	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP031566	Enterobacter hormaechei strain 2013_1a plasmid pIncLM-1301491, complete sequence	34584-34613	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_024997	Klebsiella oxytoca plasmid pACM1, complete sequence	37280-37309	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_025134	Klebsiella pneumoniae plasmid pFOX-7a, complete sequence	88512-88541	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT985387	Escherichia coli strain 694 genome assembly, plasmid: RCS55_pI	2923-2952	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP019841	Enterobacter roggenkampii strain R11 plasmid pASM2, complete sequence	62847-62876	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP007733	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-068, complete sequence	48525-48554	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP010365	Enterobacter hormaechei subsp. oharae strain 34978 plasmid p34978-70.092kb, complete sequence	55802-55831	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017853	Klebsiella variicola strain GJ2 plasmid pKPGJ-2d, complete sequence	26840-26869	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP009852	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH4 plasmid pENT-e56, complete sequence	18723-18752	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026395	Klebsiella pneumoniae strain KPNIH48 plasmid pKPC-edb7, complete sequence	8742-8771	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018669	Klebsiella pneumoniae strain CAV1042 plasmid pKPC_CAV1042-89, complete sequence	36592-36621	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026142	Klebsiella pneumoniae strain F127 plasmid pF127_2, complete sequence	7743-7772	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LC536683	Klebsiella pneumoniae MyNCGM084 plasmid pMyNCGM084, complete sequence	16675-16704	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026210	Citrobacter sp. CFNIH10 plasmid pKPC-2fe2, complete sequence	32146-32175	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP016927	Klebsiella pneumoniae isolate 23 plasmid pIncL_M_DHQP1400954, complete sequence	59507-59536	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018315	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-3, complete sequence	49988-50017	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP027148	Klebsiella pneumoniae strain AR_0363 plasmid unnamed5	9023-9052	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP015075	Escherichia coli strain Ecol_745 plasmid pEC745_OXA48, complete sequence	25833-25862	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	KU159086	Klebsiella pneumoniae plasmid pOXAAPSS2, complete sequence	61031-61060	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018690	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-3, complete sequence	28833-28862	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP031374	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvOXA-48, complete sequence	16626-16655	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MN187903	Citrobacter freundii strain Cf164 plasmid pCf164_CTX-M-8, complete sequence	7867-7896	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP032170	Klebsiella pneumoniae strain AR_0076 plasmid unnamed3, complete sequence	3448-3477	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018342	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-5, complete sequence	43933-43962	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP020502	Serratia marcescens strain BWH-23 plasmid unnamed, complete sequence	45706-45735	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP033880	Escherichia coli strain 50579417 plasmid p50579417_3_OXA-48, complete sequence	41804-41833	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029720	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed2, complete sequence	6441-6470	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP042490	Enterobacter hormaechei strain C15 plasmid pC15_002	57169-57198	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT985241	Escherichia coli strain 721 plasmid RCS40_p, complete sequence	25361-25390	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018712	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-3, complete sequence	33459-33488	5	0.833
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP021742	Klebsiella pneumoniae strain AR_0126 plasmid tig00000002jNODE_23, complete sequence	71017-71046	5	0.833
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	558465-558492	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP020890	Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence	122824-122851	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP020883	Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence	3680-3707	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP020886	Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence	90910-90937	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NC_014811	Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence	182668-182695	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	MT657335	Gordonia phage Mariokart, complete genome	17672-17699	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	ASHF01000034	Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence	59529-59556	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	456627-456654	6	0.786
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	602959-602986	6	0.786
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	333719-333748	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	104312-104341	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	104312-104341	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	125752-125781	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	260258-260287	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	157784-157813	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	463586-463615	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	6991-7020	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	761215-761244	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	287397-287426	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	93338-93367	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1474382-1474411	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	251225-251254	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	543391-543420	6	0.8
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	MH834622	Arthrobacter phage Noely, complete genome	317-346	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	333719-333748	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP013529	Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence	104312-104341	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP013582	Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence	104312-104341	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	125752-125781	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	260258-260287	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	157784-157813	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	463586-463615	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	6991-7020	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	761215-761244	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	287397-287426	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	93338-93367	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1474382-1474411	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	251225-251254	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	543391-543420	6	0.8
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	MH834622	Arthrobacter phage Noely, complete genome	317-346	6	0.8
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_008760	Polaromonas naphthalenivorans CJ2 plasmid pPNAP04, complete sequence	47710-47739	6	0.8
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	84925-84954	6	0.8
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MN617843	Mycobacterium phage Quesadilla, complete genome	24858-24887	6	0.8
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	261872-261901	6	0.8
NZ_CP019882_3	3.2\|1736738\|27\|NZ_CP019882\|CRT	1736738-1736764	27	NZ_CP020926	Sphingobium yanoikuyae strain SHJ plasmid pSES220, complete sequence	84742-84768	6	0.778
NZ_CP019882_3	3.7\|1737026\|33\|NZ_CP019882\|CRT	1737026-1737058	33	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	29482-29514	6	0.818
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	658164-658193	6	0.8
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	659095-659124	6	0.8
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	185575-185604	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1124935-1124964	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	688192-688221	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	795016-795045	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	191343-191372	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP029358	Azospirillum sp. CFH 70021 plasmid unnamed3	4340-4369	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	684363-684392	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	190779-190808	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	257081-257110	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_013860	Azospirillum sp. B510 plasmid pAB510f, complete sequence	171425-171454	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	MH669013	Gordonia phage Skysand, complete genome	34404-34433	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	MF919542	Gordonia phage Patio, complete genome	34184-34213	6	0.8
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	537927-537956	6	0.8
NZ_CP019882_3	3.14\|1737407\|30\|NZ_CP019882\|CRT	1737407-1737436	30	NZ_CP048637	Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence	265155-265184	6	0.8
NZ_CP019882_3	3.14\|1737407\|30\|NZ_CP019882\|CRT	1737407-1737436	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5008977-5009006	6	0.8
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034325	Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-CTX-M-3, complete sequence	34391-34420	6	0.8
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LR134457	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 15, complete sequence	44529-44558	6	0.8
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	162750-162777	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NC_049470	Arthrobacter phage TripleJ, complete genome	17117-17144	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	172610-172637	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP054607	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed8, complete sequence	12994-13021	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	329259-329286	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010616	Phaeobacter inhibens strain P92 plasmid pP92_f, complete sequence	23232-23259	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010679	Phaeobacter gallaeciensis strain P75 plasmid pP75_f, complete sequence	23147-23174	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	126081-126108	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010790	Phaeobacter gallaeciensis strain P63 plasmid pP63_f, complete sequence	23133-23160	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010635	Phaeobacter inhibens strain P78 plasmid pP78_f, complete sequence	23232-23259	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP045408	Roseovarius sp. THAF9 plasmid pTHAF9_d, complete sequence	27334-27361	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010755	Phaeobacter inhibens strain P70 plasmid pP70_f, complete sequence	23232-23259	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP045378	Sulfitobacter sp. THAF37 plasmid pTHAF37_f, complete sequence	41735-41762	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010713	Phaeobacter inhibens strain P66 plasmid pP66_h, complete sequence	23231-23258	7	0.75
NZ_CP019882_1	1.6\|244773\|28\|NZ_CP019882\|CRT	244773-244800	28	NZ_CP010740	Phaeobacter inhibens strain P72 plasmid pP72_e, complete sequence	23246-23273	7	0.75
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	446530-446559	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	264851-264880	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	188223-188252	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	467083-467112	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1553994-1554023	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1350792-1350821	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	823393-823422	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	667477-667506	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1305099-1305128	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1254693-1254722	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	179905-179934	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	283880-283909	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	440086-440115	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1554129-1554158	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1305101-1305130	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1050241-1050270	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1636983-1637012	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1305106-1305135	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1157424-1157453	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1157413-1157442	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	364508-364537	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1553700-1553729	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	364495-364524	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1553644-1553673	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1232046-1232075	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1041255-1041284	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1619870-1619899	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1178547-1178576	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1561875-1561904	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	540740-540769	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	792667-792696	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1508494-1508523	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	507869-507898	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1272567-1272596	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1616738-1616767	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	194833-194862	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	194947-194976	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	80525-80554	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	80639-80668	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	80867-80896	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	210933-210962	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	750005-750034	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP011523	Streptomyces sp. CFMR 7 strain CFMR-7 plasmid unnamed, complete sequence	33220-33249	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	191337-191366	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	MH727552	Gordonia phage KidneyBean, complete genome	624-653	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP033873	Caulobacter sp. FWC26 plasmid p1, complete sequence	120084-120113	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	446530-446559	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	264851-264880	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	188223-188252	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	467083-467112	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1553994-1554023	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1350792-1350821	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	823393-823422	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	667477-667506	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1305099-1305128	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1254693-1254722	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	179905-179934	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	283880-283909	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	440086-440115	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1554129-1554158	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1305101-1305130	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1050241-1050270	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1636983-1637012	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1305106-1305135	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1157424-1157453	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1157413-1157442	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	364508-364537	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1553700-1553729	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	364495-364524	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1553644-1553673	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1232046-1232075	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1041255-1041284	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1619870-1619899	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1178547-1178576	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1561875-1561904	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	540740-540769	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	792667-792696	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1508494-1508523	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	507869-507898	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1272567-1272596	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1616738-1616767	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	194833-194862	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	194947-194976	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	80525-80554	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	80639-80668	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	80867-80896	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	210933-210962	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	750005-750034	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP011523	Streptomyces sp. CFMR 7 strain CFMR-7 plasmid unnamed, complete sequence	33220-33249	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	191337-191366	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	MH727552	Gordonia phage KidneyBean, complete genome	624-653	7	0.767
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP033873	Caulobacter sp. FWC26 plasmid p1, complete sequence	120084-120113	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1121868-1121897	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP015091	Pelagibaca abyssi strain JLT2014 plasmid pPABY1, complete sequence	168735-168764	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	148350-148379	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP015988	Sphingobium sp. EP60837 plasmid pEP1, complete sequence	6971-7000	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	554785-554814	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP015369	Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p2, complete sequence	43760-43789	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP044976	Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence	824-853	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1760670-1760699	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MH910038	Mycobacterium phage LeMond, complete genome	23731-23760	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	391674-391703	7	0.767
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	456764-456793	7	0.767
NZ_CP019882_3	3.3\|1736783\|30\|NZ_CP019882\|CRT	1736783-1736812	30	MG944216	Microbacterium phage Pajaza, complete genome	6006-6035	7	0.767
NZ_CP019882_3	3.3\|1736783\|30\|NZ_CP019882\|CRT	1736783-1736812	30	MG944226	Microbacterium phage Casey, complete genome	6006-6035	7	0.767
NZ_CP019882_3	3.3\|1736783\|30\|NZ_CP019882\|CRT	1736783-1736812	30	MG944218	Microbacterium phage Pikmin, complete genome	6006-6035	7	0.767
NZ_CP019882_3	3.7\|1737026\|33\|NZ_CP019882\|CRT	1737026-1737058	33	NC_019895	Singulisphaera acidiphila DSM 18658 plasmid pSINAC03, complete sequence	30595-30627	7	0.788
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1352262-1352300	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	894451-894489	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1278744-1278782	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	789520-789558	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1882320-1882358	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	539077-539115	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1354842-1354880	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1362126-1362164	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1109736-1109774	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1657481-1657519	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1278644-1278682	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1385033-1385071	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1765257-1765295	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1783761-1783799	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1362299-1362337	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1469452-1469490	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1071092-1071130	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1284817-1284855	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1321576-1321614	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1281554-1281592	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1472833-1472871	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	708017-708055	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1373762-1373800	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1472800-1472838	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1336710-1336748	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1373010-1373048	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1471606-1471644	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1362120-1362158	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1272168-1272206	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1336710-1336748	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1373010-1373048	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1471642-1471680	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1336710-1336748	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1272190-1272228	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1336714-1336752	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1373010-1373048	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1373010-1373048	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1373010-1373048	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1471642-1471680	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	682564-682602	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1471631-1471669	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1272190-1272228	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1279028-1279066	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1259689-1259727	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1312554-1312592	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1352693-1352731	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	812143-812181	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1471631-1471669	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1272190-1272228	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1336709-1336747	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1428254-1428292	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1472621-1472659	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1272190-1272228	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1272190-1272228	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1471642-1471680	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1373013-1373051	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	670786-670824	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1471653-1471691	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1471454-1471492	7	0.821
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	670786-670824	7	0.821
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	16382-16411	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_AP022602	Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399	89040-89069	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4256580-4256609	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	464967-464996	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_019789	Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence	465135-465164	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	2217994-2218023	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	249260-249289	7	0.767
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MT889372	Microbacterium phage Avocadoman, complete genome	16902-16931	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	596890-596919	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1216180-1216209	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1369456-1369485	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	474776-474805	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	818853-818882	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	818831-818860	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP037915	Sphingomonas sp. AAP5 plasmid p150, complete sequence	49173-49202	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	819006-819035	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1692692-1692721	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1385302-1385331	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	913232-913261	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	819085-819114	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1705693-1705722	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP014769	Hymenobacter sp. PAMC 26554 plasmid unnamed1, complete sequence	136589-136618	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_008010	Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence	430391-430420	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	63681-63710	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	987626-987655	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	644288-644317	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	70124-70153	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1705688-1705717	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	452120-452149	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	142175-142204	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1705686-1705715	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	517000-517029	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_011879	Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence	11087-11116	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	569715-569744	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP020332	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM259, complete sequence	231183-231212	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_022050	Paracoccus aminophilus JCM 7686 plasmid pAMI8, complete sequence	150938-150967	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	390245-390274	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP010860	Marinovum algicola DG 898 plasmid pMaD5, complete sequence	32415-32444	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	368028-368057	7	0.767
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1500004-1500033	7	0.767
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP015420	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence	91305-91334	7	0.767
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MN234187	Mycobacterium phage DyoEdafos, complete genome	22807-22836	7	0.767
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP036456	Streptomonospora sp. M2 plasmid phiM2, complete sequence	80214-80243	7	0.767
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_AP014801	Rhodovulum sulfidophilum plasmid Plasmid1 DNA, complete genome, strain: DSM 2351	102220-102249	7	0.767
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_028947	Mycobacterium phage Kratio, complete genome	12871-12900	7	0.767
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	154908-154937	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	MN304817	Phage 68_12, complete genome	25064-25093	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	JX676771	Pseudomonas phage AF, complete genome	33804-33833	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	208465-208494	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP024924	Sphingomonas sp. Cra20 plasmid unnamed, complete sequence	141181-141210	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	162286-162315	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP022193	Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence	109110-109139	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	162047-162076	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	MT952005	Aeromonas phage BUCT551, complete genome	38218-38247	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	KF692088	Arthrobacter phage vB_ArS-ArV2, complete genome	17860-17889	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	MG757153	Streptomyces phage BillNye, complete genome	102433-102462	8	0.733
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	MK620896	Streptomyces phage Circinus, complete genome	102240-102269	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	154908-154937	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	MN304817	Phage 68_12, complete genome	25064-25093	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	JX676771	Pseudomonas phage AF, complete genome	33804-33833	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	208465-208494	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP024924	Sphingomonas sp. Cra20 plasmid unnamed, complete sequence	141181-141210	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	162286-162315	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP022193	Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence	109110-109139	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	162047-162076	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	MT952005	Aeromonas phage BUCT551, complete genome	38218-38247	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	KF692088	Arthrobacter phage vB_ArS-ArV2, complete genome	17860-17889	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	MG757153	Streptomyces phage BillNye, complete genome	102433-102462	8	0.733
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	MK620896	Streptomyces phage Circinus, complete genome	102240-102269	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	AM261282	Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence	20417-20446	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP050076	Enterobacter kobei strain 070 plasmid p070_B, complete sequence	16475-16504	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP050069	Klebsiella aerogenes strain 035 plasmid p035_A-VIM-1, complete sequence	30097-30126	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	LC486677	Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence	16531-16560	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_KP873171	Pseudomonas aeruginosa PAO1 plasmid pAMBL2, complete sequence	276-305	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP041355	Pseudomonas aeruginosa strain AZPAE15042 plasmid pIHMA87, complete sequence	114467-114496	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_022242	Achromobacter xylosoxidans subsp. denitrificans pAX22 plasmid, complete sequence	4071-4100	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_010891	Pseudomonas sp. CT14 plasmid pCT14, complete sequence	3420-3449	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP039694	Agrobacterium larrymoorei strain CFBP5473 plasmid pTiCFBP5473, complete sequence	145511-145540	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_007100	Pseudomonas aeruginosa plasmid Rms149, complete sequence	39361-39390	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP023287	Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence	73868-73897	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP045203	Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence	160453-160482	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	LC155906	Achromobacter xylosoxidans plasmid pKUN4507_1 DNA, complete sequence, strain: KUN4507	19417-19446	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP032870	Pseudomonas syringae pv. actinidiae strain P220 plasmid pLKQG722, complete sequence	26449-26478	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP018860	Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence	44633-44662	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP018852	Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence	74358-74387	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	JQ432564	Uncultured bacterium plasmid pKS208, complete sequence	23771-23800	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP028340	Thauera aromatica K172 plasmid pKJK172, complete sequence	19638-19667	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	CP022269	Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plB, complete sequence	9661-9690	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	KX889311	Pseudomonas aeruginosa plasmid pJB12, complete sequence	4818-4847	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP015139	Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence	170713-170742	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_019906	Pseudomonas putida HB3267 plasmid pPC9, complete sequence	36616-36645	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	KC964605	Uncultured bacterium plasmid pMLUA1, complete sequence	20416-20445	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	KC964606	Uncultured bacterium plasmid pMLUA3, complete sequence	20416-20445	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	KC964607	Uncultured bacterium plasmid pMLUA4, complete sequence	20416-20445	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MN366356	Bacterium plasmid pALTS27, complete sequence	19102-19131	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MN366360	Bacterium plasmid pALTS32, complete sequence	19102-19131	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP032176	Klebsiella pneumoniae strain AR_0135 plasmid unnamed1, complete sequence	68505-68534	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP026703	Serratia marcescens strain AR_0027 plasmid unitig_1_pilon, complete sequence	7907-7936	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_LT985210	Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence	14709-14738	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MK047609	Pseudomonas aeruginosa strain 121156 plasmid pNECK1, complete sequence	18524-18553	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MK671725	Pseudomonas mosselii strain AM/94 plasmid pMOS94, complete sequence	49990-50019	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MK671726	Pseudomonas mendocina strain 57 plasmid pAER57, complete sequence	100800-100829	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP018734	Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.3, complete sequence	46196-46225	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MH061177	Pseudomonas fluorescens strain P69 plasmid pG69, complete sequence	82377-82406	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MK047610	Pseudomonas aeruginosa strain 163940 plasmid pTROUS1, complete sequence	10336-10365	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MG228427	Kluyvera cryocrescens strain BO64W plasmid pKC-BO-N1-VIM, complete sequence	131348-131377	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MF344579	Pseudomonas aeruginosa strain 60512 plasmid p60512-NR, complete sequence	5619-5648	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MF564290	Pseudomonas putida strain KSS435 plasmid pVIM_Pse-KSS435, complete sequence	27096-27125	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_AP013064	Serratia marcescens SM39 plasmid pSMC1, complete sequence	20661-20690	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MH910042	Mycobacterium phage Scarlett, complete genome	23733-23762	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_021780	Salmonella phage FSL SP-088, complete genome	1983-2012	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MH791396	UNVERIFIED: Salmonella phage SeZq-1, complete genome	24254-24283	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MH791395	UNVERIFIED: Salmonella phage SeWh-1, complete genome	1857-1886	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MH910039	Mycobacterium phage Oscar, complete genome	23732-23761	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MK376955	Mycobacterium phage KiSi, complete genome	23660-23689	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MN783744	Klebsiella oxytoca plasmid pFDL-VIM, complete sequence	19769-19798	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_KX009060	Pseudomonas syringae pv. actinidiae strain RT594 plasmid pUR_RT594, complete sequence	4491-4520	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_KP099552	Enterobacter cloacae strain A56 plasmid pA56, complete sequence	8230-8259	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP032632	Pseudomonas syringae pv. actinidiae str. Shaanxi_M228 plasmid pM228, complete sequence	19365-19394	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP015372	Pandoraea pnomenusa strain MCB032 plasmid unnamed 1, complete sequence	84169-84198	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP011973	Pseudomonas syringae pv. actinidiae ICMP 18884 plasmid unnamed, complete sequence	16840-16869	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	210133-210162	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_016053	Xanthomonas arboricola pv. pruni str. CFBP 5530 plasmid pXap41, complete sequence	22871-22900	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP018849	Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence	41274-41303	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP052872	Enterobacter cloacae strain 3849 plasmid p3846_IncN_VIM-1, complete sequence	59776-59805	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_021622	Klebsiella pneumoniae plasmid pK45-67VIM complete sequence	16160-16189	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_003921	Xanthomonas citri pv. citri str. 306 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP012180	Pseudomonas syringae pv. actinidiae ICMP 18708 plasmid unnamed, complete sequence	19257-19286	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP024031	Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC33, complete sequence	16296-16325	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP006855	Xanthomonas citri subsp. citri A306 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_014208	Klebsiella oxytoca KOX105 plasmid pKOX105, complete sequence	50106-50135	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP048041	Alcaligenes faecalis strain MUB14 plasmid pMUB-AF14-2, complete sequence	37788-37817	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP009011	Xanthomonas citri pv. citri strain JX4 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP008996	Xanthomonas citri pv. citri strain MN12 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP013665	Xanthomonas citri pv. citri strain jx-6 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP008999	Xanthomonas citri pv. citri strain MN11 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP024032	Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC33, complete sequence	16296-16325	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	CP030168	Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed2, complete sequence	9500-9529	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP019733	Pseudomonas syringae pv. actinidiae strain CRAFRU 14.08 plasmid unnamed, complete sequence	7446-7475	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MN783743	Escherichia coli plasmid pGA_VIM, complete sequence	9231-9260	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	MN783743	Escherichia coli plasmid pGA_VIM, complete sequence	174192-174221	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_020452	Pseudomonas aeruginosa strain COL-1 plasmid pNOR-2000, complete sequence	18910-18939	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP009026	Xanthomonas citri pv. citri strain 5208 plasmid pXAC33, complete sequence	2272-2301	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP009014	Xanthomonas citri pv. citri strain GD3 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_020801	Xanthomonas axonopodis Xac29-1 plasmid pXAC33, complete sequence	16295-16324	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP017010	Pseudomonas syringae pv. actinidiae strain NZ-47 plasmid pPsa22180a, complete sequence	16840-16869	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP017008	Pseudomonas syringae pv. actinidiae strain ICMP 20586 plasmid pPsa20586, complete sequence	16840-16869	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP008993	Xanthomonas citri pv. citri strain NT17 plasmid pXAC33, complete sequence	2274-2303	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP009008	Xanthomonas citri pv. citri strain JX5 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP009002	Xanthomonas citri pv. citri strain MN10 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	JQ004406	Uncultured bacterium plasmid pHH128, complete sequence	54736-54765	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	JQ004407	Uncultured bacterium plasmid pHH3408, complete sequence	49600-49629	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	JQ004408	Uncultured bacterium plasmid pHH3414, complete sequence	53794-53823	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	JQ004409	Uncultured bacterium plasmid pKS77, complete sequence	51789-51818	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP008987	Xanthomonas citri pv. citri strain UI7 plasmid pXAC33, complete sequence	4335-4364	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP009005	Xanthomonas citri pv. citri strain MF20 plasmid pXAC33, complete sequence	431-460	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MH220284	Aeromonas sp. pRIVM0001_VIM-1 plasmid pRIVM0001_VIM-1_171012_B12, complete sequence	114861-114890	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MN366361	Bacterium plasmid pALTS33, complete sequence	27403-27432	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_LT963392	Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence	54745-54774	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_CP019731	Pseudomonas syringae pv. actinidiae strain CRAFRU 12.29 plasmid unnamed, complete sequence	7458-7487	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_021087	Enterobacter cloacae strain M15 plasmid, complete sequence	12577-12606	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MF141039	Pseudomonas aeruginosa strain PAcoop101 plasmid pCOOP-101, complete sequence	21662-21691	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NZ_MF344578	Pseudomonas aeruginosa strain 60512 plasmid p60512-IMP, complete sequence	21223-21252	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	LR026998	unidentified phage genome assembly, chromosome: 1	56867-56896	8	0.733
NZ_CP019882_3	3.1\|1736690\|30\|NZ_CP019882\|CRT	1736690-1736719	30	NC_048666	Salmonella phage YSD1 strain YSD1_PHAGE genome assembly	56867-56896	8	0.733
NZ_CP019882_3	3.3\|1736783\|30\|NZ_CP019882\|CRT	1736783-1736812	30	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	493847-493876	8	0.733
NZ_CP019882_3	3.7\|1737026\|33\|NZ_CP019882\|CRT	1737026-1737058	33	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	312409-312441	8	0.758
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1308938-1308976	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1045377-1045415	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1365018-1365056	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1230673-1230711	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1589688-1589726	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1045481-1045519	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1533665-1533703	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1294023-1294061	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1229770-1229808	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1272348-1272386	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1272339-1272377	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1230665-1230703	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1230020-1230058	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1230656-1230694	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1248694-1248732	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1309076-1309114	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1309059-1309097	8	0.795
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1309047-1309085	8	0.795
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP045329	Labrenzia sp. THAF191b plasmid pTHAF191b_a, complete sequence	301541-301570	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP045345	Labrenzia sp. THAF187b plasmid pTHAF187b_a, complete sequence	104051-104080	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP045335	Labrenzia sp. THAF191a plasmid pTHAF191a_b, complete sequence	53721-53750	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP019631	Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence	124390-124419	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP042825	Rhizobium sp. WL3 plasmid unnamed2, complete sequence	660814-660843	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	141731-141760	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP028965	Burkholderia sp. IDO3 plasmid p1, complete sequence	286908-286937	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1727454-1727483	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP039641	Azospirillum sp. TSH100 plasmid p2, complete sequence	39758-39787	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MT684597	Mycobacterium phage Mandlovu, complete genome	25047-25076	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MT684593	Mycobacterium phage Moonbeam, complete genome	25499-25528	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MF668270	Mycobacterium phage Emma, complete genome	25058-25087	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MN586004	Mycobacterium phage Strokeseat, complete genome	25104-25133	8	0.733
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MT684601	Mycobacterium phage Hlubikazi, complete genome	25104-25133	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032326	Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence	263282-263311	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1074040-1074069	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	675770-675799	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	333026-333055	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	46086-46115	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	379527-379556	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	613398-613427	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	MH834619	Arthrobacter phage Maureen, complete genome	37178-37207	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	MN234196	Gordonia phage CloverMinnie, complete genome	15008-15037	8	0.733
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NC_048115	Arthrobacter phage Liebe, complete genome	37179-37208	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP015233	Epibacterium mobile F1926 plasmid unnamed3, complete sequence	92907-92936	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP046282	Salmonella enterica strain FDAARGOS_687 plasmid unnamed1, complete sequence	38767-38796	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP035302	Salmonella enterica subsp. enterica strain ST1539 plasmid pST1539, complete sequence	50581-50610	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022965	Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal2, complete sequence	56929-56958	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040569	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-8290 plasmid pCFSAN059542, complete sequence	16881-16910	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_007208	Salmonella enterica OU7025 plasmid pOU1113, complete sequence	49057-49086	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_HG970001	Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 plasmid pSG, complete sequence	67495-67524	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP037876	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S3, complete sequence	23709-23738	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP020923	Salmonella enterica subsp. enterica strain 16A242 plasmid unnamed1, complete sequence	42413-42442	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039577	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence	35914-35943	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034480	Salmonella enterica subsp. enterica serovar Typhimurium strain 14028 plasmid unnamed, complete sequence	40096-40125	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP030198	Salmonella enterica strain SA20051401 plasmid pSA20051401.2, complete sequence	100109-100138	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP050746	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-1, complete sequence	52017-52046	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP053871	Salmonella enterica subsp. enterica serovar Typhimurium strain SS2017 plasmid pSS2017-1, complete sequence	23821-23850	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP053866	Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-1, complete sequence	22483-22512	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP041006	Salmonella enterica strain FDAARGOS_768 plasmid unnamed1, complete sequence	35582-35611	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022137	Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed2, complete sequence	46377-46406	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029594	Salmonella enterica strain DA34827 plasmid pDA34827-94, complete sequence	4354-4383	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP051287	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Gull_ST-29 plasmid pST29-94038, complete sequence	33423-33452	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034720	Salmonella enterica subsp. enterica serovar Typhimurium strain RSE04 plasmid pRSE04, complete sequence	40168-40197	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029596	Salmonella enterica strain DA34833 plasmid pDA34833-94, complete sequence	31229-31258	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP051277	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Sparrow_ST-87 plasmid pST87-92921, complete sequence	56783-56812	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LS997974	Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pSLT-BT	40072-40101	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP044959	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.2, complete sequence	40096-40125	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029838	Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093B, complete sequence	486-515	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019108	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence	25272-25301	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019109	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence	25272-25301	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019112	Salmonella enterica subsp. enterica serovar Pullorum plasmid pSPUV, complete sequence	48171-48200	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018634	Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence	86658-86687	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022071	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed1, complete sequence	4294-4323	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP012348	Salmonella enterica subsp. enterica serovar Pullorum str. ATCC 9120 plasmid pCFSAN000725_01, complete sequence	70380-70409	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP029841	Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence	40096-40125	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP027413	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed2, complete sequence	35865-35894	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP027409	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence	33906-33935	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP018658	Salmonella enterica subsp. enterica serovar Enteritidis strain 92-0392 plasmid pSE92-0392, complete sequence	49138-49167	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP028200	Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN018746 plasmid pGMI14-001, complete sequence	86123-86152	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_021155	Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-1, complete sequence	65771-65800	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP028319	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067216 plasmid pSC-09-1, complete sequence	51065-51094	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP045950	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_01, complete sequence	40108-40137	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017620	Salmonella enterica subsp. enterica serovar Typhimurium strain 22792 plasmid unnamed1, complete sequence	77687-77716	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	27554-27583	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017618	Salmonella enterica subsp. enterica serovar Typhimurium strain 22495 plasmid unnamed1, complete sequence	70006-70035	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014980	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC H2662 plasmid pSTY1-H2662, complete sequence	71442-71471	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014970	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1808 isolate ST1126-1 plasmid pSTY1-1808, complete sequence	71404-71433	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014968	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-1702 plasmid pSTY1-2011K-1702, complete sequence	71406-71435	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP037873	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS014854 plasmid pPNCS014854_S1, complete sequence	65709-65738	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040669	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20082869 plasmid pSA20082869.1, complete sequence	2754-2783	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014973	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY2-1898, complete sequence	71341-71370	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP038435	Salmonella enterica subsp. enterica serovar Typhimurium strain E40V plasmid unnamed, complete sequence	65697-65726	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014976	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2009K-1640 plasmid pSTY1-2009K-1640, complete sequence	71418-71447	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_017054	Salmonella enterica subsp. enterica serovar Typhimurium str. 798 plasmid p798_93, complete sequence	71266-71295	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP047324	Salmonella enterica subsp. enterica serovar Typhimurium strain RM13672 plasmid pRM13672, complete sequence	71320-71349	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014537	Salmonella enterica subsp. enterica serovar Typhimurium strain SO3 isolate SOHS 02-68 plasmid pSO3_STV, complete sequence	71332-71361	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_022570	Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 unnamed plasmid, complete sequence	71423-71452	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039560	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.2, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039586	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014859 plasmid p11-0225.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LN999012	Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 plasmid pSLT, complete sequence	71332-71361	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP038433	Salmonella enterica subsp. enterica serovar Typhimurium strain E40 plasmid unnamed, complete sequence	65697-65726	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP016390	Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pSLT931, complete sequence	71343-71372	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP025556	Salmonella enterica subsp. enterica serovar Typhimurium strain PIR00538 plasmid pPIR00538, complete sequence	18708-18737	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039855	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014864 plasmid p11-0972.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP022118	Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 plasmid unnamed1, complete sequence	396442-396471	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP034231	Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 plasmid pATCC14028, complete sequence	20401-20430	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_014476	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence	87225-87254	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP017729	Salmonella enterica subsp. enterica serovar Typhimurium str. SARA13 plasmid pSARA13, complete sequence	56546-56575	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP008745	Salmonella enterica subsp. enterica serovar Typhimurium strain VNP20009 plasmid pSLT_VNP20009, complete sequence	71321-71350	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP007582	Salmonella enterica subsp. enterica serovar Typhimurium strain 138736 plasmid, complete sequence	69129-69158	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039566	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014849 plasmid p08-7727.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP030176	Salmonella enterica subsp. enterica serovar Milwaukee str. SA19950795 plasmid pIncFII.1, complete sequence	123573-123602	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_013437	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence	91131-91160	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_019001	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence	107397-107426	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP051281	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-99574.1A, complete sequence	83868-83897	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_AP014566	Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence	107166-107195	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	LN794247	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSBLT, complete sequence	105986-106015	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP041974	Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence	33708-33737	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039580	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014857 plasmid p10-3881.1, complete sequence	118381-118410	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039583	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014858 plasmid p10-8609.1, complete sequence	7447-7476	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP044969	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS007087.2, complete sequence	5834-5863	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039596	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014865 plasmid p12-4331.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039592	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014862 plasmid p11-0500.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP039568	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014850 plasmid p08-8136.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP014577	Salmonella enterica subsp. enterica serovar Typhimurium strain RM9437 plasmid pRM9437, complete sequence	71339-71368	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP013721	Salmonella enterica subsp. enterica serovar Typhimurium strain RM10607 plasmid pRM10607, complete sequence	71332-71361	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_016864	Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 plasmid pSTUK-100, complete sequence	53131-53160	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP020113	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence	117230-117259	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014962	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 plasmid pSTY1-1899, complete sequence	71339-71368	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	CP053407	Salmonella enterica strain 87-0091 plasmid unnamed, complete sequence	40870-40899	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_016861	Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_L, complete sequence	83926-83955	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP021464	Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_2, complete sequence	103995-104024	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014050	Salmonella enterica strain FDAARGOS_94 plasmid unnamed, complete sequence	13818-13847	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP038848	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014851 plasmid p09-0499.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP050736	Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-2, complete sequence	42553-42582	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040565	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-7699 plasmid pCFSAN059544, complete sequence	20248-20277	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_003277	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 plasmid pSLT, complete sequence	71340-71369	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP051268	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Hawk_ST-33 plasmid pST33-93798, complete sequence	50975-51004	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NC_016855	Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S plasmid unnamed, complete sequence	71320-71349	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_LT855377	Salmonella enterica subsp. enterica serovar Typhimurium isolate STMU2UK plasmid 2	71350-71379	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014359	Salmonella enterica subsp. enterica serovar Typhimurium strain YU15 plasmid pYU15_94, complete sequence	71429-71458	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP015158	Salmonella enterica subsp. enterica serovar Typhimurium strain NC983 plasmid unnamed, complete sequence	71317-71346	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP014357	Salmonella enterica subsp. enterica serovar Typhimurium strain SO2 isolate SOHS 02-20 plasmid pSO2_STV, complete sequence	71325-71354	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP012698	Microbacterium sp. No. 7 plasmid A, complete sequence	120859-120888	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP023469	Salmonella enterica subsp. enterica strain BAA-1586 plasmid pSalMiami, complete sequence	72218-72247	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP050741	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-2, complete sequence	27867-27896	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040901	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP18-6199 plasmid pCFSAN074387, complete sequence	65718-65747	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP040322	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014879 plasmid p16-6397.1, complete sequence	7448-7477	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP015599	Salmonella enterica strain FORC_030 plasmid pFORC_030, complete sequence	66462-66491	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP026701	Salmonella enterica subsp. enterica serovar Typhimurium strain AR_0031 plasmid unitig_1_pilon, complete sequence	31434-31463	8	0.733
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	KX777254	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTV-Mu1, complete sequence	69387-69416	8	0.733
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	MT522006	Gordonia phage BBQValindra, complete genome	30338-30371	9	0.735
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	12974-13007	9	0.735
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	146659-146688	9	0.7
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	321662-321691	9	0.7
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	644009-644038	9	0.7
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	146659-146688	9	0.7
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP015882	Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence	321662-321691	9	0.7
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	644009-644038	9	0.7
NZ_CP019882_3	3.7\|1737026\|33\|NZ_CP019882\|CRT	1737026-1737058	33	NZ_CP023550	Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence	74947-74979	9	0.727
NZ_CP019882_3	3.7\|1737026\|33\|NZ_CP019882\|CRT	1737026-1737058	33	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	42671-42703	9	0.727
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	332463-332492	9	0.7
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	679705-679734	9	0.7
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	KR997929	Mycobacterium phage Barriga, complete genome	28229-28258	9	0.7
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	MH576971	Mycobacterium phage Arlo, complete genome	28630-28659	9	0.7
NZ_CP019882_3	3.9\|1737134\|30\|NZ_CP019882\|CRT	1737134-1737163	30	NC_028815	Mycobacterium phage Nhonho, complete genome	28973-29002	9	0.7
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1355025-1355054	9	0.7
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	24769-24798	9	0.7
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP035035	Pantoea ananatis strain NN08200 plasmid unnamed1, complete sequence	12685-12714	9	0.7
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP011869	Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence	1517-1546	9	0.7
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP045356	Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence	953353-953382	9	0.7
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP046163	Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence	623167-623196	9	0.7
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP046066	Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence	807143-807172	9	0.7
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	MG962366	Rhodococcus phage Finch, complete genome	25899-25928	9	0.7
NZ_CP019882_1	1.3\|244617\|37\|NZ_CP019882\|CRT	244617-244653	37	NZ_CP040822	Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence	48654-48690	10	0.73
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	1458618-1458651	10	0.706
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	542775-542808	10	0.706
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	GQ919031	Streptomyces phage ZL12, complete genome	29806-29839	10	0.706
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	758456-758489	10	0.706
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	394411-394444	10	0.706
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1226208-1226237	10	0.667
NZ_CP019882_2	2.3\|471987\|30\|NZ_CP019882\|CRT	471987-472016	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1235688-1235717	10	0.667
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1226208-1226237	10	0.667
NZ_CP019882_2	2.5\|472071\|30\|NZ_CP019882\|CRT	472071-472100	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1235688-1235717	10	0.667
NZ_CP019882_3	3.13\|1737359\|30\|NZ_CP019882\|CRT	1737359-1737388	30	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	111171-111200	10	0.667
NZ_CP019882_3	3.17\|1737551\|30\|NZ_CP019882\|CRT	1737551-1737580	30	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	215986-216015	10	0.667
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	MN657148	Polaromonas sp. strain ANT_J29B plasmid pA29BJ2, complete sequence	33431-33464	11	0.676
NZ_CP019882_2	2.1\|471879\|54\|NZ_CP019882\|CRT	471879-471932	54	NZ_CP025188	Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence	1198-1251	11	0.796
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP022220	Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence	211925-211963	11	0.718
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP030052	Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence	803968-804006	11	0.718
NZ_CP019882_3	3.8\|1737077\|39\|NZ_CP019882\|CRT	1737077-1737115	39	NZ_CP030054	Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence	4272-4310	11	0.718
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	406880-406913	12	0.647
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	727451-727484	12	0.647
NZ_CP019882_1	1.5\|244719\|34\|NZ_CP019882\|CRT	244719-244752	34	NC_021909	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1e, complete sequence	4048-4081	12	0.647

1. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ttccggccgctccgccgccgc	Protospacer
********************

2. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ttccggccgctccgccgccgc	Protospacer
********************

3. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ttccggccgctccgccgccgc	Protospacer
********************

4. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ctccggccgctccgccgccga	Protospacer
.********************

5. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ttccgggcgctccgccgccga	Protospacer
****** **************

6. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
tcccggccgctccgccgccga	Protospacer
*.*******************

7. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to MT024866 (Mycobacterium phage Willsammy, complete genome) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ttccggccgcgccgccgccga	Protospacer
********** **********

8. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NC_041888 (Mycobacterium phage Tortellini, complete genome) position: , mismatch: 1, identity: 0.952

ttccggccgctccgccgccga	CRISPR spacer
ttccggccgcgccgccgccga	Protospacer
********** **********

9. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_010553 (Burkholderia ambifaria MC40-6 plasmid pBMC401, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggcggtgacggcggcggcagc	Protospacer
.*****.******************

10. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KC821626 (Cellulophaga phage phi39:1, complete genome) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtgacggcggcggcggg	Protospacer
**********************.*

11. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP035518 (Escherichia coli strain U14A plasmid pU14A_B, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

12. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP014199 (Escherichia coli strain MRE600 plasmid pMRE600-1, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

13. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP012632 (Escherichia coli strain SF-173 plasmid pSF-173-1, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

14. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP015160 (Escherichia coli strain Eco889 plasmid pECO-fce, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

15. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP013834 (Escherichia coli strain JJ2434 plasmid pJJ2434_2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

16. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP024150 (Escherichia coli strain 14EC033 plasmid p14EC033c, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

17. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP027536 (Escherichia coli strain AR_0081 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

18. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP035722 (Escherichia coli strain U15A plasmid pU15A_B, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

19. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP014112 (Escherichia coli strain FDAARGOS_144 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

20. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP024918 (Klebsiella pneumoniae strain NH54 plasmid pKPNH54.2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

21. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP035479 (Escherichia coli strain U13A plasmid pU13A_B, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

22. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP024888 (Escherichia coli strain AR_0019 plasmid tig00000138_pilon, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

23. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP031852 (Klebsiella pneumoniae strain 121 plasmid pKP121-3, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

24. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP035470 (Escherichia coli strain U12A plasmid pU12A_C, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

25. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP051696 (Escherichia coli strain SCU-313 plasmid pSCU-313-2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

26. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_AP018785 (Escherichia coli strain SK1144 plasmid pSK1144) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

27. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP051737 (Escherichia coli strain SCU-108 plasmid pSCU-108-2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

28. spacer 1.4|244674|25|NZ_CP019882|CRT matches to CP054381 (Escherichia coli strain SCU-175 plasmid pSCU-175-2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

29. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP013419 (Burkholderia sp. MSMB0266 plasmid pMSMB0266, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggcggtggcgacggcggcggcagc	Protospacer
***.*****.***************

30. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP032262 (Escherichia coli strain AR_0067 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

31. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_LR740760 (Escherichia coli strain BEN5202 isolate laying hen 51 weeks old plasmid pbAPEC5202) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

32. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP028322 (Escherichia coli O18:H1 strain CFSAN067215 plasmid p0.1229_2, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

33. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP054356 (Escherichia coli strain SCU-172 plasmid pSCU-172-3, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

34. spacer 1.4|244674|25|NZ_CP019882|CRT matches to CP027377 (Escherichia coli strain 2013C-4404 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

35. spacer 1.4|244674|25|NZ_CP019882|CRT matches to CP052261 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-3, complete sequence) position: , mismatch: 2, identity: 0.92

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggcggc	Protospacer
***********.**********.**

36. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 2, identity: 0.933

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccggggccgccgccggggacgccgcca	Protospacer
*****.***********.************

37. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 2, identity: 0.933

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccggggccgccgccggggacgccgcca	Protospacer
*****.***********.************

38. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NC_008383 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
aaccggccgctccgccgccga	Protospacer
  *******************

39. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
aaccggccgctccgccgccga	Protospacer
  *******************

40. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP022670 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
aaccggccgctccgccgccga	Protospacer
  *******************

41. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP022670 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
aaccggccgctccgccgccga	Protospacer
  *******************

42. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
agccggccgctccgccgccga	Protospacer
  *******************

43. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
gaccggccgctccgccgccga	Protospacer
  *******************

44. spacer 3.11|1737251|21|NZ_CP019882|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 2, identity: 0.905

ttccggccgctccgccgccga	CRISPR spacer
ttccggccgctccgccgccct	Protospacer
*******************

45. spacer 1.1|244491|25|NZ_CP019882|CRT matches to MG009575 (Mycobacterium phage Kumao, complete genome) position: , mismatch: 3, identity: 0.88

tgccggtgcgggttcggccaagggc	CRISPR spacer
tgacggttcgggttcggccaaggtc	Protospacer
** **** *************** *

46. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_048792 (Serratia phage Moabite, complete genome) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtaacggcggcggcaat	Protospacer
**********.************..

47. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP017750 (Cupriavidus sp. USMAA2-4 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgacggcggcagcagt	Protospacer
.******************.****.

48. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
aggtgatggtggcggcggcggcagc	Protospacer
 ****.*****.*************

49. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP009572 (Sphingomonas taxi strain ATCC 55669 plasmid STP1, complete sequence) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgacgccggcggcatc	Protospacer
.************* ******** *

50. spacer 1.4|244674|25|NZ_CP019882|CRT matches to MN234219 (Mycobacterium phage Mercurio, complete genome) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtggcggcggcggcggc	Protospacer
.**********.**********.**

51. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KX808131 (Mycobacterium phage SuperGrey, complete genome) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtggcggcggcggcggc	Protospacer
.**********.**********.**

52. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP049750 (Rhodococcus fascians A21d2 plasmid unnamed1) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggcggtgacggcggcggcggc	Protospacer
.*****.***************.**

53. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggttacggcggcggcggg	Protospacer
********** ***********.*

54. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggcggtggtgacggcggcggcgcc	Protospacer
***.******************. *

55. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggcggtggtgacggcggcggcggc	Protospacer
.**.******************.**

56. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP011383 (Calothrix sp. 336/3 plasmid unnamed1) position: , mismatch: 3, identity: 0.88

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcgggcgc	Protospacer
***********.*********  **

57. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 3, identity: 0.9

-cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
ccgcccg-ggtgcccgccgccgtgcaggccc	Protospacer
 ****** ***************** *** *

58. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tgttggtggtgacggcggcggcgcg	Protospacer
** *******************.

59. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KY385384 (Mycobacterium phage SimranZ1, complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
caatggtggtaacggcggcggcagc	Protospacer
...*******.**************

60. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP032328 (Azospirillum brasilense strain MTCC4035 plasmid p7, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
ccttgatggtgacggcggcggcagc	Protospacer
.  **.*******************

61. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP032328 (Azospirillum brasilense strain MTCC4035 plasmid p7, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
ccttgatggtgacggcggcggcagc	Protospacer
.  **.*******************

62. spacer 1.4|244674|25|NZ_CP019882|CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtgagggcggcggcgat	Protospacer
************ *********...

63. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtgggggtgacggcggcggcata	Protospacer
.***** ****************

64. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtgacggtggcggccat	Protospacer
***************.****** ..

65. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP049837 (Gordonia terrae strain RL-JC02 plasmid pPAE01, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtgtcggcggcggcgag	Protospacer
*********** **********..

66. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggcggtggtgacggcggcggcggt	Protospacer
.**.******************.*.

67. spacer 1.4|244674|25|NZ_CP019882|CRT matches to LR134127 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggcgatggtgacggcggcggcagg	Protospacer
.**.*.******************

68. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP021405 (Celeribacter manganoxidans strain DY25 plasmid pDY25-A, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggcggcggtgacggcggcggcaaa	Protospacer
***.**.****************.

69. spacer 1.4|244674|25|NZ_CP019882|CRT matches to MG944221 (Mycobacterium phage Scowl, complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggcggtggtggcggcggcggcagg	Protospacer
 **.*******.************

70. spacer 1.4|244674|25|NZ_CP019882|CRT matches to MF285618 (Serratia phage 2050HW, complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtaacggcggtggcaat	Protospacer
**********.*******.****..

71. spacer 1.4|244674|25|NZ_CP019882|CRT matches to AP013980 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S31-C4, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggcggcggcggcggcaaa	Protospacer
*********.*.***********.

72. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KU594606 (Cyanophage S-RIM32 isolate RW_108_0702, complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggaggt	Protospacer
***********.********* .*.

73. spacer 1.4|244674|25|NZ_CP019882|CRT matches to MK524500 (Mycobacterium phage Kevin1, complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggtgga	Protospacer
***********.*********..*

74. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP010024 (Paraburkholderia fungorum strain ATCC BAA-463 plasmid pBIL, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcagtgacggcggcggcagt	Protospacer
 *****..****************.

75. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_014841 (Pantoea sp. At-9b plasmid pPAT9B04, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtgatgccggcggcggcaat	Protospacer
********.** ***********..

76. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP018813 (Paraburkholderia sp. SOS3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtggcggcggcggcgtc	Protospacer
.**********.**********. *

77. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
aggcggtggtgacggcggcggcgga	Protospacer
 **.******************.*

78. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_015704 (Runella slithyformis DSM 19594 plasmid pRUNSL02, complete sequence) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
ctgtggtgatgacggcggcggtagc	Protospacer
. ******.************.***

79. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_025425 (Enterobacteria phage GEC-3S complete genome) position: , mismatch: 4, identity: 0.84

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtggcggcggcggcggt	Protospacer
.**********.**********.*.

80. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.857

-cgccgggcggagccggggcggcgacggg	CRISPR spacer
tcggc-ggcggggccggggcggcgaccgg	Protospacer
 ** * *****.************** **

81. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.857

-cgccgggcggagccggggcggcgacggg	CRISPR spacer
tcggc-ggcggggccggggcggcgaccgg	Protospacer
 ** * *****.************** **

82. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 4, identity: 0.857

cgccg-ggcggagccggggcggcgacggg	CRISPR spacer
-gccgcatcggagccggggcggcgagggg	Protospacer
 **** . ***************** ***

83. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.867

--ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcccgcc--cgccgccgccagggccgccgcca	Protospacer
  *****   ************* ********

84. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.867

--ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcccgcc--cgccgccgccagggccgccgcca	Protospacer
  *****   ************* ********

85. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP034347 (Roseovarius sp. MME-070 plasmid pMME07001, complete sequence) position: , mismatch: 4, identity: 0.867

ccgcca-gggccgccgccagggacgccgcca	CRISPR spacer
-cgccatgggccagcgccagggacgccgccg	Protospacer
 ***** *****. ****************.

86. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.867

--ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcccgcc--cgccgccgccagggccgccgcca	Protospacer
  *****   ************* ********

87. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.867

--ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcccgcc--cgccgccgccagggccgccgcca	Protospacer
  *****   ************* ********

88. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP034347 (Roseovarius sp. MME-070 plasmid pMME07001, complete sequence) position: , mismatch: 4, identity: 0.867

ccgcca-gggccgccgccagggacgccgcca	CRISPR spacer
-cgccatgggccagcgccagggacgccgccg	Protospacer
 ***** *****. ****************.

89. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP053710 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

cgccgttgatcgcgctcgcgccg-ccgtcag	CRISPR spacer
cgccgttgatcgcgcaggcgccgaccgaca-	Protospacer
***************  ****** *** **

90. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.867

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgcagtgcccgccgccgtgcgaccgc	Protospacer
*******.**************** . ***

91. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 4, identity: 0.867

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgcagtgcccgccgccgtgcgaccgc	Protospacer
*******.**************** . ***

92. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 4, identity: 0.867

-cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gcggcggc-gtgtccgccgccgtgctggcgc	Protospacer
 ** * ** ***.******************

93. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019344 (Serratia marcescens plasmid R830b, complete sequence) position: , mismatch: 4, identity: 0.867

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgttgatggtggcattcacgg-atcgta	Protospacer
*********.************** .***.

94. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KM406489 (Serratia marcescens strain R471 plasmid R471, complete sequence) position: , mismatch: 4, identity: 0.867

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgttgatggtggcattcacgg-atcgta	Protospacer
*********.************** .***.

95. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP016890 (Pantoea agglomerans strain C410P1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgacggcggcggtgcg	Protospacer
.********************..

96. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KY385384 (Mycobacterium phage SimranZ1, complete genome) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtggcggcggcggcgct	Protospacer
.**********.**********. .

97. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcggtgacggcggcggcctt	Protospacer
 *****.***************  .

98. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP010957 (Sphingobium sp. YBL2 plasmid 3pYBL2-3, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
aggcggtggtgacggcggcggcgat	Protospacer
 **.******************...

99. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP046723 (Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtgatggcggcggtgcg	Protospacer
************.********..

100. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcggtgacggcggcggcctt	Protospacer
 *****.***************  .

101. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgagggcggcggcgag	Protospacer
.*********** *********..

102. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggggca	Protospacer
***********.********* .

103. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcggtgacggcggcggcctt	Protospacer
 *****.***************  .

104. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_031257 (Mycobacterium phage Mulciber, complete genome) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
caagggtggtgccggcggcggcagc	Protospacer
... ******* *************

105. spacer 1.4|244674|25|NZ_CP019882|CRT matches to AP014328 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S35-C113, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtggcggcggcggttct	Protospacer
***********.*********.  .

106. spacer 1.4|244674|25|NZ_CP019882|CRT matches to MF140410 (Mycobacterium phage Et2Brutus, complete genome) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
caagggtggtgccggcggcggcagc	Protospacer
... ******* *************

107. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgacggcggcgagtga	Protospacer
.*******************.  *

108. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcggtgacggcggcggcctt	Protospacer
 *****.***************  .

109. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_019018 (Mycobacterium marinum DL240490 plasmid pMUM003, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggtggtgaaggcggcggccca	Protospacer
 *********** *********

110. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_011355 (Mycobacterium liflandii 128FXT plasmid pMUM002, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggtggtgaaggcggcggccca	Protospacer
 *********** *********

111. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgagggcggcggcgag	Protospacer
.*********** *********..

112. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gacgggtggtgacggcggcgtcagc	Protospacer
 .  **************** ****

113. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtgtcggcggcggcgct	Protospacer
.********** **********. .

114. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcggtgacggcggcggcctt	Protospacer
 *****.***************  .

115. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP031650 (Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
tggtggtggtgatggcggcggtgcg	Protospacer
************.********..

116. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggcggtgacggcggcggcctt	Protospacer
 *****.***************  .

117. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NZ_AP017625 (Mycobacterium ulcerans subsp. shinshuense strain ATCC 33728 plasmid pShTP, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
gggtggtggtgaaggcggcggccca	Protospacer
 *********** *********

118. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
ccagggtggagacggcggcggcagc	Protospacer
. . ***** ***************

119. spacer 1.4|244674|25|NZ_CP019882|CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
ccgtggtggtgccggcggcggcact	Protospacer
. ********* *********** .

120. spacer 1.4|244674|25|NZ_CP019882|CRT matches to KC736071 (Mycobacterium phage WIVsmall, complete genome) position: , mismatch: 5, identity: 0.8

tggtggtggtgacggcggcggcagc	CRISPR spacer
cggtggtggtggcggcggcggcgct	Protospacer
.**********.**********. .

121. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
agccgggcggagccgggacggctacgac	Protospacer
 ****************.**** ***.

122. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
aggcgggcggaggcggggcggcgtcggt	Protospacer
 * ********* ********** ***

123. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
agacgggcgtggccggggcggcgacggc	Protospacer
 * ****** .****************

124. spacer 1.6|244773|28|NZ_CP019882|CRT matches to MK524490 (Mycobacterium phage Donny, complete genome) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ggacgggcggagccggggcgacgtcggc	Protospacer
 * *****************.** ***

125. spacer 1.6|244773|28|NZ_CP019882|CRT matches to JN699007 (Mycobacterium phage Acadian, complete genome) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ggacgggcggagccggggcgacgtcggc	Protospacer
 * *****************.** ***

126. spacer 1.6|244773|28|NZ_CP019882|CRT matches to MT889381 (Mycobacterium phage Suigeneris, complete genome) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ggacgggcggagccggggcgacgtcggc	Protospacer
 * *****************.** ***

127. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggccgagccggggcgacgggggc	Protospacer
******** ***********.**. **

128. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NC_010627 (Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence) position: , mismatch: 5, identity: 0.821

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccggccgcagccggggcggcggcagt	Protospacer
****** ** *************.*.*

129. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 5, identity: 0.821

-cgccgggcggagccggggcggcgacggg	CRISPR spacer
gtgcc-accggagccggggcggcgaccgg	Protospacer
 .*** . ****************** **

130. spacer 2.3|471987|30|NZ_CP019882|CRT matches to KR011061 (Skermania phage SPI1, complete genome) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcaccagggccgccgacagggccgccgcct	Protospacer
.*.************ ***** *******

131. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgccgccatcgacgccatcg	Protospacer
******************  ******..*.

132. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
acagcaggcccgccgccagcgacgccgcca	Protospacer
 *. **** ********** **********

133. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgccgccatcgacgccatcg	Protospacer
******************  ******..*.

134. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_009958 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI04, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagcaccgccgccagggacgcaggcc	Protospacer
******* .**************** * *

135. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_041918 (Geobacillus phage TP-84, complete genome) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ctgcaagggccgccgccaggaacgccacga	Protospacer
*.** ***************.*****.* *

136. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 5, identity: 0.833

ccgcca-gggccgccgccagggacgccgcca	CRISPR spacer
-cgccgcgctccgccgccagggccgccgcca	Protospacer
 ****. *  ************ ********

137. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccaggg----acgccgcca	CRISPR spacer
ccgccacggccgccgccagggcggtacgcc----	Protospacer
****** **************    *****

138. spacer 2.5|472071|30|NZ_CP019882|CRT matches to KR011061 (Skermania phage SPI1, complete genome) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcaccagggccgccgacagggccgccgcct	Protospacer
.*.************ ***** *******

139. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgccgccatcgacgccatcg	Protospacer
******************  ******..*.

140. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
acagcaggcccgccgccagcgacgccgcca	Protospacer
 *. **** ********** **********

141. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgccgccatcgacgccatcg	Protospacer
******************  ******..*.

142. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_009958 (Dinoroseobacter shibae DFL 12 = DSM 16493 plasmid pDSHI04, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagcaccgccgccagggacgcaggcc	Protospacer
******* .**************** * *

143. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_041918 (Geobacillus phage TP-84, complete genome) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ctgcaagggccgccgccaggaacgccacga	Protospacer
*.** ***************.*****.* *

144. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 5, identity: 0.833

ccgcca-gggccgccgccagggacgccgcca	CRISPR spacer
-cgccgcgctccgccgccagggccgccgcca	Protospacer
 ****. *  ************ ********

145. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 5, identity: 0.833

ccgccagggccgccgccaggg----acgccgcca	CRISPR spacer
ccgccacggccgccgccagggcggtacgcc----	Protospacer
****** **************    *****

146. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcgatcgcgccgccggccg	Protospacer
 ** ********** *********** * *

147. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcgatcgcgccgccggccg	Protospacer
 ** ********** *********** * *

148. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcggtcgcgccgccggccg	Protospacer
 ** ********** *********** * *

149. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcggtcgcgccgccggccg	Protospacer
 ** ********** *********** * *

150. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcgatcgcgccgccggccg	Protospacer
 ** ********** *********** * *

151. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcgatcgcgccgccggccg	Protospacer
 ** ********** *********** * *

152. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcggtcgcgccgccggccg	Protospacer
 ** ********** *********** * *

153. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcggtcgcgccgccggccg	Protospacer
 ** ********** *********** * *

154. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
agcagttgatcgcggtcgcgccgccggccg	Protospacer
 ** ********** *********** * *

155. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccg-ccgtcag	CRISPR spacer
tgccgttgatcgagctcccgccgcccggca-	Protospacer
.*********** **** ***** *** **

156. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP016290 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgatcgcgctcgcgccg-ccgtcag	CRISPR spacer
tgccgttgatcgagctcccgccgcccggca-	Protospacer
.*********** **** ***** *** **

157. spacer 3.2|1736738|27|NZ_CP019882|CRT matches to NC_009508 (Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence) position: , mismatch: 5, identity: 0.815

cgctcgcacccgtggtcggactgcttc	CRISPR spacer
agctcgcaaccgtggtcggactggcgc	Protospacer
 ******* ************** . *

158. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MH727545 (Mycobacterium phage DismalStressor, complete genome) position: , mismatch: 5, identity: 0.833

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgccgctgccgccggttgtgacgccgaccc	Protospacer
.****.************.*******.*.*

159. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_026598 (Mycobacterium phage Milly, complete genome) position: , mismatch: 5, identity: 0.833

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgccgctgccgccggttgtgacgccgacgc	Protospacer
.****.************.*******.* *

160. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to KX688047 (Mycobacterium phage Marcoliusprime, complete genome) position: , mismatch: 5, identity: 0.833

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgccgctgccgccggttgtgacgccgaccc	Protospacer
.****.************.*******.*.*

161. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MF140408 (Mycobacterium phage DismalFunk, complete genome) position: , mismatch: 5, identity: 0.833

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgccgctgccgccggttgtgacgccgaccc	Protospacer
.****.************.*******.*.*

162. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MF140411 (Mycobacterium phage Findley, complete genome) position: , mismatch: 5, identity: 0.833

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgccgctgccgccggttgtgacgccgaccc	Protospacer
.****.************.*******.*.*

163. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgaggtcggcgccggttgcgacgccggcac	Protospacer
**  **.* ******************* *

164. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP007144 (Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgggcggggtgcccgccgccctgctggccc	Protospacer
**  ** ************* ******* *

165. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 5, identity: 0.833

cgcccgcggtgcccgccgccg-tgctggcgc	CRISPR spacer
cgcccgcggtgctcgccgccgttcccagcg-	Protospacer
************.******** * *..***

166. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccgcggtgcccgccgccgtgctggcgc--	CRISPR spacer
cgcctgcggtgcccgccgcc--gccggagccg	Protospacer
****.***************  **.** **

167. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccgcggtgcccgccgccgtgctggcgc---	CRISPR spacer
cgccggcggtgaccgccgccg---tggcgctcg	Protospacer
**** ****** *********   ******

168. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.833

cgcccgcggtgcccgccgccgtgctggcgc---	CRISPR spacer
cgcccgcggtgaccgccgctg---tggcgctcg	Protospacer
*********** *******.*   ******

169. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KY215945 (Klebsiella pneumoniae subsp. pneumoniae strain Kp1210 plasmid pOXA-519, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

170. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KY200950 (Klebsiella pneumoniae subsp. pneumoniae strain Kp1219 plasmid pOXA-517, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

171. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KY781949 (Klebsiella pneumoniae isolate Kp41 plasmid pKp41M, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

172. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KY213890 (Klebsiella pneumoniae strain 38_wz plasmid pOXA48_wz, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

173. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT838202 (Escherichia coli isolate WI2 isolate plasmid pWI2-OXA48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

174. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LN864821 (Raoultella planticola plasmid pRA35, complete sequence, strain RA35) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

175. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014072 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed1) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

176. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP050846 (Klebsiella pneumoniae strain Bckp206 plasmid pBckp206-1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

177. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX524525 (Klebsiella pneumoniae strain RAY plasmid pRAY, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

178. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX523901 (Klebsiella pneumoniae strain Kpn-30715/15 plasmid pOXA-48_30715, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

179. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX523900 (Klebsiella pneumoniae strain Kpn-04963/15 plasmid pOXA-48_4963, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

180. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX523902 (Klebsiella pneumoniae strain Kpn-30891/15 plasmid pOXA-48_30891, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

181. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX636096 (Klebsiella pneumoniae strain RJ119 plasmid pRJ119-2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

182. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KT935445 (Klebsiella pneumoniae strain Kp6411 plasmid 6411TF, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

183. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX009507 (Escherichia coli strain 06K2206 plasmid LM6771, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

184. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019368 (Enterobacter cloacae plasmid pEl1573, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

185. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KM406491 (Klebsiella pneumoniae strain Kpn-E1.Nr7 plasmid pKpn-E1.Nr7, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

186. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KP659188 (Klebsiella pneumoniae strain 153877-1 plasmid pOXA-48E1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

187. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KP025948 (Proteus mirabilis strain Pm-Oxa48 plasmid pOXA48-Pm, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

188. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KP061858 (Enterobacter cloacae strain INSRA17313-1 plasmid pUR17313-1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

189. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KM877517 (Enterobacter cloacae strain CRE623 plasmid pIMP-HB623, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

190. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KP294351 (Escherichia coli strain CZD1527 plasmid pIGT15, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

191. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KU315015 (Serratia marcescens strain NCTC 50331 plasmid R1215, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

192. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to AP018454 (Klebsiella pneumoniae plasmid pMRY13-133KPN_2 DNA, complete genome, strain: MRY13-133) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

193. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to AP018455 (Klebsiella aerogenes plasmid pMRY13-134EAE_1 DNA, complete genome, strain: MRY13-134) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

194. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034041 (Klebsiella pneumoniae subsp. pneumoniae strain CRK0298 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

195. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011599 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-83, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

196. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP044032 (Klebsiella pneumoniae strain FDAARGOS_631 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

197. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP048353 (Raoultella ornithinolytica strain 23 plasmid p23_D-OXA48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

198. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034283 (Klebsiella pneumoniae strain I72 plasmid p72_LM_OXA48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

199. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP037737 (Citrobacter freundii strain CAV1857 plasmid pKPC_CAV1857-85, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

200. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_004464 (Citrobacter freundii plasmid pCTX-M3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

201. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP023419 (Klebsiella pneumoniae strain 1050 plasmid pKp1050-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

202. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042501 (Enterobacter sp. E76 plasmid pE76_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

203. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP048339 (Escherichia coli strain 142 plasmid p142_B, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

204. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MK249855 (Enterobacter cloacae strain 105 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

205. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MK249856 (Klebsiella pneumoniae strain 91 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

206. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MK249858 (Escherichia coli strain 46 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

207. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042509 (Leclercia adecarboxylata strain E1 plasmid pE1_004, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

208. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_021488 (Klebsiella pneumoniae plasmid pKPoxa-48N1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

209. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_021502 (Klebsiella pneumoniae plasmid pKPoxa-48N2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

210. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026194 (Enterobacteriaceae bacterium ENNIH1 plasmid pKPC-825d, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

211. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP027039 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncLM, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

212. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP020530 (Enterobacter cloacae strain 174 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

213. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP020844 (Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

214. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP020844 (Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

215. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019154 (Klebsiella pneumoniae plasmid pOXA-48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

216. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP041085 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

217. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP023251 (Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_2) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

218. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT994838 (Klebsiella variicola isolate CNR130 plasmid CNR130, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

219. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MK966141 (Enterobacter cloacae strain GHZ8R11B plasmid pHNGDR11, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

220. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MK966142 (Klebsiella pneumoniae strain GHP8R3B plasmid pHNGDR03, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

221. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP024878 (Klebsiella pneumoniae strain NH25 plasmid pNH25.4, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

222. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_005246 (Erwinia amylovora LebB66 plasmid pEL60, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

223. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042514 (Serratia marcescens strain E28 plasmid pE28_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

224. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029138 (Klebsiella pneumoniae strain AR376 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

225. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP031805 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

226. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC508263 (Klebsiella pneumoniae A1-3 plasmid pA1-3 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

227. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040036 (Klebsiella pneumoniae strain KPC160117 plasmid pOXA48-L117, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

228. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022153 (Citrobacter freundii strain 705SK3 plasmid p705SK3_2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

229. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029599 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-77, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

230. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017288 (Klebsiella variicola strain GJ3 plasmid pKPGJ-3d, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

231. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019063 (Escherichia coli plasmid pNDM-HK, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

232. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022150 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

233. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MG516907 (Klebsiella aerogenes plasmid pEa1631, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

234. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LR025105 (Escherichia coli isolate EC-1639 plasmid pOXA-48_1639, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

235. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP009857 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-d0d, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

236. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042532 (Klebsiella aerogenes strain C9 plasmid pC9_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

237. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026385 (Serratia sp. SSNIH1 plasmid pKPC-56ce, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

238. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017282 (Klebsiella variicola strain GJ1 plasmid pKPGJ-1c, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

239. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022826 (Klebsiella quasivariicola strain KPN1705 plasmid pKPN1705-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

240. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_AP019667 (Klebsiella pneumoniae strain TA6363 plasmid pTMTA63632, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

241. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT994833 (Klebsiella pneumoniae isolate CNR341 plasmid CNR341, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

242. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP031235 (Escherichia coli strain Es_ST410_NW1_NDM_09_2017 plasmid pEsST410_NW_NDM, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

243. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to KP294350 (Uncultured bacterium plasmid pARM26, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

244. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011614 (Klebsiella oxytoca strain CAV1335 plasmid pCAV1335-92, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

245. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017932 (Klebsiella oxytoca strain CAV1015 plasmid pCAV1015-76, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

246. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MN792918 (Klebsiella aerogenes strain ST143 plasmid pLAU_KAM9_OXA48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

247. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017936 (Klebsiella pneumoniae strain CAV1016 plasmid pCAV1016-76, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

248. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018974 (Escherichia coli strain Ecol_545 plasmid pEC545_KPC, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

249. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040031 (Klebsiella pneumoniae strain KPC160121 plasmid pOXA48-L121, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

250. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018461 (Klebsiella pneumoniae strain Kp_Goe_39795 plasmid pKp_Goe_795-2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

251. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011640 (Serratia marcescens strain CAV1492 plasmid pCAV1492-73, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

252. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP032174 (Klebsiella pneumoniae strain AR_0160 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

253. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LR025095 (Klebsiella pneumoniae isolate KP9201 plasmid pOXA-48_920, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

254. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP045017 (Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

255. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP053283 (Escherichia coli strain SCU-308 plasmid pSCU-308-2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

256. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC545849 (Escherichia coli Ec-MW04 plasmid pEc-MW04_OXA DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

257. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC545850 (Klebsiella variicola Kv-MW05 plasmid pKv-MW05_OXA DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

258. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011632 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-84, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

259. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042574 (Enterobacter hormaechei strain E5 plasmid pE5_003, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

260. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042542 (Enterobacter hormaechei strain C4 plasmid pC4_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

261. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014698 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

262. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011593 (Klebsiella oxytoca strain CAV1099 plasmid pCAV1099-69, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

263. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011656 (Citrobacter freundii strain CAV1741 plasmid pKPC_CAV1741, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

264. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014298 (Klebsiella pneumoniae strain KP38731 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

265. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042580 (Enterobacter kobei strain C16 plasmid pC16_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

266. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to KU159085 (Klebsiella pneumoniae plasmid pOXAAPSS1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

267. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP011609 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-71, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

268. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP032193 (Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

269. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_023027 (Klebsiella pneumoniae strain E71T plasmid, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

270. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026497 (Klebsiella pneumoniae strain 616 plasmid pKp616_2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

271. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026188 (Enterobacteriaceae bacterium ENNIH2 plasmid pKPC-ddab, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

272. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP044337 (Enterobacter hormaechei strain AKB48 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

273. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LN864819 (Klebsiella pneumoniae plasmid pKP112, complete sequence, strain KP112) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

274. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LN864820 (Citrobacter freundii plasmid pCF29, complete sequence, strain CF29) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

275. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP031216 (Escherichia coli strain Es_ST80_L1_NDM_10_2017 plasmid pEsST80_L1_NDM, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

276. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LR025091 (Klebsiella pneumoniae isolate KP980 plasmid pOXA-48_980, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

277. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP038457 (Escherichia coli strain EC-129 plasmid pEC129_4, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

278. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_011641 (Klebsiella pneumoniae plasmid pCTXM360, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

279. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042526 (Citrobacter freundii strain E11 plasmid pE11_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

280. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

281. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019346 (Enterobacter cloacae plasmid pNE1280, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

282. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP031322 (Escherichia coli strain ST2350 isolate Es_ST2350_SE1_NDM_03_2018 plasmid pEsST2350_SE_NDM, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

283. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP052472 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-4, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

284. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018700 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

285. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LR745044 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pOXA48_Kpn154) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

286. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_021078 (Klebsiella pneumoniae strain Kp002 plasmid pJEG011, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

287. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP027699 (Klebsiella pneumoniae strain KP30835 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

288. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT985264 (Escherichia coli strain 717 plasmid RCS51TR717_p, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

289. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT985279 (Escherichia coli strain 676 plasmid RCS60_p, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

290. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC505604 (Klebsiella pneumoniae A1-1 plasmid pKp1-1 genomic DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

291. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC508722 (Klebsiella pneumoniae A2-1 plasmid pA2-4 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

292. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019889 (Klebsiella pneumoniae strain 601 plasmid pNDM-OM, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

293. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MT193824 (Escherichia coli strain 19-AB01443 plasmid pOX-48-EC1443, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

294. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_MK088079 (Klebsiella pneumoniae strain 19 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

295. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_MK370728 (Klebsiella pneumoniae strain 69G1 plasmid pLimOXA-48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

296. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_MF156266 (Escherichia coli strain 24-S11 plasmid pCESC2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

297. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP030135 (Klebsiella pneumoniae strain 160111 plasmid pOXA48_L111, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

298. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042568 (Enterobacter hormaechei strain C44 plasmid pC44_002, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

299. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018736 (Klebsiella pneumoniae strain Kp_Goe_121641 plasmid pKp_Goe_641-2) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

300. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KX783441 (Klebsiella pneumoniae strain KP4368 plasmid pKP4368, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

301. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP015071 (Escherichia coli strain Ecol_743 plasmid pEC743_OXA48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

302. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KM406488 (Salmonella enterica subsp. enterica serovar Paratyphi B strain R69 plasmid R69, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

303. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KM406490 (Salmonella enterica subsp. enterica serovar Typhimurium strain 202 plasmid pSEM, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

304. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_KP975075 (Citrobacter freundii strain MRSN12115 plasmid pMRVIM1012, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

305. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP048042 (Serratia liquefaciens strain JL02 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

306. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018443 (Klebsiella pneumoniae strain Kp_Goe_822917 plasmid pKp_Goe_917-2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

307. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034202 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L_2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

308. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP035217 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-C, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

309. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029447 (Serratia marcescens strain CAV1761 plasmid pCAV1761-73, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

310. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018717 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

311. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018723 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

312. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018706 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

313. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018694 (Klebsiella pneumoniae strain Kp_Goe_821588 plasmid pKp_Goe_588-2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

314. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556214 (Escherichia coli CEX24 plasmid pCEX24 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

315. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556215 (Escherichia coli CEX25 plasmid pCEX25 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

316. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556216 (Escherichia coli CEX14 plasmid pCEX14 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

317. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556217 (Escherichia coli CEX3 plasmid pCEX3 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

318. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556218 (Enterobacter cloacae CEX5 plasmid pCEX5 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

319. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556219 (Enterobacter cloacae CEX6 plasmid pCEX6 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

320. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556220 (Enterobacter cloacae CEX4 plasmid pCEX4 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

321. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556221 (Klebsiella pneumoniae CEX18 plasmid pCEX18 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

322. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC556222 (Klebsiella pneumoniae CEX23 plasmid pCEX23 DNA, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

323. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP031566 (Enterobacter hormaechei strain 2013_1a plasmid pIncLM-1301491, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

324. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_024997 (Klebsiella oxytoca plasmid pACM1, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

325. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_025134 (Klebsiella pneumoniae plasmid pFOX-7a, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

326. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT985387 (Escherichia coli strain 694 genome assembly, plasmid: RCS55_pI) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

327. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP019841 (Enterobacter roggenkampii strain R11 plasmid pASM2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

328. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP007733 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKPN-068, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

329. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP010365 (Enterobacter hormaechei subsp. oharae strain 34978 plasmid p34978-70.092kb, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

330. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017853 (Klebsiella variicola strain GJ2 plasmid pKPGJ-2d, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

331. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP009852 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH4 plasmid pENT-e56, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

332. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026395 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPC-edb7, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

333. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018669 (Klebsiella pneumoniae strain CAV1042 plasmid pKPC_CAV1042-89, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

334. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026142 (Klebsiella pneumoniae strain F127 plasmid pF127_2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

335. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LC536683 (Klebsiella pneumoniae MyNCGM084 plasmid pMyNCGM084, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

336. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026210 (Citrobacter sp. CFNIH10 plasmid pKPC-2fe2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

337. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP016927 (Klebsiella pneumoniae isolate 23 plasmid pIncL_M_DHQP1400954, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

338. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018315 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

339. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP027148 (Klebsiella pneumoniae strain AR_0363 plasmid unnamed5) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

340. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP015075 (Escherichia coli strain Ecol_745 plasmid pEC745_OXA48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

341. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to KU159086 (Klebsiella pneumoniae plasmid pOXAAPSS2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

342. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018690 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

343. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP031374 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvOXA-48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

344. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MN187903 (Citrobacter freundii strain Cf164 plasmid pCf164_CTX-M-8, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

345. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP032170 (Klebsiella pneumoniae strain AR_0076 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

346. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018342 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-5, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

347. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP020502 (Serratia marcescens strain BWH-23 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

348. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP033880 (Escherichia coli strain 50579417 plasmid p50579417_3_OXA-48, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

349. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029720 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

350. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP042490 (Enterobacter hormaechei strain C15 plasmid pC15_002) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

351. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT985241 (Escherichia coli strain 721 plasmid RCS40_p, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

352. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018712 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-3, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

353. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP021742 (Klebsiella pneumoniae strain AR_0126 plasmid tig00000002jNODE_23, complete sequence) position: , mismatch: 5, identity: 0.833

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-atcgta	Protospacer
*****.***.************** .***.

354. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
gcgggggcggcgccggggcggcgaccgg	Protospacer
    ****** ************** **

355. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP020890 (Xanthomonas citri pv. citri strain TX160197 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ggccgggcggagccgggtcggcgcgaga	Protospacer
 **************** *****  .*.

356. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP020883 (Xanthomonas citri pv. citri strain TX160042 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ggccgggcggagccgggtcggcgcgaga	Protospacer
 **************** *****  .*.

357. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP020886 (Xanthomonas citri pv. citri strain TX160149 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ggccgggcggagccgggtcggcgcgaga	Protospacer
 **************** *****  .*.

358. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NC_014811 (Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
gcccggtcggagccggcgcggcgacagc	Protospacer
  **** ********* ********.*

359. spacer 1.6|244773|28|NZ_CP019882|CRT matches to MT657335 (Gordonia phage Mariokart, complete genome) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
ccgtcggcggtgccggggcggcggcggg	Protospacer
*  . ***** ************.****

360. spacer 1.6|244773|28|NZ_CP019882|CRT matches to ASHF01000034 (Streptomyces sp. GBA 94-10 plasmid pGBA1, complete sequence, whole genome shotgun sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccggccggtgccggggcggcggatgt	Protospacer
****** *** ************.  *

361. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
tcctgaccggagccgtggcggcgacggg	Protospacer
. *.*. ******** ************

362. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.786

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgtccggagccggggcggcggtcag	Protospacer
*****  ****************.. .*

363. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ggaccagcgccgccgccagggccgccgccg	Protospacer
  .**** ************* *******.

364. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gagccagggccgccgccaaggaggccggcc	Protospacer
  ****************.*** **** *

365. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gagccagggccgccgccaaggaggccggcc	Protospacer
  ****************.*** **** *

366. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccatcctggccgccgccggggccgccgcca	Protospacer
**..*  **********.*** ********

367. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccatcctggccgccgccggggccgccgcca	Protospacer
**..*  **********.*** ********

368. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

369. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

370. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

371. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

372. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

373. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccag--ggccgccgccagggacgccgcca	CRISPR spacer
--gcaagctcgccgccgccagggccgccgccg	Protospacer
  ** **   ************* *******.

374. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cccctcgggacgcccccagggacgccgcct	Protospacer
** *. *** **** **************

375. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cggacgcgtccgccgccagggccgccgcca	Protospacer
* * *. * ************ ********

376. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 6, identity: 0.8

--ccgccagggccgccgccagggacgccgcca	CRISPR spacer
catggcc--ggccgccgccagtgccgccgcca	Protospacer
  . ***  ************ * ********

377. spacer 2.3|471987|30|NZ_CP019882|CRT matches to MH834622 (Arthrobacter phage Noely, complete genome) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccaggtccgccgccagggccagggccg	Protospacer
******** ************ *.  ***.

378. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ggaccagcgccgccgccagggccgccgccg	Protospacer
  .**** ************* *******.

379. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP013529 (Rhizobium phaseoli strain R723 plasmid pRphaR723b, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gagccagggccgccgccaaggaggccggcc	Protospacer
  ****************.*** **** *

380. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP013582 (Rhizobium phaseoli strain N261 plasmid pRphaN261b, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gagccagggccgccgccaaggaggccggcc	Protospacer
  ****************.*** **** *

381. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccatcctggccgccgccggggccgccgcca	Protospacer
**..*  **********.*** ********

382. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccatcctggccgccgccggggccgccgcca	Protospacer
**..*  **********.*** ********

383. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

384. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

385. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

386. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

387. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccacgctggccgccgcctgggacgccggca	Protospacer
**.*   ********** ********* **

388. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccag--ggccgccgccagggacgccgcca	CRISPR spacer
--gcaagctcgccgccgccagggccgccgccg	Protospacer
  ** **   ************* *******.

389. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cccctcgggacgcccccagggacgccgcct	Protospacer
** *. *** **** **************

390. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cggacgcgtccgccgccagggccgccgcca	Protospacer
* * *. * ************ ********

391. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 6, identity: 0.8

--ccgccagggccgccgccagggacgccgcca	CRISPR spacer
catggcc--ggccgccgccagtgccgccgcca	Protospacer
  . ***  ************ * ********

392. spacer 2.5|472071|30|NZ_CP019882|CRT matches to MH834622 (Arthrobacter phage Noely, complete genome) position: , mismatch: 6, identity: 0.8

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccaggtccgccgccagggccagggccg	Protospacer
******** ************ *.  ***.

393. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_008760 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP04, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
gcctgttgaccgcgctcgcgccgccgccat	Protospacer
  *.*****.****************.**

394. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgtt--gatcgcgctcgcgccgccgtcag	CRISPR spacer
--ccggtcagatcgcggtcgcgccgccgtcga	Protospacer
  *** *  ******* *************..

395. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MN617843 (Mycobacterium phage Quesadilla, complete genome) position: , mismatch: 6, identity: 0.8

cgccgttgatcgcgctcgcgccgccgtcag--	CRISPR spacer
tcccgtagaccgcgctcgcgccgcc--cagcc	Protospacer
. **** **.***************  ***

396. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgatcgcgctcgcgccgc-cgtcag	CRISPR spacer
tgccgtcgttcgcgctcgcgccgcgcgacg-	Protospacer
.*****.* *************** ** *.

397. spacer 3.2|1736738|27|NZ_CP019882|CRT matches to NZ_CP020926 (Sphingobium yanoikuyae strain SHJ plasmid pSES220, complete sequence) position: , mismatch: 6, identity: 0.778

cgctcgcacccgtggtcggactgcttc	CRISPR spacer
gcctcgcgctcgtggtcggactgctcg	Protospacer
  *****.*.***************.

398. spacer 3.7|1737026|33|NZ_CP019882|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 6, identity: 0.818

cgccg-ttgccgcccgctccggtgccggaagcgc	CRISPR spacer
-gccgagcgccgcccgctccggagccgggagcgg	Protospacer
 ****  .************** *****.****

399. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgccggtgccgccggttgcgatgcaagcac	Protospacer
.**** ***************.** .** *

400. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgcccttgccgccggtcgcgacggccccgc	Protospacer
**** ***********.****** *  * *

401. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgatggcgccgccggtagcgtcgccggctc	Protospacer
** .* .********* *** *********

402. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gcaccggggtgctcgccgccgtgctggccc	Protospacer
   *** *****.*************** *

403. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gcaccggggtgctcgccgccgtgctggccc	Protospacer
   *** *****.*************** *

404. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tgaccgcggtggccgccgccgtggtggccg	Protospacer
.* ******** *********** ****

405. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
accacgcgctgcccgccgccgcgctggcgg	Protospacer
  * **** ************.*******

406. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP029358 (Azospirillum sp. CFH 70021 plasmid unnamed3) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
ccggggcggtgctcgccgccgggctggcgc	Protospacer
*    *******.******** ********

407. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgcggtgcccggcgccgcggaagcgg	Protospacer
*************** *****.*  .***

408. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgctgccggtgtccgccgccgtgctgccgt	Protospacer
***.  *****.************** **.

409. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccccggtgcccgcggccgtgcagcccg	Protospacer
***** ********** ******* * *

410. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_013860 (Azospirillum sp. B510 plasmid pAB510f, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cttcggtggtgcccgccgccgtcctggcgg	Protospacer
* .* *.*************** ******

411. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to MH669013 (Gordonia phage Skysand, complete genome) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
accacacggtgcccgccgacgcgctggcgc	Protospacer
  * *.************ **.********

412. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to MF919542 (Gordonia phage Patio, complete genome) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
accacacggtgcccgccgacgcgctggcgc	Protospacer
  * *.************ **.********

413. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.8

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cggtggcggtgcccgccgccgggctgatgc	Protospacer
** . **************** ****..**

414. spacer 3.14|1737407|30|NZ_CP019882|CRT matches to NZ_CP048637 (Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgcttccggcgaacagcccggagctgc	CRISPR spacer
cggcgcttcctgcgaacagcccggtcttcc	Protospacer
** ******* *************  .* *

415. spacer 3.14|1737407|30|NZ_CP019882|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgctt-ccggcgaacagcccggagctgc	CRISPR spacer
-accacctgccggcgaacagcccggtgctgg	Protospacer
 .**.*.* **************** ****

416. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034325 (Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-CTX-M-3, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgacggtggcattcacggcgtcgc-	CRISPR spacer
cgccgctgatggtggcattcacgg-accgta	Protospacer
*****.***.************** ..**.

417. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LR134457 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 15, complete sequence) position: , mismatch: 6, identity: 0.8

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccgttgacggtgaccttcacgttgccgt	Protospacer
**************.* ****** .*.**.

418. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggagcgggggcggccgtttc	Protospacer
************* ******** ..

419. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NC_049470 (Arthrobacter phage TripleJ, complete genome) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggagccggggcgctcatcaa	Protospacer
******************** . *. ..

420. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
agccgggcggagccggcgccgcgaacca	Protospacer
 *************** ** ****   .

421. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP054607 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed8, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

422. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggaggggccggggcggcgcgaca	Protospacer
******* **.************  . .

423. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010616 (Phaeobacter inhibens strain P92 plasmid pP92_f, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

424. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010679 (Phaeobacter gallaeciensis strain P75 plasmid pP75_f, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

425. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
agccgggcggagccggcgccgcgaacca	Protospacer
 *************** ** ****   .

426. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010790 (Phaeobacter gallaeciensis strain P63 plasmid pP63_f, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

427. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010635 (Phaeobacter inhibens strain P78 plasmid pP78_f, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

428. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP045408 (Roseovarius sp. THAF9 plasmid pTHAF9_d, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

429. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010755 (Phaeobacter inhibens strain P70 plasmid pP70_f, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

430. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP045378 (Sulfitobacter sp. THAF37 plasmid pTHAF37_f, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgcccgccggagccggggcggcggtcct	Protospacer
**** * ****************..

431. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010713 (Phaeobacter inhibens strain P66 plasmid pP66_h, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

432. spacer 1.6|244773|28|NZ_CP019882|CRT matches to NZ_CP010740 (Phaeobacter inhibens strain P72 plasmid pP72_e, complete sequence) position: , mismatch: 7, identity: 0.75

cgccgggcggagccggggcggcgacggg	CRISPR spacer
cgccgggcggggccggggccgcgcgcaa	Protospacer
**********.******** ***   ..

433. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gggtcatcaccgccgccagggccgccgcca	Protospacer
  *.**  .************ ********

434. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaaccgggccgccggcagggacgccgccc	Protospacer
  . * ********* *************

435. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaaccgggccgccggcagggacgccgccc	Protospacer
  . * ********* *************

436. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

437. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

438. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

439. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

440. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgtccagcgccgccgccagggactcccgcg	Protospacer
*  **** *************** **  *.

441. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

442. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

443. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

444. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

445. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgtccagcgccgccgccagggactcccgcg	Protospacer
*  **** *************** **  *.

446. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

447. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

448. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

449. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

450. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

451. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

452. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

453. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

454. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

455. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

456. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

457. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

458. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

459. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

460. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

461. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgatcctggccgccgccggggccgccgcca	Protospacer
* ..*  **********.*** ********

462. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

463. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

464. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

465. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

466. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgatcctggccgccgccggggccgccgcca	Protospacer
* ..*  **********.*** ********

467. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgggagggccgccgcctgggtcgccgctg	Protospacer
 **  ************ *** ******..

468. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

469. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

470. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

471. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

472. spacer 2.3|471987|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

473. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cagctccggccgccgcccgggacgccgctt	Protospacer
* **.  ********** **********.

474. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cagctccggccgccgcccgggacgccgctt	Protospacer
* **.  ********** **********.

475. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP011523 (Streptomyces sp. CFMR 7 strain CFMR-7 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgcgaggaccgccgccagggacagcgagc	Protospacer
**** ***.**************. **

476. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagg-----gccgccgccagggacgccgcca	CRISPR spacer
-----aggggaccgccgccgccagggccgccgccg	Protospacer
     ***     ************* *******.

477. spacer 2.3|471987|30|NZ_CP019882|CRT matches to MH727552 (Gordonia phage KidneyBean, complete genome) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
aggccagcgccgccgccaaggacgcacccg	Protospacer
  ***** **********.******  **.

478. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP033873 (Caulobacter sp. FWC26 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgctgccaggcacttgggcg	Protospacer
*************.****** ** . * *.

479. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gggtcatcaccgccgccagggccgccgcca	Protospacer
  *.**  .************ ********

480. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaaccgggccgccggcagggacgccgccc	Protospacer
  . * ********* *************

481. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaaccgggccgccggcagggacgccgccc	Protospacer
  . * ********* *************

482. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

483. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

484. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

485. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

486. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgtccagcgccgccgccagggactcccgcg	Protospacer
*  **** *************** **  *.

487. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

488. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

489. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

490. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

491. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgtccagcgccgccgccagggactcccgcg	Protospacer
*  **** *************** **  *.

492. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

493. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

494. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

495. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

496. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

497. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

498. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

499. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

500. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

501. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

502. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

503. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

504. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

505. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

506. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

507. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgatcctggccgccgccggggccgccgcca	Protospacer
* ..*  **********.*** ********

508. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

509. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tccgcgtggccgccgccacggccgccgcca	Protospacer
.*  *. *********** ** ********

510. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgacgccagggtcagcttga	Protospacer
************ ******** *. * . *

511. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tggtcgacgccgccgccaaggacgccgcca	Protospacer
. *.*.. **********.***********

512. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgatcctggccgccgccggggccgccgcca	Protospacer
* ..*  **********.*** ********

513. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgggagggccgccgcctgggtcgccgctg	Protospacer
 **  ************ *** ******..

514. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

515. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

516. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

517. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

518. spacer 2.5|472071|30|NZ_CP019882|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagggccgccgcccggtacgagggct	Protospacer
 **************** ** ***  * *

519. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cagctccggccgccgcccgggacgccgctt	Protospacer
* **.  ********** **********.

520. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cagctccggccgccgcccgggacgccgctt	Protospacer
* **.  ********** **********.

521. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP011523 (Streptomyces sp. CFMR 7 strain CFMR-7 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgcgaggaccgccgccagggacagcgagc	Protospacer
**** ***.**************. **

522. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagg-----gccgccgccagggacgccgcca	CRISPR spacer
-----aggggaccgccgccgccagggccgccgccg	Protospacer
     ***     ************* *******.

523. spacer 2.5|472071|30|NZ_CP019882|CRT matches to MH727552 (Gordonia phage KidneyBean, complete genome) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
aggccagcgccgccgccaaggacgcacccg	Protospacer
  ***** **********.******  **.

524. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP033873 (Caulobacter sp. FWC26 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagggccgctgccaggcacttgggcg	Protospacer
*************.****** ** . * *.

525. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
tgccgatgatcgcgctcgcgctgccgcagc	Protospacer
.**** ***************.****. .

526. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP015091 (Pelagibaca abyssi strain JLT2014 plasmid pPABY1, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
tgccgttgatcgcgctcgacccgccaagcg	Protospacer
.*****************  *****.   *

527. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ttccgatgatcgcgttcgcgccgccggcga	Protospacer
. *** ********.*********** *..

528. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP015988 (Sphingobium sp. EP60837 plasmid pEP1, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
atccgttgatcgcggtcgcgccgcaggttg	Protospacer
  ************ ********* * . *

529. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
cgccggggatcgcgctcgcgccggccgcgt	Protospacer
*****  **************** *  *.

530. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP015369 (Methylobacterium phyllosphaerae strain CBMB27 plasmid CBMB27-p2, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgcgctgaacgcgctcgcgccgccgccca	Protospacer
*  **.*** ****************.* .

531. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP044976 (Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
cgccggtgatcgggctcgcgccgggcgctg	Protospacer
***** ****** **********    * *

532. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
gcctgctgatcgcgatcgcgccgccgccat	Protospacer
  *.*.******** ***********.**

533. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MH910038 (Mycobacterium phage LeMond, complete genome) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
cgccggtgatctcgctcgcgccggtcacac	Protospacer
***** ***** *********** .  **

534. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgcgctgaacgcgctcgcgccgccgccca	Protospacer
*  **.*** ****************.* .

535. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
gcctgctgatcgcgatcgcgccgccgccat	Protospacer
  *.*.******** ***********.**

536. spacer 3.3|1736783|30|NZ_CP019882|CRT matches to MG944216 (Microbacterium phage Pajaza, complete genome) position: , mismatch: 7, identity: 0.767

cgcctgctccaccgctgatggcgccgaagc	CRISPR spacer
cgccttctccaccgctggtggcgaggcgac	Protospacer
***** ***********.*****  * ..*

537. spacer 3.3|1736783|30|NZ_CP019882|CRT matches to MG944226 (Microbacterium phage Casey, complete genome) position: , mismatch: 7, identity: 0.767

cgcctgctccaccgctgatggcgccgaagc	CRISPR spacer
cgccttctccaccgctggtggcgaggcgac	Protospacer
***** ***********.*****  * ..*

538. spacer 3.3|1736783|30|NZ_CP019882|CRT matches to MG944218 (Microbacterium phage Pikmin, complete genome) position: , mismatch: 7, identity: 0.767

cgcctgctccaccgctgatggcgccgaagc	CRISPR spacer
cgccttctccaccgctggtggcgaggcgac	Protospacer
***** ***********.*****  * ..*

539. spacer 3.7|1737026|33|NZ_CP019882|CRT matches to NC_019895 (Singulisphaera acidiphila DSM 18658 plasmid pSINAC03, complete sequence) position: , mismatch: 7, identity: 0.788

cgccgttgccgcccgctccggtgccggaagcgc	CRISPR spacer
cggtgccgccgcccgctccggcgccggaagccg	Protospacer
** .*..**************.*********

540. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

541. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

542. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

543. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

544. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

545. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

546. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

547. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

548. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

549. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

550. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

551. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

552. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

553. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

554. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

555. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

556. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

557. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

558. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

559. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

560. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

561. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

562. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

563. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

564. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

565. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

566. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

567. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

568. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

569. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

570. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

571. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

572. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

573. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

574. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

575. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

576. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

577. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

578. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

579. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

580. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

581. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

582. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

583. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

584. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

585. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

586. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

587. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

588. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

589. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

590. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

591. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

592. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

593. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

594. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

595. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

596. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

597. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

598. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

599. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.821

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgcgagcgtgccgccggtgt	Protospacer
.* ***  .*************** *************.

600. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
ttcaattgccgccggttgcgacgccgggat	Protospacer
. * .**********************  .

601. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_AP022602 (Mycobacterium gallinarum strain JCM 6399 plasmid pJCM6399) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tcccggtgccgccagttgcgacgccgcccg	Protospacer
. *** *******.************ *.

602. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccggtgccgccggtggcgacgatgacgt	Protospacer
***** ********** ****** .*.* .

603. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggtggcgtcgccaccgt	Protospacer
*.************** *** ****. * .

604. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_019789 (Deinococcus peraridilitoris DSM 19664 plasmid pDEIPE01, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggtggcgtcgccaccgt	Protospacer
*.************** *** ****. * .

605. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
gttctttgccgccggacgcgacgccggcta	Protospacer
  .* ********** .************

606. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccgttgccgccggtttcgatgttgtcgt	Protospacer
***************** ***.*..* * .

607. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MT889372 (Microbacterium phage Avocadoman, complete genome) position: , mismatch: 7, identity: 0.767

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccggtgccgccgtttgcgacggggacgg	Protospacer
***** ******** ********  *.*

608. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc-----	CRISPR spacer
cgcccgcgctgcccgccgcc-----gacgccttcg	Protospacer
******** ***********     *.***

609. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc-----	CRISPR spacer
cgcccgcgctgcccgccgcc-----gacgccttcg	Protospacer
******** ***********     *.***

610. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

611. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

612. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

613. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

614. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP037915 (Sphingomonas sp. AAP5 plasmid p150, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gtgaagcggtgcctgccgccatgctggcgc	Protospacer
     ********.******.*********

615. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

616. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgctcctactc	Protospacer
******* *************. *. .* *

617. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
acctggcggtgtccgccgccgtgctgacgg	Protospacer
  *. ******.**************.**

618. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgc-tggcgc	CRISPR spacer
aggccgcggtgctcgccgccgtgcgcgaca-	Protospacer
 * *********.*********** .*.*.

619. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgctcctactc	Protospacer
******* *************. *. .* *

620. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgctcctactc	Protospacer
******* *************. *. .* *

621. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP014769 (Hymenobacter sp. PAMC 26554 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gccacgcagtgcccgccgccctgctggccg	Protospacer
  * ***.************ *******

622. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_008010 (Deinococcus geothermalis DSM 11300 plasmid pDGEO01, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tgtttgcgctgcccgccgccgcgctggcga	Protospacer
.*...*** ************.*******

623. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
acctggcggtgtccgccgccgtgctgacgg	Protospacer
  *. ******.**************.**

624. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
acctggcggtgtccgccgccgtgctgacgg	Protospacer
  *. ******.**************.**

625. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
acctggcggtgtccgccgccgtgctgacgg	Protospacer
  *. ******.**************.**

626. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gcgcggcggtgcccggcgccgtcctggcgg	Protospacer
   * ********** ****** ******

627. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

628. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgttggcggtgcccgccgccgagcgggcca	Protospacer
**.. **************** ** ***

629. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tcccgctggtgcccggcgccgtgctcgcgc	Protospacer
. **  .******** ********* ****

630. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

631. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
ccacgacggcgcccgccgccgtgatggcga	Protospacer
*  * .***.************* *****

632. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_011879 (Pseudarthrobacter chlorophenolicus A6 plasmid pACHL01, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
ccgcagcggggccggccgccgtgctggcca	Protospacer
*  * **** *** **************

633. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcgcgcggtgcccgccgccgccatccccc	Protospacer
*** *****************.  *  * *

634. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP020332 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM259, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tgatcccggtgttcgccgccgtgctggcga	Protospacer
.* .* *****..****************

635. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_022050 (Paracoccus aminophilus JCM 7686 plasmid pAMI8, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tgatctcggtgcccgccgccatgctgtcgg	Protospacer
.* .* **************.***** **

636. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgcccccactc	Protospacer
******* *************. *. .* *

637. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP010860 (Marinovum algicola DG 898 plasmid pMaD5, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
catgcgcggtgcccgccgccatgccggtgg	Protospacer
*.. ****************.***.**.*

638. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgccactccgc	Protospacer
******* *************.  .  ***

639. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gccttgccatgcgcgccgccgtgctggcgc	Protospacer
  *..** .*** *****************

640. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP015420 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccgctgacggtggcattctcgccaaggg	Protospacer
*****.************** ** *.  *

641. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MN234187 (Mycobacterium phage DyoEdafos, complete genome) position: , mismatch: 7, identity: 0.767

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
aaccagtgaccgtggcattaacggcgtcgt	Protospacer
 .**. **** ******** *********.

642. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP036456 (Streptomonospora sp. M2 plasmid phiM2, complete sequence) position: , mismatch: 7, identity: 0.767

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
ggccgctgacggtggcattcacacgggcac	Protospacer
 ****.****************.  * *.*

643. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_AP014801 (Rhodovulum sulfidophilum plasmid Plasmid1 DNA, complete genome, strain: DSM 2351) position: , mismatch: 7, identity: 0.767

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccgctgacggtggcattctcgccaaggg	Protospacer
*****.************** ** *.  *

644. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_028947 (Mycobacterium phage Kratio, complete genome) position: , mismatch: 7, identity: 0.767

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccgctgacgctggcattcacgaacgcgt	Protospacer
*****.***** ***********.   **.

645. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ggccgatcgccgccgccacggacgccgcct	Protospacer
   * *  ********** **********

646. spacer 2.3|471987|30|NZ_CP019882|CRT matches to MN304817 (Phage 68_12, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ctgccagggacgctgccagggacgctctgc	Protospacer
*.******* ***.***********. .

647. spacer 2.3|471987|30|NZ_CP019882|CRT matches to JX676771 (Pseudomonas phage AF, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cagccagggacgcagccagggacgcgcagg	Protospacer
* ******* *** ***********    .

648. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgatcagggctgccgccagggaggccgagc	Protospacer
* ..******.*********** ****

649. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP024924 (Sphingomonas sp. Cra20 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagtgccgccgccagggttgctttgg	Protospacer
******* ************* .**. . .

650. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agctctcggccgccggccgggacgccgcca	Protospacer
   .*  ******** * ************

651. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP022193 (Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcttcttcgccgccgccggggacgccgcct	Protospacer
.* .*   *********.***********

652. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP045303 (Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagcgccgccgccagggcgctcatcc	Protospacer
******* *************   .*..*

653. spacer 2.3|471987|30|NZ_CP019882|CRT matches to MT952005 (Aeromonas phage BUCT551, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagtgccgccgccagggagacccagg	Protospacer
 ****** ************** .**   .

654. spacer 2.3|471987|30|NZ_CP019882|CRT matches to KF692088 (Arthrobacter phage vB_ArS-ArV2, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagagccgccgccagggctgtcaggg	Protospacer
*******.************* .*.*.  .

655. spacer 2.3|471987|30|NZ_CP019882|CRT matches to MG757153 (Streptomyces phage BillNye, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagagccgccgccagggcaattacga	Protospacer
*******.*************  ....* *

656. spacer 2.3|471987|30|NZ_CP019882|CRT matches to MK620896 (Streptomyces phage Circinus, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagagccgccgccagggcaattacga	Protospacer
*******.*************  ....* *

657. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ggccgatcgccgccgccacggacgccgcct	Protospacer
   * *  ********** **********

658. spacer 2.5|472071|30|NZ_CP019882|CRT matches to MN304817 (Phage 68_12, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ctgccagggacgctgccagggacgctctgc	Protospacer
*.******* ***.***********. .

659. spacer 2.5|472071|30|NZ_CP019882|CRT matches to JX676771 (Pseudomonas phage AF, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cagccagggacgcagccagggacgcgcagg	Protospacer
* ******* *** ***********    .

660. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
cgatcagggctgccgccagggaggccgagc	Protospacer
* ..******.*********** ****

661. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP024924 (Sphingomonas sp. Cra20 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagtgccgccgccagggttgctttgg	Protospacer
******* ************* .**. . .

662. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agctctcggccgccggccgggacgccgcca	Protospacer
   .*  ******** * ************

663. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP022193 (Yangia pacifica strain YSBP01 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
tcttcttcgccgccgccggggacgccgcct	Protospacer
.* .*   *********.***********

664. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP045303 (Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagcgccgccgccagggcgctcatcc	Protospacer
******* *************   .*..*

665. spacer 2.5|472071|30|NZ_CP019882|CRT matches to MT952005 (Aeromonas phage BUCT551, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
gcgccagtgccgccgccagggagacccagg	Protospacer
 ****** ************** .**   .

666. spacer 2.5|472071|30|NZ_CP019882|CRT matches to KF692088 (Arthrobacter phage vB_ArS-ArV2, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagagccgccgccagggctgtcaggg	Protospacer
*******.************* .*.*.  .

667. spacer 2.5|472071|30|NZ_CP019882|CRT matches to MG757153 (Streptomyces phage BillNye, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagagccgccgccagggcaattacga	Protospacer
*******.*************  ....* *

668. spacer 2.5|472071|30|NZ_CP019882|CRT matches to MK620896 (Streptomyces phage Circinus, complete genome) position: , mismatch: 8, identity: 0.733

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccgccagagccgccgccagggcaattacga	Protospacer
*******.*************  ....* *

669. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to AM261282 (Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

670. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP050076 (Enterobacter kobei strain 070 plasmid p070_B, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

671. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP050069 (Klebsiella aerogenes strain 035 plasmid p035_A-VIM-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

672. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to LC486677 (Serratia marcescens MRY16-414SMA plasmid pMRY16-414SMA_2 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

673. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_KP873171 (Pseudomonas aeruginosa PAO1 plasmid pAMBL2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

674. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP041355 (Pseudomonas aeruginosa strain AZPAE15042 plasmid pIHMA87, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

675. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_022242 (Achromobacter xylosoxidans subsp. denitrificans pAX22 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

676. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_010891 (Pseudomonas sp. CT14 plasmid pCT14, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

677. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP039694 (Agrobacterium larrymoorei strain CFBP5473 plasmid pTiCFBP5473, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
tcgcggtgatcgcgctcgcgccgctggtcg	Protospacer
.  ** ******************.* . *

678. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_007100 (Pseudomonas aeruginosa plasmid Rms149, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

679. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP023287 (Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pP2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

680. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP045203 (Citrobacter sp. NMI7904_11 plasmid pCTEL-2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

681. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to LC155906 (Achromobacter xylosoxidans plasmid pKUN4507_1 DNA, complete sequence, strain: KUN4507) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

682. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP032870 (Pseudomonas syringae pv. actinidiae strain P220 plasmid pLKQG722, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

683. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP018860 (Xanthomonas citri pv. citri strain LH201 plasmid pLH201.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

684. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP018852 (Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

685. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to JQ432564 (Uncultured bacterium plasmid pKS208, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

686. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP028340 (Thauera aromatica K172 plasmid pKJK172, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

687. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to CP022269 (Xanthomonas citri pv. vignicola strain CFBP7112 plasmid plB, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

688. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to KX889311 (Pseudomonas aeruginosa plasmid pJB12, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

689. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP015139 (Escherichia coli strain Ecol_732 plasmid pEC732_IMP14, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

690. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_019906 (Pseudomonas putida HB3267 plasmid pPC9, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

691. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to KC964605 (Uncultured bacterium plasmid pMLUA1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

692. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to KC964606 (Uncultured bacterium plasmid pMLUA3, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

693. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to KC964607 (Uncultured bacterium plasmid pMLUA4, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

694. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MN366356 (Bacterium plasmid pALTS27, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

695. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MN366360 (Bacterium plasmid pALTS32, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

696. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP032176 (Klebsiella pneumoniae strain AR_0135 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

697. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP026703 (Serratia marcescens strain AR_0027 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

698. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_LT985210 (Pseudomonas syringae pv. cerasicola strain CFBP 6110 plasmid PP1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

699. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MK047609 (Pseudomonas aeruginosa strain 121156 plasmid pNECK1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

700. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MK671725 (Pseudomonas mosselii strain AM/94 plasmid pMOS94, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

701. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MK671726 (Pseudomonas mendocina strain 57 plasmid pAER57, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

702. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP018734 (Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.3, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgtcgccgtgcc	Protospacer
*   ********** *****.******

703. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MH061177 (Pseudomonas fluorescens strain P69 plasmid pG69, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

704. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MK047610 (Pseudomonas aeruginosa strain 163940 plasmid pTROUS1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

705. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MG228427 (Kluyvera cryocrescens strain BO64W plasmid pKC-BO-N1-VIM, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

706. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MF344579 (Pseudomonas aeruginosa strain 60512 plasmid p60512-NR, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

707. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MF564290 (Pseudomonas putida strain KSS435 plasmid pVIM_Pse-KSS435, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

708. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_AP013064 (Serratia marcescens SM39 plasmid pSMC1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

709. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MH910042 (Mycobacterium phage Scarlett, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
cgccggtgatctcgctcgcgccggtcacgc	Protospacer
***** ***** *********** .  *.

710. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_021780 (Salmonella phage FSL SP-088, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctatgtcgatcgcgcttgcgccgccgttga	Protospacer
*  .**.*********.**********...

711. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MH791396 (UNVERIFIED: Salmonella phage SeZq-1, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctatgtcgatcgcgcttgcgccgccgttga	Protospacer
*  .**.*********.**********...

712. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MH791395 (UNVERIFIED: Salmonella phage SeWh-1, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctatgtcgatcgcgcttgcgccgccgttga	Protospacer
*  .**.*********.**********...

713. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MH910039 (Mycobacterium phage Oscar, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
cgccggtgatctcgctcgcgccggtcacgc	Protospacer
***** ***** *********** .  *.

714. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MK376955 (Mycobacterium phage KiSi, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
cgccggtgatctcgctcgcgccggtcacgc	Protospacer
***** ***** *********** .  *.

715. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MN783744 (Klebsiella oxytoca plasmid pFDL-VIM, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

716. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_KX009060 (Pseudomonas syringae pv. actinidiae strain RT594 plasmid pUR_RT594, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

717. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_KP099552 (Enterobacter cloacae strain A56 plasmid pA56, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

718. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP032632 (Pseudomonas syringae pv. actinidiae str. Shaanxi_M228 plasmid pM228, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

719. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP015372 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

720. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP011973 (Pseudomonas syringae pv. actinidiae ICMP 18884 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

721. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
gcgcgttgatcgcgctggcggcgccgacca	Protospacer
   ************* *** ***** * .

722. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_016053 (Xanthomonas arboricola pv. pruni str. CFBP 5530 plasmid pXap41, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

723. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP018849 (Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

724. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP052872 (Enterobacter cloacae strain 3849 plasmid p3846_IncN_VIM-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

725. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_021622 (Klebsiella pneumoniae plasmid pK45-67VIM complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

726. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_003921 (Xanthomonas citri pv. citri str. 306 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

727. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP012180 (Pseudomonas syringae pv. actinidiae ICMP 18708 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

728. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP024031 (Xanthomonas citri pv. citri strain Xcc49 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

729. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP006855 (Xanthomonas citri subsp. citri A306 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

730. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_014208 (Klebsiella oxytoca KOX105 plasmid pKOX105, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

731. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP048041 (Alcaligenes faecalis strain MUB14 plasmid pMUB-AF14-2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

732. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP009011 (Xanthomonas citri pv. citri strain JX4 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

733. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP008996 (Xanthomonas citri pv. citri strain MN12 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

734. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP013665 (Xanthomonas citri pv. citri strain jx-6 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

735. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP008999 (Xanthomonas citri pv. citri strain MN11 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

736. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP024032 (Xanthomonas citri pv. citri strain Xcc29-1 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

737. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to CP030168 (Xanthomonas citri pv. punicae strain LMG7504 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

738. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP019733 (Pseudomonas syringae pv. actinidiae strain CRAFRU 14.08 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

739. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MN783743 (Escherichia coli plasmid pGA_VIM, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

740. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to MN783743 (Escherichia coli plasmid pGA_VIM, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

741. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_020452 (Pseudomonas aeruginosa strain COL-1 plasmid pNOR-2000, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

742. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP009026 (Xanthomonas citri pv. citri strain 5208 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

743. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP009014 (Xanthomonas citri pv. citri strain GD3 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

744. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_020801 (Xanthomonas axonopodis Xac29-1 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

745. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP017010 (Pseudomonas syringae pv. actinidiae strain NZ-47 plasmid pPsa22180a, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

746. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP017008 (Pseudomonas syringae pv. actinidiae strain ICMP 20586 plasmid pPsa20586, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

747. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP008993 (Xanthomonas citri pv. citri strain NT17 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

748. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP009008 (Xanthomonas citri pv. citri strain JX5 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

749. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP009002 (Xanthomonas citri pv. citri strain MN10 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

750. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to JQ004406 (Uncultured bacterium plasmid pHH128, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

751. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to JQ004407 (Uncultured bacterium plasmid pHH3408, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

752. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to JQ004408 (Uncultured bacterium plasmid pHH3414, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

753. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to JQ004409 (Uncultured bacterium plasmid pKS77, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

754. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP008987 (Xanthomonas citri pv. citri strain UI7 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

755. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP009005 (Xanthomonas citri pv. citri strain MF20 plasmid pXAC33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

756. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MH220284 (Aeromonas sp. pRIVM0001_VIM-1 plasmid pRIVM0001_VIM-1_171012_B12, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

757. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MN366361 (Bacterium plasmid pALTS33, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

758. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_LT963392 (Pseudomonas syringae pv. cerasicola isolate CFBP6109 plasmid PP1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

759. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_CP019731 (Pseudomonas syringae pv. actinidiae strain CRAFRU 12.29 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

760. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_021087 (Enterobacter cloacae strain M15 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

761. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MF141039 (Pseudomonas aeruginosa strain PAcoop101 plasmid pCOOP-101, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

762. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NZ_MF344578 (Pseudomonas aeruginosa strain 60512 plasmid p60512-IMP, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ccgagttgatcgcggtcgcgctgccgtgcc	Protospacer
*   ********** ******.*****

763. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to LR026998 (unidentified phage genome assembly, chromosome: 1) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctatgtcgatcgcgcttgcgccgccgttga	Protospacer
*  .**.*********.**********...

764. spacer 3.1|1736690|30|NZ_CP019882|CRT matches to NC_048666 (Salmonella phage YSD1 strain YSD1_PHAGE genome assembly) position: , mismatch: 8, identity: 0.733

cgccgttgatcgcgctcgcgccgccgtcag	CRISPR spacer
ctatgtcgatcgcgcttgcgccgccgttga	Protospacer
*  .**.*********.**********...

765. spacer 3.3|1736783|30|NZ_CP019882|CRT matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 8, identity: 0.733

cgcctgctccaccgctgatggcgccgaagc	CRISPR spacer
gggaggctccaccgcagatggcgccgtccc	Protospacer
 *   ********** **********   *

766. spacer 3.7|1737026|33|NZ_CP019882|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.758

cgccgttgccgcccgctccggtgccggaagcgc	CRISPR spacer
caccgccgccgcccgctccggtgccgggccgga	Protospacer
*.***..********************.   *

767. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

768. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
cagccaggtcgccgttgcccgccagcgtgccgccggtgt	Protospacer
*. ***  .************* * *************.

769. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

770. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

771. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccgttgcccgccagcgtgccgccggtgt	Protospacer
.* ***. .************* * *************.

772. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
cagccaggtcgccgttgcccgccagcgtgccgccggtgt	Protospacer
*. ***  .************* * *************.

773. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgccagcgtgccgccggtgt	Protospacer
.* ***  .************* * *************.

774. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

775. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

776. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

777. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

778. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

779. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

780. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

781. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccaggtcgccgttgcccgccagcgtgccgccggtgt	Protospacer
.* ***  .************* * *************.

782. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

783. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

784. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.795

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
tggccatgtcgccattgcccgcgagcgtgccgccggtgt	Protospacer
.* ***. .****.********** *************.

785. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP045329 (Labrenzia sp. THAF191b plasmid pTHAF191b_a, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccgttgccgacggtttcgacgctccgct	Protospacer
*********** ***** ******.   ..

786. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP045345 (Labrenzia sp. THAF187b plasmid pTHAF187b_a, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccgttgccgacggtttcgacgctccgct	Protospacer
*********** ***** ******.   ..

787. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP045335 (Labrenzia sp. THAF191a plasmid pTHAF191a_b, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccgttgccgacggtttcgacgctccgct	Protospacer
*********** ***** ******.   ..

788. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP019631 (Labrenzia aggregata strain RMAR6-6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cgccgttgccgacggtttcgacgctccgct	Protospacer
*********** ***** ******.   ..

789. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP042825 (Rhizobium sp. WL3 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tccatcagccgcctgttgccacgccggctc	Protospacer
. *  . ****** ***** **********

790. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
ggtaaacgccgcaggttgcgacgcctgctc	Protospacer
 *. . .***** ************ ****

791. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP028965 (Burkholderia sp. IDO3 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
acgcgatgcggccggttgcgacgccgcgcc	Protospacer
   ** *** ****************  .*

792. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cctcgttgccgccgcctgcgacgccgcgaa	Protospacer
* .*********** .**********

793. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP039641 (Azospirillum sp. TSH100 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
tgtcgttgccgccgttggcgacgccgcggg	Protospacer
.*.*********** * *********

794. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MT684597 (Mycobacterium phage Mandlovu, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggttgcgccggtaccgt	Protospacer
*.****************** ** .. * .

795. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MT684593 (Mycobacterium phage Moonbeam, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggttgcgccggtaccgt	Protospacer
*.****************** ** .. * .

796. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MF668270 (Mycobacterium phage Emma, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggttgcgccggtaccgt	Protospacer
*.****************** ** .. * .

797. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MN586004 (Mycobacterium phage Strokeseat, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggttgcgccggtaccgt	Protospacer
*.****************** ** .. * .

798. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MT684601 (Mycobacterium phage Hlubikazi, complete genome) position: , mismatch: 8, identity: 0.733

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
caccgttgccgccggttgcgccggtaccgt	Protospacer
*.****************** ** .. * .

799. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032326 (Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gaggcgccgtgcccgccgccgtgctcgcct	Protospacer
 .  *** ***************** ** .

800. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gacccgccgtgcccgccgccgtggtgagat	Protospacer
 .***** *************** **. ..

801. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gacccgccgtgcccgccgccgtggtgagat	Protospacer
 .***** *************** **. ..

802. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gacccgccgtgcccgccgccgtggtgagat	Protospacer
 .***** *************** **. ..

803. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
ccaccgcgatgcccgccgccgtgccacggt	Protospacer
*  *****.***************..  *.

804. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
ccgacgaggtgctcgccgccgtgctggaca	Protospacer
*   ** *****.**************

805. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tcttcgacgtgccggccgccgtgctggcgg	Protospacer
. ..**  ***** ***************

806. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to MH834619 (Arthrobacter phage Maureen, complete genome) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tggtagttgtgcccgccgacgtgctggcgg	Protospacer
.* . *. ********** **********

807. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to MN234196 (Gordonia phage CloverMinnie, complete genome) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tcgcggcggtgaccgccgtcgtgctggcct	Protospacer
.  * ****** ******.********* .

808. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NC_048115 (Arthrobacter phage Liebe, complete genome) position: , mismatch: 8, identity: 0.733

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
tggtagttgtgcccgccgacgtgctggcgg	Protospacer
.* . *. ********** **********

809. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP015233 (Epibacterium mobile F1926 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
ttggattgaccgtggcattcacggcatcgg	Protospacer
.   .***** **************.***

810. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP046282 (Salmonella enterica strain FDAARGOS_687 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

811. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP035302 (Salmonella enterica subsp. enterica strain ST1539 plasmid pST1539, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

812. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022965 (Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

813. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040569 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-8290 plasmid pCFSAN059542, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

814. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_007208 (Salmonella enterica OU7025 plasmid pOU1113, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

815. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_HG970001 (Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 plasmid pSG, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

816. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP037876 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S3, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

817. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP020923 (Salmonella enterica subsp. enterica strain 16A242 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

818. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039577 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

819. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034480 (Salmonella enterica subsp. enterica serovar Typhimurium strain 14028 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

820. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP030198 (Salmonella enterica strain SA20051401 plasmid pSA20051401.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

821. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP050746 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

822. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP053871 (Salmonella enterica subsp. enterica serovar Typhimurium strain SS2017 plasmid pSS2017-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

823. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP053866 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

824. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP041006 (Salmonella enterica strain FDAARGOS_768 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

825. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022137 (Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

826. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029594 (Salmonella enterica strain DA34827 plasmid pDA34827-94, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

827. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP051287 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Gull_ST-29 plasmid pST29-94038, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

828. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034720 (Salmonella enterica subsp. enterica serovar Typhimurium strain RSE04 plasmid pRSE04, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

829. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029596 (Salmonella enterica strain DA34833 plasmid pDA34833-94, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

830. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP051277 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Sparrow_ST-87 plasmid pST87-92921, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

831. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LS997974 (Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pSLT-BT) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

832. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP044959 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

833. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029838 (Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093B, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

834. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019108 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

835. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019109 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

836. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019112 (Salmonella enterica subsp. enterica serovar Pullorum plasmid pSPUV, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

837. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018634 (Salmonella enterica subsp. enterica serovar Enteritidis strain 49-2444 plasmid pSE49-2444, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

838. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022071 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

839. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP012348 (Salmonella enterica subsp. enterica serovar Pullorum str. ATCC 9120 plasmid pCFSAN000725_01, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

840. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP029841 (Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

841. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP027413 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

842. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP027409 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

843. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP018658 (Salmonella enterica subsp. enterica serovar Enteritidis strain 92-0392 plasmid pSE92-0392, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

844. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP028200 (Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN018746 plasmid pGMI14-001, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

845. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_021155 (Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

846. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP028319 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067216 plasmid pSC-09-1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

847. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP045950 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_01, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

848. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017620 (Salmonella enterica subsp. enterica serovar Typhimurium strain 22792 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

849. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

850. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017618 (Salmonella enterica subsp. enterica serovar Typhimurium strain 22495 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

851. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014980 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC H2662 plasmid pSTY1-H2662, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

852. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014970 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1808 isolate ST1126-1 plasmid pSTY1-1808, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

853. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014968 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-1702 plasmid pSTY1-2011K-1702, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

854. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP037873 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS014854 plasmid pPNCS014854_S1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

855. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040669 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20082869 plasmid pSA20082869.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

856. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014973 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY2-1898, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

857. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP038435 (Salmonella enterica subsp. enterica serovar Typhimurium strain E40V plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

858. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014976 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2009K-1640 plasmid pSTY1-2009K-1640, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

859. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_017054 (Salmonella enterica subsp. enterica serovar Typhimurium str. 798 plasmid p798_93, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

860. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP047324 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM13672 plasmid pRM13672, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

861. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014537 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO3 isolate SOHS 02-68 plasmid pSO3_STV, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

862. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_022570 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 unnamed plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

863. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039560 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

864. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039586 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014859 plasmid p11-0225.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

865. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LN999012 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 plasmid pSLT, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

866. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP038433 (Salmonella enterica subsp. enterica serovar Typhimurium strain E40 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

867. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP016390 (Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pSLT931, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

868. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP025556 (Salmonella enterica subsp. enterica serovar Typhimurium strain PIR00538 plasmid pPIR00538, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

869. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039855 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014864 plasmid p11-0972.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

870. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP022118 (Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaatatgaaac	Protospacer
***** ***************  ..*  .*

871. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP034231 (Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 plasmid pATCC14028, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

872. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_014476 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

873. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP017729 (Salmonella enterica subsp. enterica serovar Typhimurium str. SARA13 plasmid pSARA13, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

874. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP008745 (Salmonella enterica subsp. enterica serovar Typhimurium strain VNP20009 plasmid pSLT_VNP20009, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

875. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP007582 (Salmonella enterica subsp. enterica serovar Typhimurium strain 138736 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

876. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039566 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014849 plasmid p08-7727.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

877. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP030176 (Salmonella enterica subsp. enterica serovar Milwaukee str. SA19950795 plasmid pIncFII.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

878. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_013437 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

879. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_019001 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

880. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP051281 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-99574.1A, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

881. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_AP014566 (Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

882. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to LN794247 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSBLT, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

883. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP041974 (Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

884. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039580 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014857 plasmid p10-3881.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

885. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039583 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014858 plasmid p10-8609.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

886. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP044969 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS007087.2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

887. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039596 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014865 plasmid p12-4331.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

888. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039592 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014862 plasmid p11-0500.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

889. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP039568 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014850 plasmid p08-8136.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

890. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP014577 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM9437 plasmid pRM9437, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

891. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP013721 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM10607 plasmid pRM10607, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

892. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_016864 (Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 plasmid pSTUK-100, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

893. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP020113 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

894. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014962 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 plasmid pSTY1-1899, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

895. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to CP053407 (Salmonella enterica strain 87-0091 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

896. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_016861 (Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_L, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

897. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP021464 (Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

898. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014050 (Salmonella enterica strain FDAARGOS_94 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

899. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP038848 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014851 plasmid p09-0499.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

900. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP050736 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

901. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040565 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-7699 plasmid pCFSAN059544, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

902. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_003277 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 plasmid pSLT, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

903. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP051268 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Hawk_ST-33 plasmid pST33-93798, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

904. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NC_016855 (Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

905. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_LT855377 (Salmonella enterica subsp. enterica serovar Typhimurium isolate STMU2UK plasmid 2) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

906. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014359 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU15 plasmid pYU15_94, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

907. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP015158 (Salmonella enterica subsp. enterica serovar Typhimurium strain NC983 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

908. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP014357 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO2 isolate SOHS 02-20 plasmid pSO2_STV, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

909. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP012698 (Microbacterium sp. No. 7 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
acgggacgacggtggcattcagggcgtagc	Protospacer
    * .************** ***** **

910. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP023469 (Salmonella enterica subsp. enterica strain BAA-1586 plasmid pSalMiami, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

911. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP050741 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-2, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

912. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040901 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP18-6199 plasmid pCFSAN074387, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

913. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP040322 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014879 plasmid p16-6397.1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

914. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP015599 (Salmonella enterica strain FORC_030 plasmid pFORC_030, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

915. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP026701 (Salmonella enterica subsp. enterica serovar Typhimurium strain AR_0031 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

916. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to KX777254 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTV-Mu1, complete sequence) position: , mismatch: 8, identity: 0.733

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
cgccggtgacggtggcattcaacatgaaac	Protospacer
***** ***************  ..*  .*

917. spacer 1.5|244719|34|NZ_CP019882|CRT matches to MT522006 (Gordonia phage BBQValindra, complete genome) position: , mismatch: 9, identity: 0.735

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
cgcgcgcggaaacgccggcgtcgagggcagagac	Protospacer
*. * ****.**********.********  *.

918. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 9, identity: 0.735

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
caagggcgggaaggccgtcgccgacgtctttccg	Protospacer
************ **** ****** * * .*  .

919. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 9, identity: 0.7

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ggggtgtcgccgccgccggggacgccgccc	Protospacer
  * ..  *********.***********

920. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 9, identity: 0.7

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccggcagggccgccgccagggcgagtgtgg	Protospacer
*** *****************  . .*. .

921. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 9, identity: 0.7

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccggcagggccgccgccagggcgagtgtgg	Protospacer
*** *****************  . .*. .

922. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 9, identity: 0.7

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ggggtgtcgccgccgccggggacgccgccc	Protospacer
  * ..  *********.***********

923. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP015882 (Ensifer adhaerens strain Casida A plasmid pCasidaAB, complete sequence) position: , mismatch: 9, identity: 0.7

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccggcagggccgccgccagggcgagtgtgg	Protospacer
*** *****************  . .*. .

924. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 9, identity: 0.7

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
ccggcagggccgccgccagggcgagtgtgg	Protospacer
*** *****************  . .*. .

925. spacer 3.7|1737026|33|NZ_CP019882|CRT matches to NZ_CP023550 (Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

cgccgttgccgcccgctccggtgccggaagcgc	CRISPR spacer
gggccgtgccacccgctcaggtgccggaagtct	Protospacer
 * *  ****.******* ***********. .

926. spacer 3.7|1737026|33|NZ_CP019882|CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.727

cgccgttgccgcccgctccggtgccggaagcgc	CRISPR spacer
cgccgttgccgcccgcgccggggcgaagggcag	Protospacer
**************** **** ** ....**.

927. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 9, identity: 0.7

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
cattaccgccgccgattgcgacgccggcat	Protospacer
*......*******.************* .

928. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 9, identity: 0.7

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
gcaaaccgccgccggttacgatgccggctc	Protospacer
    ...**********.***.********

929. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to KR997929 (Mycobacterium phage Barriga, complete genome) position: , mismatch: 9, identity: 0.7

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
taccgttgccgccggttgcgccggtaccgt	Protospacer
..****************** ** .. * .

930. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to MH576971 (Mycobacterium phage Arlo, complete genome) position: , mismatch: 9, identity: 0.7

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
taccgttgccgccggttgcgccggtaccgt	Protospacer
..****************** ** .. * .

931. spacer 3.9|1737134|30|NZ_CP019882|CRT matches to NC_028815 (Mycobacterium phage Nhonho, complete genome) position: , mismatch: 9, identity: 0.7

cgccgttgccgccggttgcgacgccggctc	CRISPR spacer
taccgttgccgccggttgcgccggtaccgt	Protospacer
..****************** ** .. * .

932. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.7

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
cgcccgccgtgcccgccgccgccccccact	Protospacer
******* *************. *.    .

933. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.7

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
acgacgcgctgctcgccgccgtgctggtca	Protospacer
    **** ***.**************.

934. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP035035 (Pantoea ananatis strain NN08200 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
aagcgacggtgcccgccgccgcgctggaaa	Protospacer
 . * .***************.***** .

935. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP011869 (Pseudonocardia sp. HH130629-09 plasmid pLS1-1, complete sequence) position: , mismatch: 9, identity: 0.7

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
acagcgccgtgcccgccgccgtgctccggg	Protospacer
    *** *****************   *

936. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP045356 (Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence) position: , mismatch: 9, identity: 0.7

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
tttggttgacgatggcattcacggcctgag	Protospacer
. . *******.************* * .

937. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP046163 (Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence) position: , mismatch: 9, identity: 0.7

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
tttggttgacgatggcattcacggcctgag	Protospacer
. . *******.************* * .

938. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP046066 (Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence) position: , mismatch: 9, identity: 0.7

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
tttggttgacgatggcattcacggcctgag	Protospacer
. . *******.************* * .

939. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to MG962366 (Rhodococcus phage Finch, complete genome) position: , mismatch: 9, identity: 0.7

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
acagaccgacggtggcattctcggcgtggc	Protospacer
    ...************* ****** **

940. spacer 1.3|244617|37|NZ_CP019882|CRT matches to NZ_CP040822 (Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence) position: , mismatch: 10, identity: 0.73

tgcgggcggcaacgcgggcgtgaacgccgggccggac	CRISPR spacer
cctgtgcggcgacgcgggcgagaacgccgggctcacc	Protospacer
. .* *****.********* ***********. . *

941. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 10, identity: 0.706

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
ggccggcgggaatgccggcgacgagggcgacggc	Protospacer
 .  ********.******* *******. .**

942. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
atcgaacgggaacacctgcgccgagggcaccgcc	Protospacer
   *..*******.** *************.*

943. spacer 1.5|244719|34|NZ_CP019882|CRT matches to GQ919031 (Streptomyces phage ZL12, complete genome) position: , mismatch: 10, identity: 0.706

caagggcgggaacgccggcgccgagggcactgga----	CRISPR spacer
ggaggccgggaacaccggcgccgagg----cagactac	Protospacer
 .*** *******.************    ..**

944. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 10, identity: 0.706

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
ggccggcgggaatgccggcgacgagggcgacggc	Protospacer
 .  ********.******* *******. .**

945. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 10, identity: 0.706

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
gtggcgcgggaacgccggcgccgcaggcagcgtc	Protospacer
  .* ****************** .**** .*

946. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 10, identity: 0.667

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaagcgggccgccgccatggacgccgggc	Protospacer
  .   ************ ********

947. spacer 2.3|471987|30|NZ_CP019882|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 10, identity: 0.667

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaagcgggccgccgccatggacgccgggc	Protospacer
  .   ************ ********

948. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 10, identity: 0.667

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaagcgggccgccgccatggacgccgggc	Protospacer
  .   ************ ********

949. spacer 2.5|472071|30|NZ_CP019882|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 10, identity: 0.667

ccgccagggccgccgccagggacgccgcca	CRISPR spacer
agaagcgggccgccgccatggacgccgggc	Protospacer
  .   ************ ********

950. spacer 3.13|1737359|30|NZ_CP019882|CRT matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.667

cgcccgcggtgcccgccgccgtgctggcgc	CRISPR spacer
gccccgccgtgcccgccgccgtgtccagat	Protospacer
  ***** ***************.. . ..

951. spacer 3.17|1737551|30|NZ_CP019882|CRT matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 10, identity: 0.667

cgccgttgacggtggcattcacggcgtcgc	CRISPR spacer
tatgaagaacggtggcattctcggcgtcgt	Protospacer
... .  .************ ********.

952. spacer 1.5|244719|34|NZ_CP019882|CRT matches to MN657148 (Polaromonas sp. strain ANT_J29B plasmid pA29BJ2, complete sequence) position: , mismatch: 11, identity: 0.676

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
cggcggctggaacgccggcaccgagggcgagacc	Protospacer
*.. *** ***********.********.  .

953. spacer 2.1|471879|54|NZ_CP019882|CRT matches to NZ_CP025188 (Roseomonas mucosa strain AD2 plasmid p1-AD2, complete sequence) position: , mismatch: 11, identity: 0.796

ccgccggggccgccgccagggccgccgccggggccgccgccagggccgccgccg	CRISPR spacer
ccgctgcctgggccgccggggccgccgccggggacgccgccagggccgccaggg	Protospacer
****.*     ******.*************** ****************.  *

954. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP022220 (Bradyrhizobium guangxiense strain CCBAU 53363 plasmid p53363, complete sequence) position: , mismatch: 11, identity: 0.718

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
ccgacgagtcgcccttgcccgcgatcgtgccgccagtcg	Protospacer
*   *.  .**** ********************.**

955. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP030052 (Bradyrhizobium guangdongense strain CCBAU 51649 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.718

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
ccgacgagtcgcccttgcccgcgatcgtgccgccagtcg	Protospacer
*   *.  .**** ********************.**

956. spacer 3.8|1737077|39|NZ_CP019882|CRT matches to NZ_CP030054 (Bradyrhizobium guangzhouense strain CCBAU 51670 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.718

cgcccactccgccgttgcccgcgatcgtgccgccggtgc	CRISPR spacer
ccgacgagtcgcccttgcccgcgatcgtgccgccagtcg	Protospacer
*   *.  .**** ********************.**

957. spacer 1.5|244719|34|NZ_CP019882|CRT matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 12, identity: 0.647

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
tcgcggcgggaacgtcggcgccgatggccgcctg	Protospacer
. . **********.********* ***  .  .

958. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 12, identity: 0.647

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
ttcaagctggaacgccggcgccgagcgcatcaag	Protospacer
.  ..** ***************** ***.....

959. spacer 1.5|244719|34|NZ_CP019882|CRT matches to NC_021909 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1e, complete sequence) position: , mismatch: 12, identity: 0.647

caagggcgggaacgccggcgccgagggcactgga	CRISPR spacer
ggcaaccggggacgccggcggcgagggcacccag	Protospacer
 . .. ****.********* *********. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

473199 : 487355

Mycobacterium_phage(92.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078017508.1\|473199_473454_+	hypothetical protein	A0A2H4PFT2	Mycobacterium_phage	2.0e-16	50.6
WP_078017509.1\|473647_473899_+	hypothetical protein	NA	NA	NA	NA
WP_078017510.1\|473895_474516_+	hypothetical protein	A0A067XQV3	Caulobacter_phage	3.5e-30	41.7
WP_078017511.1\|474512_474722_+	hypothetical protein	NA	NA	NA	NA
WP_078017512.1\|474714_475155_+	hypothetical protein	A0A2P1N163	Mycobacterium_phage	2.4e-09	35.6
WP_078017513.1\|475087_476083_+	hypothetical protein	A0A218M9M6	Mycobacterium_phage	1.2e-99	58.6
WP_078021727.1\|475911_477090_+	hypothetical protein	A0A0A7RVR2	Mycobacterium_phage	3.4e-122	68.3
WP_078017514.1\|477286_478114_+	hypothetical protein	A0A2L1ISV2	Mycobacterium_phage	9.1e-66	51.4
WP_078021728.1\|478113_478542_+	RusA family crossover junction endodeoxyribonuclease	W0LKB6	Mycobacterium_phage	5.4e-46	73.4
WP_078017515.1\|478538_478793_+	hypothetical protein	NA	NA	NA	NA
WP_078021729.1\|479151_481692_+	DNA methylase N-4	W6ATN1	Mycobacterium_phage	0.0e+00	69.9
WP_078017516.1\|481688_482156_+	ASCH domain-containing protein	A0A2K9VF48	Mycobacterium_phage	1.3e-53	67.5
WP_078017517.1\|482152_482698_+	hypothetical protein	A0A088FAC0	Mycobacterium_phage	3.8e-76	81.9
WP_078017518.1\|482694_483633_+	hypothetical protein	NA	NA	NA	NA
WP_078017519.1\|483632_484094_+	hypothetical protein	NA	NA	NA	NA
WP_078017520.1\|484090_484564_+	hypothetical protein	A0A0F6WE48	Mycobacterium_phage	1.1e-15	61.1
WP_078017521.1\|484710_484926_+	hypothetical protein	NA	NA	NA	NA
WP_078017522.1\|484922_485144_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078017523.1\|485151_485337_+	hypothetical protein	NA	NA	NA	NA
WP_078017524.1\|485333_485783_+	hypothetical protein	NA	NA	NA	NA
WP_078017525.1\|485779_486211_+	WhiB family transcriptional regulator	A0A076G8B1	Mycobacterium_phage	8.8e-12	35.5
WP_078017526.1\|486114_486426_+	helix-turn-helix domain-containing protein	A0A2R4AQF4	Mycobacterium_phage	5.7e-05	41.8
WP_078017527.1\|486425_487355_+	hypothetical protein	A0A076YNI8	Mycobacterium_phage	8.0e-26	64.3

DBSCAN-SWA_2

493006 : 533641

Mycobacterium_phage(86.21%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078017536.1\|493006_494554_+	hypothetical protein	G8I4L0	Mycobacterium_phage	1.3e-177	61.1
WP_078021731.1\|494809_495349_+	hypothetical protein	G8I4L2	Mycobacterium_phage	1.5e-32	48.7
WP_078017537.1\|495345_495753_+	DUF1360 domain-containing protein	G8I4L3	Mycobacterium_phage	9.8e-29	52.7
WP_078021732.1\|495815_497651_+	hypothetical protein	G8I4L4	Mycobacterium_phage	1.4e-159	50.4
WP_078017538.1\|497650_500056_+	hypothetical protein	G8I4L5	Mycobacterium_phage	5.6e-273	62.5
WP_078017539.1\|500058_500238_+	hypothetical protein	NA	NA	NA	NA
WP_078017540.1\|500232_500931_-	hypothetical protein	A0A0K0N7E2	Gordonia_phage	3.9e-41	46.0
WP_078017541.1\|500996_501437_-	hypothetical protein	NA	NA	NA	NA
WP_078017542.1\|503725_504505_+	hypothetical protein	A0A0K1LSU9	Mycobacterium_phage	1.4e-55	48.2
WP_078017543.1\|504525_504930_+	hypothetical protein	G8I4L9	Mycobacterium_phage	3.1e-19	48.3
WP_078017544.1\|506176_506983_+	hypothetical protein	A0A1J0MDY1	Mycobacterium_phage	3.5e-62	48.3
WP_078021733.1\|507036_507519_+	hypothetical protein	G8I4M7	Mycobacterium_phage	3.5e-41	54.3
WP_078017545.1\|507526_507934_+	hypothetical protein	NA	NA	NA	NA
WP_078017546.1\|507923_508331_+	hypothetical protein	G8I4M9	Mycobacterium_phage	5.0e-41	68.0
WP_078017547.1\|508995_513459_+	hypothetical protein	T2A952	Mycobacterium_phage	2.5e-48	46.1
WP_078021734.1\|514036_515038_+	hypothetical protein	G8I4N2	Mycobacterium_phage	2.0e-136	64.8
WP_078017548.1\|515037_516120_+	hypothetical protein	G8I4N3	Mycobacterium_phage	8.8e-93	49.4
WP_078017549.1\|516167_517763_+	hypothetical protein	A0A222ZQ73	Mycobacterium_phage	9.1e-30	30.3
WP_078017550.1\|517776_518112_+	hypothetical protein	A0A222ZKR4	Mycobacterium_phage	7.8e-08	38.6
WP_078021735.1\|518136_518775_+	hypothetical protein	G8I4N9	Mycobacterium_phage	1.8e-77	61.0
WP_078017551.1\|518872_519475_+	hypothetical protein	A0A2R4AN94	Mycobacterium_phage	4.9e-69	66.5
WP_078017552.1\|519471_520803_+	hypothetical protein	G8I4P1	Mycobacterium_phage	9.7e-118	50.5
WP_078017553.1\|520783_521449_+	hypothetical protein	G8I4P2	Mycobacterium_phage	5.5e-37	44.2
WP_078021736.1\|521485_521884_+	hypothetical protein	NA	NA	NA	NA
WP_078017554.1\|521883_522603_+	hypothetical protein	G8I4P4	Mycobacterium_phage	5.5e-51	52.4
WP_078017555.1\|522635_525110_+	hypothetical protein	A0A142KAY6	Gordonia_phage	2.9e-30	32.6
WP_078017556.1\|527159_527573_+	hypothetical protein	NA	NA	NA	NA
WP_078017557.1\|527572_527893_+	hypothetical protein	M4WNN0	Mycobacterium_phage	1.5e-08	38.8
WP_078017558.1\|527892_528129_+	hypothetical protein	NA	NA	NA	NA
WP_078021737.1\|528158_528539_+	hypothetical protein	A0A2D1G9X1	Mycobacterium_phage	4.8e-30	54.8
WP_078017559.1\|528583_528814_+	hypothetical protein	A0A088FRF2	Mycobacterium_phage	3.7e-17	60.8
WP_078017560.1\|528876_529188_-	hypothetical protein	A0A076GDT8	Mycobacterium_phage	3.4e-13	48.0
WP_078017561.1\|529184_529496_-	DUF732 domain-containing protein	NA	NA	NA	NA
WP_078017562.1\|529656_529914_-	hypothetical protein	NA	NA	NA	NA
WP_078021738.1\|530017_530197_+	hypothetical protein	A0A097EVH1	Mycobacterium_phage	1.2e-20	76.8
WP_078017563.1\|530193_531024_-	hypothetical protein	A0A142KCU7	Gordonia_phage	1.1e-74	51.7
WP_078017564.1\|531344_532667_-	MFS transporter	NA	NA	NA	NA
WP_078017565.1\|532669_533641_-	hydroxyacid dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	6.6e-23	30.5

DBSCAN-SWA_3

1941486 : 2004496

Mycobacterium_phage(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078018603.1\|1941486_1942473_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_078021892.1\|1942662_1942887_+\|transposase	transposase	NA	NA	NA	NA
WP_078021893.1\|1943026_1944217_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_078018604.1\|1944419_1944674_-	hypothetical protein	NA	NA	NA	NA
WP_078018605.1\|1945036_1946242_+	alpha/beta hydrolase	Q854G2	Mycobacterium_phage	9.0e-38	37.6
WP_078018606.1\|1946545_1948030_+	wax ester/triacylglycerol synthase family O-acyltransferase	NA	NA	NA	NA
WP_078018607.1\|1948029_1949658_+	HAD-IB family hydrolase	NA	NA	NA	NA
WP_078018608.1\|1949654_1951991_+	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_078018609.1\|1951974_1953981_+	copper resistance protein CopD	NA	NA	NA	NA
WP_078021894.1\|1954114_1954576_+	hypothetical protein	A0A2I2MPH3	Mycobacterium_phage	3.1e-07	32.0
WP_078021895.1\|1954634_1955807_-	cytochrome P450	NA	NA	NA	NA
WP_078018610.1\|1955963_1956509_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_078018611.1\|1956580_1958254_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	6.6e-47	27.8
WP_078018612.1\|1958307_1963179_+	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_078021896.1\|1963171_1963585_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_078018613.1\|1963581_1964223_+	hypothetical protein	NA	NA	NA	NA
WP_078021897.1\|1964243_1964855_+	DUF1345 domain-containing protein	NA	NA	NA	NA
WP_078018614.1\|1964851_1966405_-	alpha-amylase	NA	NA	NA	NA
WP_078018615.1\|1966401_1966944_-	globin	NA	NA	NA	NA
WP_078018616.1\|1966942_1967575_+	HNH endonuclease	H6WG01	Cyanophage	2.6e-20	36.3
WP_078018617.1\|1967621_1967834_+	hypothetical protein	NA	NA	NA	NA
WP_078018618.1\|1967820_1968300_+	DUF5130 domain-containing protein	NA	NA	NA	NA
WP_078018619.1\|1968300_1968651_-	HNH endonuclease	A0A0K0N676	Gordonia_phage	5.1e-10	42.2
WP_078018620.1\|1968674_1971233_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.3e-43	32.9
WP_078018621.1\|1971256_1971592_-	DUF732 domain-containing protein	NA	NA	NA	NA
WP_078018622.1\|1971854_1972475_+	disulfide bond formation protein DsbA	NA	NA	NA	NA
WP_078018623.1\|1972524_1973934_+	cytosine permease	NA	NA	NA	NA
WP_078018624.1\|1973930_1974380_+	nucleoside deaminase	NA	NA	NA	NA
WP_078018625.1\|1974376_1975330_+	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_078018626.1\|1975285_1976218_-	aldo/keto reductase	NA	NA	NA	NA
WP_078018627.1\|1976298_1976844_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_078018628.1\|1976854_1977334_+	ribose-5-phosphate isomerase	NA	NA	NA	NA
WP_078018629.1\|1977337_1978129_+	Fpg/Nei family DNA glycosylase	A0A1V0CNR6	Kaumoebavirus	7.5e-09	23.7
WP_078018630.1\|1978129_1978462_-	transcriptional regulator	NA	NA	NA	NA
WP_078018631.1\|1978556_1979168_+	dinucleotide-binding enzyme	NA	NA	NA	NA
WP_078018632.1\|1979164_1979497_+	hypothetical protein	NA	NA	NA	NA
WP_078021898.1\|1979493_1980489_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_078018633.1\|1980614_1981337_+	hypothetical protein	NA	NA	NA	NA
WP_078018634.1\|1981383_1983075_+	sodium:proton antiporter	NA	NA	NA	NA
WP_078018635.1\|1983969_1985151_-	esterase	NA	NA	NA	NA
WP_078018636.1\|1985398_1987099_+	phosphoesterase	NA	NA	NA	NA
WP_078018637.1\|1987108_1988449_-	hypothetical protein	NA	NA	NA	NA
WP_078018638.1\|1990670_1990922_+	hypothetical protein	NA	NA	NA	NA
WP_078018639.1\|1990969_1992325_+	hypothetical protein	NA	NA	NA	NA
WP_078018640.1\|1992401_1992875_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_078018641.1\|1992864_1994988_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_078018642.1\|1995007_1995748_-	hypothetical protein	NA	NA	NA	NA
WP_078018643.1\|1995744_1996941_-	hypothetical protein	NA	NA	NA	NA
WP_078018644.1\|1999248_2000694_+	trigger factor	NA	NA	NA	NA
WP_078018645.1\|2000814_2001411_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.2e-40	48.9
WP_078018646.1\|2001415_2002063_+\|protease	ATP-dependent Clp protease proteolytic subunit	NA	NA	NA	NA
WP_078018647.1\|2002050_2002947_-	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_078018648.1\|2003215_2004496_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.6e-141	59.4

DBSCAN-SWA_4

4057737 : 4064223

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078020156.1\|4057737_4059903_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	2.1e-210	52.2
WP_078020157.1\|4059869_4060352_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	S6ANL8	Bacillus_phage	3.3e-07	29.5
WP_078020158.1\|4060378_4060621_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	2.9e-20	62.7
WP_078020159.1\|4061075_4061618_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.7e-10	37.3
WP_078020160.1\|4061706_4062309_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_078022147.1\|4062305_4063352_+	DNA polymerase IV	I6RSM4	Salmonella_phage	2.4e-15	26.7
WP_078020161.1\|4063353_4064223_-	short chain dehydrogenase	W8CYX9	Bacillus_phage	1.4e-08	30.6

DBSCAN-SWA_5

5435031 : 5463906

Mycobacterium_phage(77.27%)

portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078021189.1\|5435031_5435973_-	hypothetical protein	A0A222ZMT9	Mycobacterium_phage	9.8e-40	34.0
WP_078022311.1\|5435986_5437693_-	hypothetical protein	G1D594	Mycobacterium_phage	2.7e-165	51.5
WP_078021190.1\|5437713_5438634_-	hypothetical protein	A0A2P1CGB7	Mycobacterium_phage	1.4e-46	36.4
WP_078021191.1\|5438630_5442533_-	hypothetical protein	A0A097EWI0	Mycobacterium_phage	6.5e-138	37.6
WP_078021192.1\|5442573_5442855_-	hypothetical protein	NA	NA	NA	NA
WP_078021193.1\|5442998_5443613_-	hypothetical protein	NA	NA	NA	NA
WP_078021194.1\|5443717_5444449_-	hypothetical protein	A0A0U4JMB7	Mycobacterium_phage	7.4e-19	31.4
WP_078021195.1\|5444640_5445135_-	hypothetical protein	A0A097EWD5	Mycobacterium_phage	2.9e-27	45.3
WP_078021196.1\|5445131_5445515_-	hypothetical protein	NA	NA	NA	NA
WP_078021197.1\|5445514_5445871_-	hypothetical protein	A0A076G7Q4	Mycobacterium_phage	3.1e-10	34.9
WP_078021198.1\|5445876_5446311_-	hypothetical protein	A0A2P1CG85	Mycobacterium_phage	3.8e-39	61.7
WP_078021199.1\|5446310_5446679_-	hypothetical protein	NA	NA	NA	NA
WP_078021200.1\|5446736_5447690_-	hypothetical protein	A0A097EWC9	Mycobacterium_phage	1.7e-119	70.1
WP_078021201.1\|5447718_5448501_-	hypothetical protein	A0A097EWH6	Mycobacterium_phage	3.0e-34	49.2
WP_078021202.1\|5448582_5448894_-	hypothetical protein	A0A222ZQR2	Mycobacterium_phage	8.0e-07	41.0
WP_078021203.1\|5449044_5450847_-	hypothetical protein	A0A2P1CG55	Mycobacterium_phage	3.1e-66	47.9
WP_078021204.1\|5450827_5452363_-\|portal	phage portal protein	A0A2P1CG44	Mycobacterium_phage	4.1e-168	58.7
WP_078021205.1\|5452385_5454218_-	hypothetical protein	A0A097EWC4	Mycobacterium_phage	1.1e-241	64.0
WP_078022312.1\|5454229_5454580_-	hypothetical protein	NA	NA	NA	NA
WP_078021206.1\|5454866_5455328_-	hypothetical protein	NA	NA	NA	NA
WP_078021207.1\|5455412_5455769_-	hypothetical protein	NA	NA	NA	NA
WP_078021208.1\|5456011_5456635_+	hypothetical protein	A0A0U4J7P6	Gordonia_phage	9.0e-58	52.9
WP_078021209.1\|5456631_5457678_+	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	1.1e-143	68.7
WP_078021210.1\|5457710_5458349_-	hypothetical protein	A0A088FRN2	Mycobacterium_phage	5.3e-29	36.1
WP_078021211.1\|5458345_5458606_-	hypothetical protein	NA	NA	NA	NA
WP_078021212.1\|5458602_5458857_-	hypothetical protein	NA	NA	NA	NA
WP_078021213.1\|5458822_5459656_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078021214.1\|5459652_5460000_-	DUF4326 domain-containing protein	A0A1D8EX70	Mycobacterium_phage	3.2e-20	49.6
WP_078021215.1\|5459999_5460284_-	hypothetical protein	A0A218M9A5	Mycobacterium_phage	2.4e-05	42.3
WP_078022313.1\|5460280_5460508_-	hypothetical protein	NA	NA	NA	NA
WP_078021216.1\|5460533_5460863_-	DUF4031 domain-containing protein	A0A291LA06	Bordetella_phage	7.4e-11	42.4
WP_078021217.1\|5461485_5461857_-	hypothetical protein	NA	NA	NA	NA
WP_078022314.1\|5461894_5462209_-	hypothetical protein	G9FI25	Nocardia_phage	1.5e-21	63.5
WP_078021218.1\|5462268_5462502_-	hypothetical protein	NA	NA	NA	NA
WP_078021219.1\|5462498_5462816_-	hypothetical protein	NA	NA	NA	NA
WP_078021220.1\|5462883_5463906_-	hypothetical protein	A0A1C9EHS9	Gordonia_phage	1.7e-45	40.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019882

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection