CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019401	Planococcus faecalis strain AJ003 chromosome, complete genome	2 crisprs	csa3,WYL,cas3,DinG,DEDDh	1	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019401_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019401_1

451495-451609

Orphan

Consensus_repeat	Method
CATTCATAATTTTCCGGAGGGGATTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019401_1

>merge|NZ_CP019401|1|451495-451609|CRISPRCasFinder
CATTCATAATTTTCCGGAGGGGATTGCCACGTTTATGTCGGCAATACAAGATCCGGCTCTTGGAATCGCTATCGCAATTGCAGTAGCCATTCATAATATTCCGGAGGGGATTGCC

>NZ_CP019401|1|1|451495-451609|CRISPRCasFinder
CATTCATAATTTTCCGGAGGGGATTGCC	ACGTTTATGTCGGCAATACAAGATCCGGCTCTTGGAATCGCTATCGCAATTGCAGTAGC
CATTCATAATATTCCGGAGGGGATTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019401.1\|WP_078080101.1\|461276_462893_+\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|341284
NZ_CP019401.1\|WP_071153502.1\|445540_446497_+\|siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226966
NZ_CP019401.1\|WP_071153512.1\|458073_459222_+\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
NZ_CP019401.1\|WP_078080099.1\|455344_456313_+\|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP019401.1\|WP_071153506.1\|450354_450999_+\|uracil-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381680
NZ_CP019401.1\|WP_071153501.1\|444757_445519_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226963
NZ_CP019401.1\|WP_071153500.1\|443810_444761_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|226964
NZ_CP019401.1\|WP_058386434.1\|460034_461183_+\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173849
NZ_CP019401.1\|WP_058386447.1\|447785_448454_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP019401.1\|WP_078080098.1\|451958_452906_+\|DUF4003-family-protein	unknown	unknown	gnl\|CDD\|379047
NZ_CP019401.1\|WP_071153503.1\|446717_447782_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP019401.1\|WP_071153509.1\|454411_455257_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225928
NZ_CP019401.1\|WP_071153510.1\|456309_456948_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP019401.1\|WP_078080097.1\|442867_443818_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226965
NZ_CP019401.1\|WP_078080096.1\|441721_442585_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019401.1\|WP_071153511.1\|456959_457862_+\|glycine/betaine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270246
NZ_CP019401.1\|WP_071153504.1\|448589_449879_-\|ammonium-transporter	unknown	unknown	gnl\|CDD\|223083
NZ_CP019401.1\|WP_071153505.1\|449891_450233_-\|P-II-family-nitrogen-regulator	unknown	unknown	gnl\|CDD\|223424
NZ_CP019401.1\|WP_071153508.1\|453055_454273_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340874
NZ_CP019401.1\|WP_078080100.1\|459249_460020_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187629

Protein	Function_ID	Function_description	E-value
NZ_CP019401.1\|WP_078080101.1\|461276_462893_+\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|341284	cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles. This family includes fatty acyl-CoA synthetases that can activate medium-chain to long-chain fatty acids. They catalyze the ATP-dependent acylation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The fatty acyl-CoA synthetases are responsible for fatty acid degradation as well as physiological regulation of cellular functions via the production of fatty acyl-CoA esters. The fatty acyl-CoA synthetase from Thermus thermophiles in this family catalyzes the long-chain fatty acid, myristoyl acid, while another member in this family, the AlkK protein identified from Pseudomonas oleovorans, targets medium chain fatty acids. This family also includes uncharacterized FACS proteins.	0
NZ_CP019401.1\|WP_071153502.1\|445540_446497_+\|siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|226966	COG4607, CeuA, ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism].	1.45838e-136
NZ_CP019401.1\|WP_078080099.1\|455344_456313_+\|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.57322e-137
NZ_CP019401.1\|WP_071153506.1\|450354_450999_+\|uracil-DNA-glycosylase	gnl\|CDD\|381680	cd10030, UDG-F4_TTUDGA_SPO1dp_like, Uracil DNA glycosylase family 4, includes Thermotoga maritima TTUDGA, Bacillus phage SPO1 DNA polymerase, and similar proteins. Uracil DNA glycosylase family 4 includes Thermotoga maritima TTUDGA, a robust uracil DNA glycosylase that shares narrow substrate specificity and high catalytic efficiency with family 1, acting on double-stranded and single-stranded uracil-containing DNA. Members of this family possess four conserved cysteine residues required to coordinate the [4Fe-4S] iron-sulfur cluster. This family also includes the N-terminal domain of Bacillus phage SPO1 DNA polymerase. Bacteriophage SPO1 is one of a group of large, lytic, tailed bacteriophages of Bacillus subtilis, and contains hydroxymethyluracil (hmUra) in place of thymine in their DNA. It has been speculated that this UDG domain may help discriminate between hmUra containing SPO1 DNA and thymine-containing host DNA. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other.	2.4219e-61
NZ_CP019401.1\|WP_071153501.1\|444757_445519_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226963	COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism].	3.33863e-146
NZ_CP019401.1\|WP_071153500.1\|443810_444761_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|226964	COG4605, CeuC, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	3.36655e-127
NZ_CP019401.1\|WP_058386434.1\|460034_461183_+\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173849	cd01160, LCAD, Long chain acyl-CoA dehydrogenase. LCAD is an acyl-CoA dehydrogenases (ACAD), which is found in the mitochondria of eukaryotes and in some prokaryotes. It catalyzes the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of LCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. LCAD acts as a homodimer.	6.03902e-165
NZ_CP019401.1\|WP_058386447.1\|447785_448454_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	1.47894e-92
NZ_CP019401.1\|WP_078080098.1\|451958_452906_+\|DUF4003-family-protein	gnl\|CDD\|379047	pfam13170, DUF4003, Protein of unknown function (DUF4003). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 327 and 345 amino acids in length.	1.07034e-43
NZ_CP019401.1\|WP_071153503.1\|446717_447782_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	2.67616e-09
NZ_CP019401.1\|WP_071153509.1\|454411_455257_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225928	COG3393, COG3393, Predicted acetyltransferase [General function prediction only].	7.40587e-15
NZ_CP019401.1\|WP_071153510.1\|456309_456948_+\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	7.44856e-80
NZ_CP019401.1\|WP_078080097.1\|442867_443818_+\|ABC-transporter-permease	gnl\|CDD\|226965	COG4606, CeuB, ABC-type enterochelin transport system, permease component [Inorganic ion transport and metabolism].	2.3347e-145
NZ_CP019401.1\|WP_071153505.1\|449891_450233_-\|P-II-family-nitrogen-regulator	gnl\|CDD\|223424	COG0347, GlnK, Nitrogen regulatory protein PII [Amino acid transport and metabolism].	8.7057e-36
NZ_CP019401.1\|WP_071153511.1\|456959_457862_+\|glycine/betaine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270246	cd13528, PBP2_osmoprotectants, Substrate-binding domain of osmoregulatory ABC-type transporters; the type 2 periplasmic-binding protein fold. This family represents the periplasmic substrate-binding component of ABC transport systems that are involved in uptake of osmoprotectants (also termed compatible solutes) such as betaine, choline, proline betaine, carnitine, and L-proline. To counteract the efflux of water, bacteria and archaea accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.37745e-115
NZ_CP019401.1\|WP_071153504.1\|448589_449879_-\|ammonium-transporter	gnl\|CDD\|223083	COG0004, AmtB, Ammonia permease [Inorganic ion transport and metabolism].	2.55648e-131
NZ_CP019401.1\|WP_071153512.1\|458073_459222_+\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	0
NZ_CP019401.1\|WP_071153508.1\|453055_454273_+\|MFS-transporter	gnl\|CDD\|340874	cd17316, MFS_SV2_like, Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the Major Facilitator Superfamily. This family is composed of metazoan synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters including those that transport inorganic phosphate (Pht), aromatic compounds (PcaK and related proteins), proline/betaine (ProP), alpha-ketoglutarate (KgtP), citrate (CitA), shikimate (ShiA), and cis,cis-muconate (MucK), among others. SV2 is a transporter-like protein that serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. Also included in this family is synaptic vesicle 2 (SV2)-related protein (SVOP) and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. The SV2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.14839e-72
NZ_CP019401.1\|WP_078080100.1\|459249_460020_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.01915e-122

>NZ_CP019401.1|WP_071153506.1|450354_450999_+|uracil-DNA-glycosylase
MYRISEKLAELGMQRIEGFPVEGFVWGSGPENPVIMLVGEAPGENELETGIPFTGRAGKELMASLESVGLAREDVYITSAVRSRPYKWGTKKKRNGETIDRKYNRAPTKKEIIAHAPILDTEIQAVQPPIIVTLGNVGLQRLVGSKAKVTELHGVLMETPILYWNEEESCFKETTEVYHIFPTFHPASVFYNPSVRLLKDADWQKLKELLGGAK
>NZ_CP019401.1|WP_071153505.1|449891_450233_-|P-II-family-nitrogen-regulator
MKKIETIIRSSVFADVRQALALEGIDGLSVTEIAGIGKQEGRVGLFRGNAYTMEFSPKLKLEMVVDDHKVEDIIQALLEYASTGQVGDGKIFIFSVEEAIRIRTKERGTVAIG
>NZ_CP019401.1|WP_071153504.1|448589_449879_-|ammonium-transporter
MEAVQSSVDMIWVMLGAMLVFFMHAGFAMVESGFTRSKNTLNILMKNMITVSLGSILYFIVGYALMFGPSSFGLIGTQGFALTGVEDIGFFVFQAVFAATCATIISGAVAERMNLSAYILLTIAMTAVIYPVVGHWVWGGGWLSQIGFIDFAGSTVVHLTGAVAAFIAAWKIGPRIGKYSGKSVNTIPGHSLPLGALGVFILWLGWFGFNGGSTLAADPTLVPPVIANTLLAASAGIIATAGYTRFRYGRIDASLTMNGALAGLVGITAGAANVSFFGAMMIGLLAGVIMTEAIRLLDSKIRVDDPVGAISVHGIAGIWGTLAVGLFDTTNGLFYGGGTEILGLQAVGVLAVIAWASLSTGIVLFAIGRIVPLRVTAEDEEAGLDFSEHGSQAYSMQDVLHGSPFGRNDSFAQRLNQLGEEPSPQKTIS
>NZ_CP019401.1|WP_058386447.1|447785_448454_+|ABC-transporter-ATP-binding-protein
MAVLELNRVKKSFGTGHKKVDALKETNFQAEQGELIAVIGPSGSGKSTFLTIAGGLLSPTGGDILINDTNISSLNEKQLSKIRLKEIGFILQASNLVPFLTVEKQLKLLDKVKKDNMNKEQLEQLYKDLGIGDLRSKYPSDLSGGERQRVAIAKALYSNPSIILADEPTASLDSDRAYEVMELLKAETKNKKTTTIVVTHDIRLVDYCDKVYKMVDGVLELQ
>NZ_CP019401.1|WP_071153503.1|446717_447782_+|ABC-transporter-permease
MFLAWNEIIKNKLRFTLIIGVLMLVAYLVFFLSGLANGLASLNREAVDKWDADAIVLTEESDQSLTQSSLSIDAVDEIQADETAVLGQLNAIAQTGDLKAGVSIFGINSDEFIMPEVIEGEEFTDANEVIAGDALKDEGFKLGDTLSLSSTKETLKIVGFTDQARFNAAPVLYTTLETLQLVKFGETAENDSQISAIVVRTEDVSATTDENGLATIETETFIESLPGYTEQSLTLNFMIYFLFVISSVIVAIFLYVLTVQKISMFGVMKAQGIPSGYLARSVVAQTAILAAIGVAVGLGLTLFTGAFLPSAVPVAFDIPTMLIYGVVLIAVAILGAVFSVLTIVKIDPLKAIGG
>NZ_CP019401.1|WP_071153502.1|445540_446497_+|siderophore-ABC-transporter-substrate-binding-protein
MKKWIVAAVTLMMVAFLAACGSTEKTTESDTATAESEEMTVTHELGETTFNKNPEKVVVFDFGVLDSMDKLGIEAVAGVPQANIPAYLEKYEDAEKYENVGTLKEADFEAINAMKPDLIIISGRQADMYDEFSEIAPTIHMAVDTEDYMGSFKENMTTLGEIFGKEDQITEELAAIDTKIEEVKETVSGSAEKALIILANEGKVSAYGAASRFGLIHDVFGVKQADEGIEASTHGQSISYEYILETNPDMMFVVDRNAVVGNGTNAADSLENELVQKTNAYQNDKIIYLDPDFWYLSGGGLQSVTQMVTDVQSAFEQN
>NZ_CP019401.1|WP_071153501.1|444757_445519_+|ATP-binding-cassette-domain-containing-protein
MIQVRELTKLYGKKTVVENVTVNIQRGQITSFIGPNGAGKSTLLSMVSRLLDADTGEVLIDSTNTKKLKSNEFSKRVSILKQSNFMNVRLTIRELVSFGRFPYSKGRLNDEDEKMVDQSIDYMDLKEMENSYLDELSGGQRQRAFIAMVIAQDTDYVLLDEPLNNLDMKHSVQIMKILRRLVDDLGKTVVIVLHDINFASVYSDRIVALKNGRVVKDGTTEEIIQSAALKEIYDMDIPIQQMNDCRICVYFNS
>NZ_CP019401.1|WP_071153500.1|443810_444761_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MRDLHKMLILVGLALAACSLYLFQDLNGSFDYALPRRGVKVFAMVLTGVAIAYATVVFQTITHNRILTPSIMGLDSLYMLLQTVLIFFLGSDHVTIVNKQVNFLLSIAVMVIFALLFYRLLFKKNDRPIYFLLLVGIICGTFFGSITTFLQVLIDPNEFSIIQDRMFASFNNVNSDLVWTSLVIITLLIAFAWKQNSSLDVLTLGRDTAINLGVNYDALVKQMLVLSAVLIAVATALVGPITFFGLIVANLSYQFFTSYKHSVLLTGSIVISVVALVSGQWVVERIFTFNTTLSVIINFIGGIYFIYLLLKESRSK
>NZ_CP019401.1|WP_078080097.1|442867_443818_+|ABC-transporter-permease
MKKRYLIPTLIILSIISLFVGVSSISVADLLDFQSEETQIFLISRLPRLVAILLAGAGMSMAGLIMQQLSRNKFVSPTTAGTLDATRLGILVSMLMFANASMLEKMAVAFAFALAGTFLFMQILNRIKFKDAIFIPLVGLMFGNILSSITTFFAYRADVIQNMSAWLQGDFSMVMKGSYELLYISVPVFVIAYLYANRFTVAGMGEDFSKNLGMKYRSVVNIGLVLVALITATVVLTVGVIPFLGLIIPNIVSIFKGDHLQKTLPHTAMLGAIFLLVCDILGRVMIYPYEISISLMVGVIGSFIFLFLLFRRKTYA
>NZ_CP019401.1|WP_078080096.1|441721_442585_+|hypothetical-protein
MKKWILFMSTATLAIGLSACSETAEPASGDETTKGEDSKLTVQEVYEKSVEASEDITSVHADIVTDQTIAMQGDGMEMDMTVSSSMDMTIDPVAFYQKAETSVVSEDIDNSNPMSMEMYFTEQGMYMYEETMATWLKMPDASIEDLKALADQQTANPSQQLEELAEFKDDFTFKQTEAEYILTLDASGEKFNELMDQQLEKTLGQMELEAQMALEDMTIHAVNYVIYVDKESFLTTGIDMKMDMDMNIEDEMMNIKSDMQADYSRFNEIQAITVPAEVVEQAQEIAG
>NZ_CP019401.1|WP_078080098.1|451958_452906_+|DUF4003-family-protein
MDIKRIEQTFLDVSKTTGWAVDKRIALAVTNVYLSQDQAFDAEKHEAAVEVIKKNEGWTSPLRSHLLHVAAAFMVMKEEAVESSLKLANQNQKALNDVGFWKTSYTYLAALLMKKPEEAEQARALYKEMKKHHKFLTSNEDIPYAALLGSREGSLEERAATMNRYYRDLREQGFTMGNNLQWLSQIMTFDSPVYDAKIVGKVLAIHQFFKEEKINISLAQYPILGFLAVTEIDGKALEGVVENTRELEKNKIFRWYKDMAFSTAVQQAMADNIEVRDVATMTFATSLETLMQAQQAAMMVSINAAIISSSNTSSS
>NZ_CP019401.1|WP_071153508.1|453055_454273_+|MFS-transporter
MATIAEKKTGPISRNRLLGIAGLGWLFDAMDVGILAFVIAALHEDWGLTSSQMGWIGSVNSIGMAVGAFVFGIYADRVGRKKIFIITLLLFSIASGISAFATTLAAFMILRFFVGMGLGGELPVASTLVSESVPAKERGRVIVLLESFWAAGWLVAAVISYFIIPSFGWRVALLLTALPAVYALYLRINLPDSPQFSAKKDVLRSISTNIKDVWSEKYRRPTLMLWIVWFTVVFSYYGMFLWLPSVMVLKGFTLIKSFQYVLIMTLAQLPGYFSAAWLIERAGRKFVLVTYLIGTAISALAFGNADTITLLIVSGAFLSFFNLGAWGALYAYSPEQYPTVIRGTGTGMAAAFGRIGGVLGPLLVGTLLTAGANLNVIFGIFCVSILIGALAVAFLGKETKQLELE
>NZ_CP019401.1|WP_071153509.1|454411_455257_+|GNAT-family-N-acetyltransferase
MEMIIYSDSAVFLEKVSPLLYKKEDIHSLFLGVLGQIHANQYEGYFLALVETDDEIVAACLMTPPHALQLIVFQTFPQIEREIVGHLQNLGIEVSGIVGEQTTSRLFAEAWIERTGEQVNILMDQGLYRIEAVNKGLRKSRGSWRIASKKDAIILEEWYRLFEEETGIGRSTQTQISHKIAGFLERKEVYVWEVDERVVSCMQKKRPSKNGITVSFVFTPNAQRRNGYAQTLVAEVTNELLLEYDFVMLYTDLTNPTSNKIYREIGYEQIANPVHLIFVEK
>NZ_CP019401.1|WP_078080099.1|455344_456313_+|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein
MIRFENVTKRFPDGTEALKDISLVLPTNELTAIIGPSGCGKTTLMKMINKLEKPTEGSIFIDEKPINGMDEVQLRRSIGYVIQRIGLFPHMTISDNVALVPKLLDWTKDKKEQRVRELLQLVGLDPEVYMERYPLELSGGQQQRVGVVRALAGDPNIVLMDEPFSALDPISREQLQDELRNLQQTINKTIVFVTHDMDEALKIADSVILMRDGQVEQVGTPQQLIDNPANEFVRSFIGIERINQKRTFGDRKLLEFLDLFTEEWAGDTEEISAEQTIENAFLQLDKSTKNYLAIVQGAQVVAYANDRDLLKAALAKETGATA
>NZ_CP019401.1|WP_071153510.1|456309_456948_+|ABC-transporter-permease
MKNFLDTLVSRQDMIIGALLEHMYLSFVAVAIGIAIALPLGILITRYRRYAESIIGVTAVFQTIPSLALFGFLVPILGIGSPTALIALIIYALLPILRNTYAGIVGVDSSTIEAGRGMGMTRTQILRQIELPLALPFIMAGIRTATVLTVGIATLATFVGAGGLGDIIYRGLQSYNNSLVLAGALPVALLAIGFDQILKWIEKRATPKGLKP
>NZ_CP019401.1|WP_071153511.1|456959_457862_+|glycine/betaine-ABC-transporter-substrate-binding-protein
MKKTTLGVFLAATTVIAGCGSGGDELDPIVIGGKPWTEQYILPHILGQYIEANSDYTVEYEEGLGEVSILTPALEKGDIDMYVEYTGTGMKDVLKKESVPGQSSEEVLDIVRIGYEDTLGATWLEPLGFENGYTLAYSKDSGYDAKTYSDLAEISQSEEMRFGAPHPFYERKGDGYEDLIATYPFKFSATESFDPAIMYEAVKSGEVEVIPAFTTDSRIELFDLETTEDDLSFFPKYDAAPVVRMETLEEYPELEEVLSGLAGQISEEEMLAMNSRIDVDQEIAADVAREFLIDKGLIEE
>NZ_CP019401.1|WP_071153512.1|458073_459222_+|thiolase-family-protein
MREVVIIEGVRSAVGRRKGQFADQRPDELAALVLEELVSRAGVDKSEVEDIILGCVSQAGEQGGNIARTASLIAGFPDYVPGVTIDRQCGSSQQAVHFGAQAILAGDMDIVIAGGVESMTRVPMFSNMQGAALSEKLTDQYEIINQGLSAERIAKKWGFTRQQLDAFAVQSHERAQHAIGAGHYKREIIPIRTQGPDGETRMIDEDEGPRPGTTEEVLAGLKTAFDEKGVITAGNASQMSDGASAVLLMSTDKAKELGLKPKARIVARVVVGSDPTLMLTGPIAATKKVLAKAGLEISEMDRYEVNEAFAPVPLAWLHDIGGDPEKLNVNGGAIALGHPLGATGTKLLVSLLHELERTDGRYGLLAICEGMGMANATIIEKL
>NZ_CP019401.1|WP_078080100.1|459249_460020_+|SDR-family-NAD(P)-dependent-oxidoreductase
MEFSQVKAVVTGGASGLGEATVRRIAKSGGKAAIFDLNAERAKVLIEELGEGSVIYKETDVTNASQVEQNINDTLEQFGGINLVVNCAGIGTPGKVVSKGEPIALDQFEKVIKVNLVGSFNVIRVAAAAMQKNEPTEDGERGVIISTASVAAYEGQIGQAAYSASKGGVVAMTLPIARELARDGIRVMAIAPGLMETPMVEGLPDAAIASLSAAVPFPARLGKPAEFAHLVESITTNSMLNGETIRLDGAIRMQPK
>NZ_CP019401.1|WP_058386434.1|460034_461183_+|acyl-CoA-dehydrogenase-family-protein
MGRYRFEEDEHVMFRKSLRKFLEKEAVPNYDQWEKDRLIPKSFWKKLGDMGFLSPQIEEQYGGLGLDFRYAVVIGEEMERVGASLTGVGLHNDITVPYIEAYGNEEQKQRWLPGCISGDHITAIAMTEPGAGSDLANISTTAVRDGDNYIVNGQKTFITNGINSTLVLVVVKTDPKAQPKHRGISLLMVEEGTPGFQKGRKLDKVGLHAQDTSELYFEDCIVPATNLIGEENKGFTYLMEKLQQERLVVAMAAQVASEDMLEMTLEYVKSRKAFGKPIGSFQNSQFKLVEMATEIELGHSFLESLIEDHMAGKDIVSKVSMAKFWLTDTAKKISGECMQLHGGYGYMEEYKIARRYRDIPVAAIYAGSNEIMKTIVAKRMGL
>NZ_CP019401.1|WP_078080101.1|461276_462893_+|long-chain-fatty-acid--CoA-ligase
MMDSPLLLSSFVKRAERYFPEKLIISRTGENMIHRIPYKEFAVRSRKLAAALTGLGMKRGTKVGSFAWNHHRHLELYFGVPGAGAILHMINIRLSHEHIAYVINHAEDEILVVDHDLFPLIEKLAPMLKSVKHFIIMKDGVDLPETTLGNVYSYEQLLAAEDDSFEFPEDLDENTPAGMCYTSATTGNPKGVVYTHRGLVLHSYALGMSDAMGLSEQDIALSIVPMFHANAWGLPFAGVLFGTTQVLPGPGFAPGMLLDLIESEKVTLTAGVPTIWMGVLKELEANPRNIDTLRMIICGGSASPKGLIRAFEEKYNVPFVTGYGMTETAPLVSLAITTSAMTDMTMDERIERRSMAGLPMPGLEVRIVNENGEAPWDGETMGELNVKGAWIADEYYKDERTEEAFKEGWLYTGDIAVIESDGYIKLMDRTKDLIKSGGEWISSVDLENALMTHEAVFEAAVVAIPHEKWMERPLACVVLKEGHAEDDATKAILLTYLESQFAKWWVPDDVVFLKEVPKTSVGKFLKAALRKELDGYYQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019401_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019401_2

3351089-3351172

Orphan

Consensus_repeat	Method
CGTGCGTATTCTTCCGTTGAACG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019401_2

>merge|NZ_CP019401|2|3351089-3351172|CRISPRCasFinder
CGTGCGTATTCTTCCGTTGAACGTGCGTATCTCCCGCTGAACGTGCGTATCTTCCGCTGACCGTGCGTATTCTTCCGCTGAACG

>NZ_CP019401|2|2|3351089-3351172|CRISPRCasFinder
CGTGCGTATTCTTCCGTTGAACG	TGCGTATCTCCCGCTGAACGTGCGTATCTTCCGCTGAC
CGTGCGTATTCTTCCGCTGAACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019401.1\|WP_071152877.1\|3353039_3354380_-\|gluconate-transporter	unknown	unknown	gnl\|CDD\|182485
NZ_CP019401.1\|WP_071152880.1\|3358923_3359493_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|183450
NZ_CP019401.1\|WP_078080786.1\|3349112_3350783_-\|FAD-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|183782
NZ_CP019401.1\|WP_071152879.1\|3356381_3357311_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP019401.1\|WP_071152870.1\|3343871_3344651_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225375
NZ_CP019401.1\|WP_071152881.1\|3359652_3360246_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP019401.1\|WP_071152878.1\|3355485_3356337_+\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP019401.1\|WP_169793174.1\|3347797_3347950_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019401.1\|WP_071152871.1\|3344660_3345347_-\|peptidase-E	unknown	unknown	gnl\|CDD\|367568
NZ_CP019401.1\|WP_078080787.1\|3351428_3352973_-\|gluconokinase	unknown	unknown	gnl\|CDD\|130381
NZ_CP019401.1\|WP_058383986.1\|3357609_3358836_+\|dicarboxylate/amino-acid:cation-symporter	unknown	unknown	gnl\|CDD\|366058
NZ_CP019401.1\|WP_071152873.1\|3346224_3346770_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP019401.1\|WP_078080785.1\|3348691_3349123_-\|DUF4181-domain-containing-protein	unknown	unknown	gnl\|CDD\|372726
NZ_CP019401.1\|WP_071152874.1\|3346806_3347346_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP019401.1\|WP_071152875.1\|3347981_3348449_-\|DUF4181-domain-containing-protein	unknown	unknown	gnl\|CDD\|372726
NZ_CP019401.1\|WP_071152872.1\|3345431_3346208_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393
NZ_CP019401.1\|WP_071152882.1\|3360239_3361052_-\|protein-phosphatase-2C-domain-containing-protein	unknown	unknown	gnl\|CDD\|379325
NZ_CP019401.1\|WP_058383989.1\|3354474_3355359_-\|decarboxylating-6-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236582
NZ_CP019401.1\|WP_071152883.1\|3361211_3361556_+\|heme-oxygenase	unknown	unknown	gnl\|CDD\|237345
NZ_CP019401.1\|WP_071152869.1\|3343392_3343875_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181

Protein	Function_ID	Function_description	E-value
NZ_CP019401.1\|WP_071152883.1\|3361211_3361556_+\|heme-oxygenase	gnl\|CDD\|237345	PRK13315, PRK13315, heme oxygenase.	1.97298e-42
NZ_CP019401.1\|WP_071152880.1\|3358923_3359493_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|183450	PRK12335, PRK12335, tellurite resistance protein TehB; Provisional.	1.98978e-11
NZ_CP019401.1\|WP_078080786.1\|3349112_3350783_-\|FAD-binding-dehydrogenase	gnl\|CDD\|183782	PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed.	0
NZ_CP019401.1\|WP_071152879.1\|3356381_3357311_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	5.21939e-72
NZ_CP019401.1\|WP_071152870.1\|3343871_3344651_-\|alpha/beta-hydrolase	gnl\|CDD\|225375	COG2819, COG2819, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	6.48521e-30
NZ_CP019401.1\|WP_071152881.1\|3359652_3360246_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	6.04101e-58
NZ_CP019401.1\|WP_071152878.1\|3355485_3356337_+\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.06524e-82
NZ_CP019401.1\|WP_071152871.1\|3344660_3345347_-\|peptidase-E	gnl\|CDD\|367568	pfam03575, Peptidase_S51, Peptidase family S51.	1.03589e-80
NZ_CP019401.1\|WP_078080787.1\|3351428_3352973_-\|gluconokinase	gnl\|CDD\|130381	TIGR01314, gntK_FGGY, gluconate kinase, FGGY type. Gluconate is derived from glucose in two steps. This model describes one form of gluconate kinase, belonging to the FGGY family of carbohydrate kinases. Gluconate kinase phosphoryates gluconate for entry into the Entner-Douderoff pathway. [Energy metabolism, Sugars].	0
NZ_CP019401.1\|WP_058383986.1\|3357609_3358836_+\|dicarboxylate/amino-acid:cation-symporter	gnl\|CDD\|366058	pfam00375, SDF, Sodium:dicarboxylate symporter family.	1.06339e-101
NZ_CP019401.1\|WP_071152873.1\|3346224_3346770_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.15414e-40
NZ_CP019401.1\|WP_071152877.1\|3353039_3354380_-\|gluconate-transporter	gnl\|CDD\|182485	PRK10472, PRK10472, low affinity gluconate transporter; Provisional.	8.27358e-158
NZ_CP019401.1\|WP_078080785.1\|3348691_3349123_-\|DUF4181-domain-containing-protein	gnl\|CDD\|372726	pfam13789, DUF4181, Domain of unknown function (DUF4181).	1.35653e-07
NZ_CP019401.1\|WP_071152874.1\|3346806_3347346_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.92315e-31
NZ_CP019401.1\|WP_071152875.1\|3347981_3348449_-\|DUF4181-domain-containing-protein	gnl\|CDD\|372726	pfam13789, DUF4181, Domain of unknown function (DUF4181).	6.07232e-06
NZ_CP019401.1\|WP_071152872.1\|3345431_3346208_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	0.00474692
NZ_CP019401.1\|WP_071152882.1\|3360239_3361052_-\|protein-phosphatase-2C-domain-containing-protein	gnl\|CDD\|379325	pfam13672, PP2C_2, Protein phosphatase 2C. Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.	5.08883e-16
NZ_CP019401.1\|WP_058383989.1\|3354474_3355359_-\|decarboxylating-6-phosphogluconate-dehydrogenase	gnl\|CDD\|236582	PRK09599, PRK09599, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_CP019401.1\|WP_071152869.1\|3343392_3343875_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.31092e-12

>NZ_CP019401.1|WP_078080786.1|3349112_3350783_-|FAD-binding-dehydrogenase
MEPSAIVVGAGLAGLVAAAEIADAGKKVLLLDQEPAASFGGQAWWSFGGLFLVDSPEQRRMGINDSKELAWQDWLGAAGFDKEQDEDYWGKKWAEAYVDFATYEKRNWLADMGVKFFPVVGWAERGGYLAEGHGNSVPRFHIVWGTGPGIVAPFERRVREHIKNGLIDYQPRHRVDELMIKGGRVTGVTGSLLETSDVKRGEASSRNVVSNFRCEAKAVIITSGGIGANHELIRKNWPSRLGIAPETMLTGVPAHVDGRMLAITEKAGGRIVKRDRMWHYTEGIKNWNPVWNKHGIRILPGPSSMWFDATGKRFSAPNFPGFDTLGTLETIQKTGYSYSWFILTQKIIEKEFALSGSEQNPDLTGKSIPQVLSRVRAGATAPVKAFMDKGEDFVVAETLEELVARMNKLTGENLLDFARIKQQISARDAQLDNKFSKDLQITAMRGARNYRGDRLIRVAAPHKLLDRKKGPLIAVRLHILSRKTLGGLQTDLSARVLGDTGQPVPGLYAAGEVAGFGGGGIHGYRSLEGTFLGSCLFSGRVAGRAVASEGGAESDC
>NZ_CP019401.1|WP_078080785.1|3348691_3349123_-|DUF4181-domain-containing-protein
MIVEDVGWRIFLFLLGVVSSIFLVNMLLRKILGVERKAFFSDTRVNDVHKKWDRILNGLSAVIVFIISLVAINYGPAAFFYVLLVSVLLGIIQLLVRLGFEKKHAENPNDYLYTLLESVTGTIILITFGVSLFPDYLSVVFNI
>NZ_CP019401.1|WP_071152875.1|3347981_3348449_-|DUF4181-domain-containing-protein
MEFSAFVAGVHLAAVVGSELSESEVALRFIFFVGGSIASIYLVDKVLKKILKIEKNKSSTDSYVNDLHKKWDKIISLWSGIALTVITFILFNTNASINLFLLLPVAALPFLPTIIQVGFEKKYAENPNDYLYTLLGLGMSSGIIITLLLIFSPGI
>NZ_CP019401.1|WP_169793174.1|3347797_3347950_-|hypothetical-protein
MGDIIAVFALLVPVFIAAMALRWVRIIRSNSERQIEQNEEIIALLKKSNE
>NZ_CP019401.1|WP_071152874.1|3346806_3347346_-|GNAT-family-N-acetyltransferase
MRSEQVYIRFFQPRDAAEKLKLEVANRNFFEAYSVTRYSDFYTLEMQRELIEIYADQKEDDLSYSFGIFENETDVLVGTISLVQVIRGPLQSAILGYALDKTYNGRGYMTEAIELTVAYAFKKLALHRIEAGVMPGNDASVRVLEKAGFHQEGIASKNVEINGKWQDHQILAIINPRDF
>NZ_CP019401.1|WP_071152873.1|3346224_3346770_-|GNAT-family-N-acetyltransferase
MTFPLLETKRLRLNQVEESDAVRFFDIMSRDKVTEYYGMDSLSYEEEAVEVIRSFRLSFEVNRSIRWAIRLKETNQFIGTIGLNNLNPKAKKAEIGYELHPDYWGQQFMQEAIHSVLNYAFTELDLYRMGAVTFPENTSSNRLLQKLGFTVEGKLRGYLYQRNQSHDALIFSLLKPEWSSS
>NZ_CP019401.1|WP_071152872.1|3345431_3346208_+|nucleotidyltransferase-domain-containing-protein
MLIQEIAVQQITASLIQSSYVRAVFLKGSMGRNEHDEHSDIDLYCLVDQEQESLFLKERLSHLEAYRPVLFQDDIFVIAPQLIVVFDNFLHIDLFTVTVESFTAKDFFKVVYDPENLLEQFVASQSLTLSKEEYTDHVIDVAWFLFQYRKAAARGNEIWAVKMLSQVLEHLSRVLLYRYTPERAQLGLKAISRSLPKTIFAEVEKMSTLMTPENHAQAALIVRCLLAKEIGWMHQHVTDPNKIMPLMQKMITERVEST
>NZ_CP019401.1|WP_071152871.1|3344660_3345347_-|peptidase-E
MRQIIAMGGGGFSMEPDNPLLDHYILKQANKALPKICFIPTASGDADNYIEKFYDFFNQQHCEPSHLSLFKPHTRNLEAFVLQQDIIYVGGGNTKNLLVLWKEWGLDQILKKAWEQGVILAGLSAGSICWYEQGVTDSYGDKLEPLEALGFLRGSHCPHYDGEAERRPTYRQFMNQGVMQSGIAADDGAAVHYIDQKIKKVVSSRPSAKAYRVFKGGEEELAVEYLGE
>NZ_CP019401.1|WP_071152870.1|3343871_3344651_-|alpha/beta-hydrolase
MMDIFSITSEKLQDNRMIRVSIPKDYRLTNKQYPVLYMHDGQNVFRNDHAIGGVSLELENYVDKNSLDIIVVAIDQRREQRKNEYCPWKNGVYSKPFLEDKTVSFGGSGSSYIEFIVEELKPYIDKTYRTKQSQTAMAGISLGGLITLYAACIYPHIFTNIILFSAGFYANQEKIEELIDITDLSVLTSLYMDCGTSEAGSNSTTSHEFLVSNQRIAKKLNRKCSVVTFNILEGEKHNYLSFQKRVPELFSFLQNEVLS
>NZ_CP019401.1|WP_071152869.1|3343392_3343875_-|GNAT-family-N-acetyltransferase
MKVELIKAEVSDAPSILAMQKESFMPLLVKYQDMQTNPANETLEQVLTRITMSGSFFYKIVKGQKMVGAIRVKYGGENCFWISPIFVDPQFQGLGVAKEAMKLVEERHAEAHVWELATILEEEANCRFYEKLGYQSTGVTQSLNSNATLGYFNKIAKDAD
>NZ_CP019401.1|WP_078080787.1|3351428_3352973_-|gluconokinase
MPEQSYYLGVDIGTTSTKAVLFDKSGKILAADTVFYALETPNPLVAEQDPEEIFRAVLSSVRKIIRKSEIDTNQLKLVSFSSAMHSLIAVDAKGNLLTQSITWADTRSSKHAKYIKERLNGHEIYLRTGTPIHAMSPLSKLLWLKDEKPEVFEQAAKFIGIKEFVFQELFGEYVVDHSIASATGLFNLRELDWDKEALGVAGITPEQLARPVPTTHQLTGIDSEHALFMGIPEDVPFIIGASDGVLANLGVDAIEPGVLAVTIGTSGAIRTVTTEPKTDPKGRTFCYALTENHWVVGGPVNNGGIVLRWLRDEFASSEVETAKRLGIDPYDVLTKIAETVNPGADGLLFHPYLTGERAPLWDANARGSFFGLSIHHKKQHMIRAVLEGIVFNLYTVLLAVEELTGEPTRIQASGGFARSGMWRQLMADVFDKPVVIPESFESSCLGAVVLGMYAIGEVDDFSIVSEMIGQTHTHDPDETSAGIYRELLPIYIRLSRLLTAEYESIADFQRKHLE
>NZ_CP019401.1|WP_071152877.1|3353039_3354380_-|gluconate-transporter
MSGSTLIMVALAGIFLLLFLVIRTKLHAFVALLLVSLLVGIAAGMPLNEVITSIQNGMGGTLGFVAVVVGLGAMFGKMLEVSGGAERLASTMISKFGEDKAPWALGVTGFIVAIPVFFDVGFIILVPIVYGLARKTGKSLLHYGIPLLAGLAVTHSFIPPTPGPIAVAELVGAELGWVILFGVLAGIPAMILAGPVFGRFIGKKIHVLIPDYMELEKKEYDKELPSFAMITSLILIPLVLILLNTLSAVLLEEGNTVREILTFLGHPFVALTIATLLTFYLLGTKRGYSRQEVQDIATKALEPAGIIILVTGAGGVFKQVLIDSGVGAVLGDMMGDSSLPPIVLAFLIAAAVRVAQGSATVAMVTAAGLITPLLEIVGMTGPALGLIVIAIASGATVLSHVNDSGFWLVNRYFGMDVKDTLKSWTVMETIIGLTGFVVVLIISFFI
>NZ_CP019401.1|WP_058383989.1|3354474_3355359_-|decarboxylating-6-phosphogluconate-dehydrogenase
MEIGIIGLGKMGLNLALNIVDHGHEVIGYDSHTEIKESGFTQVSSIEEMVKQLEAPRTLWLMVPAGEITETVIEQLIPLLEEGDAIIDGGNSNYKDTLRRAAILKEHNMFFFDCGTSGGTDGARHGICSMIGGDAEKFKTIEPLLKDISVEDGYLYTGEAGSGHFLKMIHNGIEYGMMQSIAEGFDILNKSPFDYNFEKVADVWNNGSIISSYLMEMTKNAFSKDAKLEGIKGVMNSSGEGKWTVETALDLNVPAPVITLSLMMRYRSLEDDTFAGKVVAAQRNEFGGHAVEKK
>NZ_CP019401.1|WP_071152878.1|3355485_3356337_+|MurR/RpiR-family-transcriptional-regulator
MKEQQFALAAIRGSYRHFSEKEKKIADYVLHDPKNIIHLTINQIADELGLAESTIFRFCQRIGFKGFQAFKISLAAEVVAPLKDIHEKIEEGDSIRVVTEKVFRSNIKTLEDTLQIVDAEAMEQATHKLMHARKIDFYGNGGSAMVAMDGYHKFVRLGLHVSMNLDSHMQLMAASQLQSDDVAIVISHSGSTTDILDVLHVLKEKGVTIISVTNFAKSPLSKEADIALYTVSEETDFRSEALASRIAQLSLIDALYTNLMIARGTDGKKALQDMREAMAHKRL
>NZ_CP019401.1|WP_071152879.1|3356381_3357311_-|NADP-dependent-oxidoreductase
MEKMKAYVRTSASTQEVELQELAIPKITEAEVLVEIQAFGVGMHDRYVVPPNATFPYVIGSEAAGVIIKMGSEVSGFGLGDRVILSSSFQLKGGCWAQYAAVSCEMLVAMPHSISFIQGAAIPVAGKTALESLRTLDLKPGNTLFVAGASGAIGTIVIQLAKNRGIRVIGSASSKNHPHLLLLGAEKAVDYSIAEWKDQIKQWMPEGVDAALAIHRGTSKDSMDIVKTGGKVVTVSGDKVDSERETKVEQMQHQLSIQEAVNMLIQDMVEKKLHLVIENVYSFEQALDALEKTETGHARGKLVVSMEEA
>NZ_CP019401.1|WP_058383986.1|3357609_3358836_+|dicarboxylate/amino-acid:cation-symporter
MKAVWNRYLTTSLILKITIALILGVAVGLIFGEQAAVLAPLGDLLLNLLTFLIIPLILFTMMVGINQSSIGDLGRMGGKVFIYYTLSSAFAIIVGLAVASLLQPGMGMQLQGNETFDVPENPGVINVLLNIVPSNIFTAFTELNLLGIIFTAFAFGIALSYMRNSTELGSLGEHLYKTVNALNEMTLIVLKAVLQYVPIGIFAIMAKTVGSQGLDTLFSLGEMILVLYAALLVQILLYVLLLFVFKVNPLEFFKQARTPMLTAFVTQSSSGTLPLTLNAAKNLGLSKSLYGFSLPLGATINMDGAAIRIAVSAVFAANLVGDPLSLSEMLMVVLVGTLASIGTAGVPGAGIVMIATVFVQLGLPIEAVALLTAIDAIVGMGATGLNVTGDLVGTTVIDKNEKKRQTVS
>NZ_CP019401.1|WP_071152880.1|3358923_3359493_-|methyltransferase-domain-containing-protein
MKKVAYDGYYKEENYFGNPYPGLLEFFSTFQPKGTVVDLGCGQGRDALSLGELGYNVIGIDHSVVGIEQLNREAKKRELTVEGIVGDVYTYQISKDVDVVLLDSMLHFYKNDLKKETELVEMILTQLKEGGVFVNCIIKGDKGEKILKKIIDESPSEWEILIDEYTDYREASVEYHLLAVKKGKPSKNL
>NZ_CP019401.1|WP_071152881.1|3359652_3360246_+|histidine-phosphatase-family-protein
MTTIGLVRHGITDWNIQGIAQGSADVPLNETGRQQAASLAERLVSEEEWDVIISSDLARAKETAEIISNTLGLPVHHFEPRLRERSGGKIEGTTEEERLEKWGTDWRTLDLAMENLEDASERGLACVQDVLEHFSDQRVLLVSHGALIGLTLQKLMPETFQKTSMDNTSITLLTHTENQWSCSLFNCTTHLVKSESY
>NZ_CP019401.1|WP_071152882.1|3360239_3361052_-|protein-phosphatase-2C-domain-containing-protein
MPRQREIISWVGSNNAYIDQLDIQQFNHLILGRFGGNSTAGQVKNEDGCLIWMDEKEDWEFVMILDAHRSAESAELVVRQFQKNMSIVASLLSGKVSVGVFSRLEKRLLQLFQEDSFLEACRRVEGETACLIAVRKEKYLYWFSVGDCLLYLFHPELIDFGQYQLNQRQFYDWIGQVNTFEQAVPSFSSGVRELRQGENQLLLTTDGLVECPGAVFSEPDSIWQKCKDTATTDSVSALLATIQKNHVRDSTTVVSWKVTIAEAASYASNQ
>NZ_CP019401.1|WP_071152883.1|3361211_3361556_+|heme-oxygenase
MYIVTNRIKMKSGFAEKMAPNFSRPGALQEMDGFMKVEVAITQDSTEYDELNVSMYWETLENYEAWKTSDVFKEAHKRPAASADSNEPKKESPMLGSQLTITKIVGLLEAKTSN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP019401_2	2.1\|3351112\|38\|NZ_CP019401\|CRISPRCasFinder	3351112-3351149	38	NZ_CP019401.1	3351011-3351048	1	0.974

1. spacer 2.1|3351112|38|NZ_CP019401|CRISPRCasFinder matches to position: 3351011-3351048, mismatch: 1, identity: 0.974

tgcgtatctcccgctgaacgtgcgtatcttccgctgac	CRISPR spacer
tgcgtatcttccgctgaacgtgcgtatcttccgctgac	Protospacer
*********.****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

546909 : 554236

uncultured_virus(33.33%)

protease,integrase

attL 550638:550656|attR 559313:559331

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058386359.1\|546909_547680_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.1e-19	29.9
WP_078080124.1\|547697_548516_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_006831533.1\|548707_548992_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	4.1e-18	48.4
WP_071154661.1\|549023_550655_+	chaperonin GroEL	A0A240F755	uncultured_virus	2.9e-156	54.0
550638:550656	attL	NA	NA	NA	NA
WP_071154660.1\|550748_551918_-\|integrase	site-specific integrase	S6C485	Thermus_phage	2.7e-87	44.3
WP_071154659.1\|551952_552420_-	transcriptional regulator	NA	NA	NA	NA
WP_071154658.1\|552549_552801_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_169835252.1\|552821_553100_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071154656.1\|553113_553413_+	hypothetical protein	A0A1B1P7U4	Bacillus_phage	2.6e-07	31.8
WP_071154655.1\|553417_554236_+	bifunctional DNA primase/polymerase	A0A173H0P8	Pseudoalteromonas_phage	2.1e-22	40.7
559313:559331	attR	NA	NA	NA	NA

DBSCAN-SWA_2

940058 : 949828

Synechococcus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071153246.1\|940058_941354_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.7e-16	31.7
WP_071153247.1\|941370_942087_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SCX8	Cyanophage	5.9e-45	42.4
WP_058386059.1\|942083_942338_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	6.1e-05	34.1
WP_049695147.1\|942334_943018_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_071153248.1\|943001_945227_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.3e-164	41.8
WP_038705370.1\|945202_946624_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-53	33.9
WP_071153249.1\|946636_947698_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.0e-61	45.6
WP_071153250.1\|947687_948260_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.8e-20	33.0
WP_071153251.1\|948292_949828_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	6.2e-76	51.0

DBSCAN-SWA_3

1227799 : 1233395

Staphylococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058385824.1\|1227799_1228030_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.9e-21	66.7
WP_058385823.1\|1228136_1228583_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	2.8e-45	61.6
WP_071153366.1\|1228649_1229108_+	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	9.3e-20	38.0
WP_071153367.1\|1229088_1229868_+	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	3.5e-35	37.2
WP_071153368.1\|1229910_1231500_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	7.6e-186	62.2
WP_071153369.1\|1232198_1233395_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.1e-160	75.6

DBSCAN-SWA_4

2120847 : 2167439

Bacillus_phage(25.0%)

holin,tail,terminase,integrase,plate,capsid

attL 2116538:2116597|attR 2166065:2166157

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2116538:2116597	attL	NA	NA	NA	NA
WP_071152976.1\|2120847_2121117_-\|holin	holin	A0A0U4JE55	Bacillus_phage	3.1e-15	48.8
WP_071152977.1\|2121132_2121513_-	hypothetical protein	NA	NA	NA	NA
WP_169835269.1\|2122154_2123123_+	EpsG family protein	NA	NA	NA	NA
WP_078080527.1\|2123203_2124412_-	hypothetical protein	NA	NA	NA	NA
WP_078080528.1\|2124413_2125625_-	hypothetical protein	NA	NA	NA	NA
WP_071152983.1\|2125626_2126325_-	hypothetical protein	NA	NA	NA	NA
WP_078080529.1\|2126371_2126503_-	XkdX family protein	NA	NA	NA	NA
WP_071152985.1\|2126906_2127656_-\|tail	tail fiber protein	NA	NA	NA	NA
WP_071152986.1\|2127659_2128313_-	DUF2313 domain-containing protein	S6BFJ0	Thermus_phage	8.4e-14	25.3
WP_078080530.1\|2128312_2129401_-\|plate	baseplate J/gp47 family protein	A0A0A7RUN3	Clostridium_phage	3.4e-36	31.7
WP_078080531.1\|2129397_2129811_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_071152990.1\|2129812_2130157_-	DUF2577 family protein	NA	NA	NA	NA
WP_078080532.1\|2130199_2132125_-	C40 family peptidase	A0A2H4IZP4	uncultured_Caudovirales_phage	1.1e-40	32.5
WP_071152992.1\|2132136_2132835_-	LysM peptidoglycan-binding domain-containing protein	S6BFJ4	Thermus_phage	2.0e-13	28.5
WP_071152993.1\|2132831_2134223_-	hypothetical protein	A0A1S5S8I3	Streptococcus_phage	6.5e-32	42.4
WP_078080533.1\|2134497_2135250_-	hypothetical protein	A0A1X9I6B4	Streptococcus_phage	3.9e-23	53.7
WP_169835270.1\|2135284_2135443_-	hypothetical protein	NA	NA	NA	NA
WP_071152996.1\|2135457_2135865_-	hypothetical protein	NA	NA	NA	NA
WP_071152997.1\|2135911_2136343_-	hypothetical protein	NA	NA	NA	NA
WP_078080534.1\|2136346_2137375_-\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0A7S087	Clostridium_phage	8.0e-11	24.0
WP_078080535.1\|2137405_2137951_-	hypothetical protein	NA	NA	NA	NA
WP_078080536.1\|2137955_2138348_-	hypothetical protein	NA	NA	NA	NA
WP_078080537.1\|2138344_2138680_-	hypothetical protein	NA	NA	NA	NA
WP_078080538.1\|2138676_2139060_-	hypothetical protein	A0A1U9WQS7	Geobacillus_phage	2.1e-09	34.7
WP_071154213.1\|2139094_2139361_-	hypothetical protein	M4ZS13	Bacillus_phage	1.8e-07	48.3
WP_078080539.1\|2139424_2140411_-\|capsid	major capsid protein	A0A1U9WQS4	Geobacillus_phage	2.9e-103	56.7
WP_071154210.1\|2140435_2140786_-	hypothetical protein	NA	NA	NA	NA
WP_078080540.1\|2140785_2141541_-	hypothetical protein	M4ZSA3	Bacillus_phage	8.8e-07	29.1
WP_078080541.1\|2141705_2141888_-	hypothetical protein	NA	NA	NA	NA
WP_071154207.1\|2142108_2142339_-	hypothetical protein	NA	NA	NA	NA
WP_071154206.1\|2142343_2142592_-	hypothetical protein	NA	NA	NA	NA
WP_071154205.1\|2142639_2143548_-	hypothetical protein	A0A1S5SAA4	Streptococcus_phage	1.5e-08	42.2
WP_071154204.1\|2143544_2145107_-	hypothetical protein	A0A1U9WQP5	Geobacillus_phage	2.3e-134	48.9
WP_071154203.1\|2145110_2146397_-\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	1.3e-151	61.9
WP_071154202.1\|2146396_2147239_-\|terminase	terminase small subunit	Q5YA77	Bacillus_phage	9.9e-68	56.1
WP_071154201.1\|2147275_2147722_-	hypothetical protein	NA	NA	NA	NA
WP_071154200.1\|2147924_2148320_-	hypothetical protein	A0A290FZR5	Caldibacillus_phage	2.0e-34	53.0
WP_071154199.1\|2148331_2148526_-	hypothetical protein	NA	NA	NA	NA
WP_071154198.1\|2148539_2148914_-	hypothetical protein	NA	NA	NA	NA
WP_071154197.1\|2149023_2149203_-	DUF3954 domain-containing protein	A0A2P1JTX5	Anoxybacillus_phage	4.0e-11	53.7
WP_071154196.1\|2149248_2149440_-	hypothetical protein	NA	NA	NA	NA
WP_071154195.1\|2149552_2149834_-	hypothetical protein	NA	NA	NA	NA
WP_071154194.1\|2149836_2150271_-	RusA family crossover junction endodeoxyribonuclease	A8ATL5	Listeria_phage	1.8e-20	39.3
WP_071154193.1\|2150366_2150615_-	hypothetical protein	NA	NA	NA	NA
WP_071154191.1\|2150946_2151150_-	hypothetical protein	NA	NA	NA	NA
WP_071154190.1\|2151142_2151712_-	hypothetical protein	A0A2P1JTZ1	Anoxybacillus_phage	1.3e-39	49.5
WP_169835271.1\|2151731_2151872_-	hypothetical protein	NA	NA	NA	NA
WP_071154189.1\|2151887_2152109_-	hypothetical protein	NA	NA	NA	NA
WP_071154188.1\|2152316_2152580_-	hypothetical protein	NA	NA	NA	NA
WP_169835272.1\|2152734_2152911_-	hypothetical protein	NA	NA	NA	NA
WP_071154187.1\|2153006_2153432_-	single-stranded DNA-binding protein	D7RWG9	Brochothrix_phage	1.1e-41	74.8
WP_071154186.1\|2153443_2153692_-	hypothetical protein	NA	NA	NA	NA
WP_071154185.1\|2153691_2154279_-	hypothetical protein	NA	NA	NA	NA
WP_071154184.1\|2154359_2154539_-	hypothetical protein	NA	NA	NA	NA
WP_151897524.1\|2154550_2155357_-	ATP-binding protein	A0A1B1P8D0	Bacillus_phage	2.0e-70	50.0
WP_071154183.1\|2155313_2156237_-	DnaD domain protein	D2XR43	Bacillus_phage	9.9e-45	40.1
WP_071154182.1\|2156329_2156569_-	hypothetical protein	NA	NA	NA	NA
WP_078080543.1\|2156599_2157406_-	PD-(D/E)XK nuclease family protein	A0A290GJV0	Caldibacillus_phage	8.8e-90	61.5
WP_078080544.1\|2157368_2158268_-	hypothetical protein	A0A2P1JTZ5	Anoxybacillus_phage	3.1e-107	67.9
WP_071154180.1\|2158353_2158572_-	hypothetical protein	NA	NA	NA	NA
WP_071154179.1\|2158544_2158760_-	hypothetical protein	NA	NA	NA	NA
WP_071154178.1\|2158759_2158999_-	hypothetical protein	NA	NA	NA	NA
WP_078080545.1\|2159261_2159786_-	hypothetical protein	NA	NA	NA	NA
WP_071154175.1\|2159873_2160152_-	hypothetical protein	NA	NA	NA	NA
WP_078080546.1\|2160158_2161145_-	hypothetical protein	NA	NA	NA	NA
WP_071154173.1\|2161162_2161915_-	antA/AntB antirepressor family protein	Q6R850	Staphylococcus_virus	3.6e-61	54.0
WP_143039543.1\|2162254_2162443_-	hypothetical protein	NA	NA	NA	NA
WP_071154171.1\|2162459_2162696_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_071154170.1\|2162849_2163275_+	helix-turn-helix transcriptional regulator	A8ATJ9	Listeria_phage	5.6e-11	54.0
WP_078080547.1\|2163336_2163537_+	YqaE/Pmp3 family membrane protein	A0A2I7SCF5	Paenibacillus_phage	1.8e-12	62.3
WP_078080548.1\|2163565_2164276_+	PH domain-containing protein	A0A0D4DCT6	Staphylococcus_phage	1.4e-22	36.5
WP_071154169.1\|2164345_2164807_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.7e-19	33.8
WP_071154168.1\|2164874_2165999_+\|integrase	site-specific integrase	A0A0S2SXP1	Bacillus_phage	7.6e-47	54.6
WP_058384986.1\|2166104_2167439_-	type I glutamate--ammonia ligase	A0A1V0SJ53	Klosneuvirus	5.2e-10	25.2
2166065:2166157	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019401

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection