CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP019879	Komagataeibacter nataicola strain RZS01 plasmid pKNA04, complete sequence	0 crisprs	NA	0	1
NZ_CP019878	Komagataeibacter nataicola strain RZS01 plasmid pKNA03, complete sequence	0 crisprs	NA	0	0
NZ_CP019881	Komagataeibacter nataicola strain RZS01 plasmid pKNA06, complete sequence	0 crisprs	NA	0	0
NZ_CP019877	Komagataeibacter nataicola strain RZS01 plasmid pKNA02, complete sequence	0 crisprs	NA	0	0
NZ_CP019880	Komagataeibacter nataicola strain RZS01 plasmid pKNA05, complete sequence	0 crisprs	NA	0	0
NZ_CP019876	Komagataeibacter nataicola strain RZS01 plasmid pKNA01, complete sequence	0 crisprs	NA	0	0
NZ_CP019875	Komagataeibacter nataicola strain RZS01 chromosome, complete genome	1 crisprs	csa3,DEDDh,DinG,WYL	2	10

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 24550

Streptococcus_phage(20.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078528599.1\|3305_3569_-\|transposase	transposase	NA	NA	NA	NA
WP_078528602.1\|3940_5212_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	1.6e-08	30.0
WP_078528605.1\|5908_6178_+	hypothetical protein	NA	NA	NA	NA
WP_078528608.1\|6177_6585_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_078528611.1\|6593_7262_-	hypothetical protein	NA	NA	NA	NA
WP_078528614.1\|7461_7785_-	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_078528638.1\|7726_8029_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_078528617.1\|8114_11498_-	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	2.2e-09	25.4
WP_078528640.1\|11660_11954_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_078528620.1\|12018_12258_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_110571435.1\|12963_13299_+	hypothetical protein	NA	NA	NA	NA
WP_110571434.1\|13302_13557_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_078528623.1\|13522_14026_+	transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	6.4e-22	47.6
WP_078528626.1\|15476_16577_+	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	1.8e-61	39.9
WP_078528643.1\|16620_16872_-	hypothetical protein	NA	NA	NA	NA
WP_078528629.1\|16898_17534_-	AAA family ATPase	D4HTX7	Vibrio_phage	1.1e-10	27.4
WP_078528632.1\|17576_18194_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.2e-14	34.4
WP_071406638.1\|18950_19334_+\|transposase	transposase	NA	NA	NA	NA
WP_019092242.1\|19330_19678_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
WP_078524623.1\|19743_21312_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	3.2e-104	44.9
WP_078528635.1\|21223_22228_-	sodium:proton antiporter	A0A2H4J428	uncultured_Caudovirales_phage	8.1e-16	33.3
WP_078528599.1\|22643_22907_-\|transposase	transposase	NA	NA	NA	NA
WP_078528602.1\|23278_24550_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	1.6e-08	30.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP019875

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019875_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019875_1

1986382-1986500

Orphan

Consensus_repeat	Method
CCACCGCCCCAGCCCCATCCGCC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP019875_1

>merge|NZ_CP019875|1|1986382-1986500|CRISPRCasFinder
CCAGCACCCCATCCGCCCCAGCCCCATCCGCCATGCCATCCACCACAGCCCCCGCCGCCATGCCATCCGCCACCACCACCGCGCCAGCCCCCGCCACCACCATGCCAGCCTCCACCGCC

>NZ_CP019875|1|1|1986382-1986500|CRISPRCasFinder
CCAGCACCCCATCCGCCCCAGCC	CCATCCGCCATGCCATCCACCACAG
CCCCCGCCGCCATGCCATCCGCC	ACCACCACCGCGCCAGCCCCCGCCA
CCACCATGCCAGCCTCCACCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019875.1\|WP_078525666.1\|1980097_1980382_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019875.1\|WP_078525674.1\|1982446_1982773_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227505
NZ_CP019875.1\|WP_078525660.1\|1976717_1977467_-\|pyridoxine-5'-phosphate-synthase	unknown	unknown	gnl\|CDD\|235380
NZ_CP019875.1\|WP_078525680.1\|1984851_1985907_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|234585
NZ_CP019875.1\|WP_078525694.1\|1993563_1994913_-\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	unknown	unknown	gnl\|CDD\|236307
NZ_CP019875.1\|WP_061274471.1\|1995373_1995829_-\|type-II-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|235443
NZ_CP019875.1\|WP_078525678.1\|1983523_1984597_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NZ_CP019875.1\|WP_078525664.1\|1978445_1979852_-\|M20/M25/M40-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|236379
NZ_CP019875.1\|WP_078525696.1\|1994912_1995377_-\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein	unknown	unknown	gnl\|CDD\|235777
NZ_CP019875.1\|WP_078525698.1\|1996628_1997570_-\|YihY/virulence-factor-BrkB-family-protein	unknown	unknown	gnl\|CDD\|377085
NZ_CP019875.1\|WP_078525670.1\|1980968_1981688_+\|orotidine-5'-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|234695
NZ_CP019875.1\|WP_078525688.1\|1989001_1990300_+\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP019875.1\|WP_078525672.1\|1981747_1982374_+\|phosphoribosylanthranilate-isomerase	unknown	unknown	gnl\|CDD\|234923
NZ_CP019875.1\|WP_078525662.1\|1977463_1978453_-\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|235402
NZ_CP019875.1\|WP_078525676.1\|1983012_1983513_-\|DUF721-domain-containing-protein	unknown	unknown	gnl\|CDD\|377496
NZ_CP019875.1\|WP_078525686.1\|1988222_1988915_+\|VTT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378149
NZ_CP019875.1\|WP_078525692.1\|1991151_1993386_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|377393
NZ_CP019875.1\|WP_078527897.1\|1995961_1996504_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868
NZ_CP019875.1\|WP_078525684.1\|1987034_1988105_-\|heme-A-synthase	unknown	unknown	gnl\|CDD\|240283
NZ_CP019875.1\|WP_078525690.1\|1990484_1991015_+\|adenine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235028

Protein	Function_ID	Function_description	E-value
NZ_CP019875.1\|WP_078525684.1\|1987034_1988105_-\|heme-A-synthase	gnl\|CDD\|240283	PTZ00127, PTZ00127, cytochrome c oxidase assembly protein; Provisional.	3.88605e-105
NZ_CP019875.1\|WP_078525674.1\|1982446_1982773_-\|hypothetical-protein	gnl\|CDD\|227505	COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification].	0.000557481
NZ_CP019875.1\|WP_078525660.1\|1976717_1977467_-\|pyridoxine-5'-phosphate-synthase	gnl\|CDD\|235380	PRK05265, PRK05265, pyridoxine 5'-phosphate synthase; Provisional.	8.57954e-140
NZ_CP019875.1\|WP_078525680.1\|1984851_1985907_+\|ferrochelatase	gnl\|CDD\|234585	PRK00035, hemH, ferrochelatase; Reviewed.	3.45957e-152
NZ_CP019875.1\|WP_078525694.1\|1993563_1994913_-\|acetyl-CoA-carboxylase-biotin-carboxylase-subunit	gnl\|CDD\|236307	PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated.	0
NZ_CP019875.1\|WP_061274471.1\|1995373_1995829_-\|type-II-3-dehydroquinate-dehydratase	gnl\|CDD\|235443	PRK05395, PRK05395, type II 3-dehydroquinate dehydratase.	2.25331e-90
NZ_CP019875.1\|WP_078525678.1\|1983523_1984597_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	3.43833e-113
NZ_CP019875.1\|WP_078525664.1\|1978445_1979852_-\|M20/M25/M40-family-metallo-hydrolase	gnl\|CDD\|236379	PRK09104, PRK09104, hypothetical protein; Validated.	0
NZ_CP019875.1\|WP_078525696.1\|1994912_1995377_-\|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein	gnl\|CDD\|235777	PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein.	5.69474e-52
NZ_CP019875.1\|WP_078525698.1\|1996628_1997570_-\|YihY/virulence-factor-BrkB-family-protein	gnl\|CDD\|377085	pfam03631, Virul_fac_BrkB, Virulence factor BrkB. This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.	3.06667e-51
NZ_CP019875.1\|WP_078525670.1\|1980968_1981688_+\|orotidine-5'-phosphate-decarboxylase	gnl\|CDD\|234695	PRK00230, PRK00230, orotidine-5'-phosphate decarboxylase.	7.28568e-92
NZ_CP019875.1\|WP_078525688.1\|1989001_1990300_+\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.26283e-86
NZ_CP019875.1\|WP_078525672.1\|1981747_1982374_+\|phosphoribosylanthranilate-isomerase	gnl\|CDD\|234923	PRK01222, PRK01222, phosphoribosylanthranilate isomerase.	5.05241e-69
NZ_CP019875.1\|WP_078525662.1\|1977463_1978453_-\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|235402	PRK05312, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase PdxA.	9.18793e-169
NZ_CP019875.1\|WP_078525676.1\|1983012_1983513_-\|DUF721-domain-containing-protein	gnl\|CDD\|377496	pfam05258, DUF721, Protein of unknown function (DUF721). This family contains several actinomycete proteins of unknown function.	1.71609e-16
NZ_CP019875.1\|WP_078525686.1\|1988222_1988915_+\|VTT-domain-containing-protein	gnl\|CDD\|378149	pfam09335, VTT, VMP1, TMEM41, and TVP38 (VTT) domain. The VTT domain was previously called the SNARE-associated domain, but was renamed as there seems to be no evidence for association with SNARE proteins.	2.23473e-11
NZ_CP019875.1\|WP_078525692.1\|1991151_1993386_+\|FUSC-family-protein	gnl\|CDD\|377393	pfam04632, FUSC, Fusaric acid resistance protein family. This family includes a conserved region found in two proteins associated with fusaric acid resistance, FusC from Burkholderia cepacia and fdt-2 from Klebsiella oxytoca. These proteins are likely to be membrane transporter proteins.	2.19177e-124
NZ_CP019875.1\|WP_078527897.1\|1995961_1996504_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	3.91957e-38
NZ_CP019875.1\|WP_078525690.1\|1990484_1991015_+\|adenine-phosphoribosyltransferase	gnl\|CDD\|235028	PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional.	1.15465e-90

>NZ_CP019875.1|WP_078525680.1|1984851_1985907_+|ferrochelatase
MTFITVKRAAGHEDAPPRTGVLLSNLGTPDGTGYGAVRRYLAEFLSDRRIIEASPVIWKPILYGPVLTFRPRRSGEAYHRIWHHDRDESPLRTYTRDQAEMLATRLAGDDVPVAWGMRYGQPSIKQALHELVAQGCDRILLAPLYPQYSATTTATANDQAFRALMRLRNQPAIRTLPPFADHPAYIAALGRSITARLETLDFKPQMIVASFHGLPRVYVEKGDSYADECARTIIALRRAMGYDAQMMPLTFQSRFGPAKWLEPYTAPFIESLPAQGIERIAVITPGFISDCIETLDEIGNEAAEDFIKAGGKELALIPCLNNSPDAIDLLETLVREELAGWLPRKPAAPAG
>NZ_CP019875.1|WP_078525678.1|1983523_1984597_+|A/G-specific-adenine-glycosylase
MLPCATDLLRWYDRHRRILPWRALPGQKIDPYRVWLSEIMLQQTTVTAVMPYFERFLAAFPDVTALARAPQDRVMALWAGLGYYARARNLHACAQAVAARGGVFPDTVEGLLELPGIGAYTAAAIAAIAFGRPVVPVDGNVERVTSRLFALTDPLPAARKAIAARAVTLNADAQAKARPSDFAQALFDLGAGICTPRSPACVLCPWREACAGHAQGIAATLPRRAPKPVRPVRHGVHFCLVDEAGGLLLVRRPEKGLLGGMMGLPGPHWRDDPWPEAEALSLAPAAPRLQPHWRMVGQVKHVFTHFTLLVDVYAARIAAFPNSMAAAGCVHYPGDAAVALPSLMDKCVKVARKAGIF
>NZ_CP019875.1|WP_078525676.1|1983012_1983513_-|DUF721-domain-containing-protein
MTNPPPRSKKKNEAHAPAEPPRRAFRARSMAALLPQISQPVFRRQSAAAVQVMTDWADIVGPHLAALTVPRKLSAGTLTVGCQGPVAMELQHLAPTVIARINTTCGTGVVKRLKMVQDLLAPPRQAAPPAPPRRPPPPVEIDDMPDGPLKEALASLGGWLRARQGR
>NZ_CP019875.1|WP_078525674.1|1982446_1982773_-|hypothetical-protein
MRKLALLLAVSMGLVGVLPAPSAHAWGGGWRGGPGWGGGWHRGWGWGGFGMGMAAGTALGVAMSPYRYRPYGYGYAYPAYGYPPPPYPVYAYPPPPPPPPPAYYGYYR
>NZ_CP019875.1|WP_078525672.1|1981747_1982374_+|phosphoribosylanthranilate-isomerase
MTVRVKICGIRDGAGLDAACAAGADWVGFVFFSRSPRHVTAPQAAPLVRRLPHDGPRAIGLFVRPTDDEIRHVLDTVALDGLQIYDTATRAAAIRVQFGVPVWLAAGIAVRADLPQSCAVDGLVIESRPPAGAQRPGGNARTFDWSLTEGWQAPAPWMLAGGLRPGNVREAVRLSGARAVDVSSGVETAPGVKSPALIHEFVRAAHGL
>NZ_CP019875.1|WP_078525670.1|1980968_1981688_+|orotidine-5'-phosphate-decarboxylase
MSHGRSTRLIVALDTKDTAQAVSWREQVAGPAGMVKLGLEFTYACGLDAVRRAAGGSPLFLDLKLHDIPNTVASAIGSLAALRPAMLTIHASGGRAMIAAARKAVDETFPADARPLLLAVTVLTSMDETALHETGVEGSVEAQVLRLGALAMDSGADGLVCSSHEIAPLRAALGDRPVLVVPGIRPAGSALGDQKRVMTPAQASAAGADWIVVGRPITRADDPAAAAAAIAAELEKARS
>NZ_CP019875.1|WP_078525666.1|1980097_1980382_-|hypothetical-protein
MGKVVVFRNTARRDESWAVEARTGRETRIASIYATRAAAEADCVWRNQQVAAYRAFLERNAVAVPQYSIRPYRRADLPRAWRPLPALGFLHGQC
>NZ_CP019875.1|WP_078525664.1|1978445_1979852_-|M20/M25/M40-family-metallo-hydrolase
MTAPAHSLSPVLEQADRTLDAALERLFAFLRIPSISTQPEHADDCCRAAQWLRDELDGLGFDVTLHETPGHPILTAHDRTPPAGPHVLFYGHYDVQPVDPLELWESGPFEPKLVVGENGTKRIVARGASDDKGQVMTFIEAIRAIRATTGQMPVRISLLIEGEEECGGPSLLPFMEKHRKELRADVGLICDTAMLPGVPAITTTLRGMVGEEVHLRCATRDLHSGIYGNAARNPAEVLCQVLSSIRDEATGRVTLPGFYAGVQDPAPELRARWREIAPDDATFLGEVGLSRPAGEKGYTAIEQTWCRPSFEINGISSGYTGAGFKTVLPGEAVAKVSFRLVAGQDPVHIRQAFCSHVRTMVPEDCTVTFTPCGGSVASTLPDDAFGLKPALSALGEEWNTPAVTIGCGGSIPVAADMQRVLGMPALLVGFALDDDRAHSPNEKYDLTSFHKGMRSWIRILHAMATTDA
>NZ_CP019875.1|WP_078525662.1|1977463_1978453_-|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MPEASAPLALTMGDPAGIGPEITAGAWQAMRAGATVFAVIGDAALIGRHGVPVREIGTMGEAAGVFADAVPVLPVTLAAPVVAGQPDSRNADAITTSIARAVELARHGHAAGVVTNPISKIVLKKAGFAYPGHTEYLAALCNVPGREVMMLACPELRVVPVTIHVSLRRALDELTTGGIIAATRTTHAALMRDFGLARPRIAMAGLNPHAGEGGTMGTEEQTIIIPAMEALREHGMDVSGPWPPDTMFTPPARARYDVAMCMYHDQALIPLKTIDMTQGVNTTLGLPIIRTSPDHGTAFDIAGRGTADPTSLVAALRMAMQMAEHRNRS
>NZ_CP019875.1|WP_078525660.1|1976717_1977467_-|pyridoxine-5'-phosphate-synthase
MSASSPAAIRLGVNIDHVATVRNARGGTHPDPVRAALLAQKSGADGITAHLREDRRHIRDADLERLRAELAIPLNMEMAATEEMTAIATRLHPHACCLVPERRQEVTTEGGLDVVGQAETLAPRIARLNGAGIRVSLFIDPDAAQIETAARLGAAVVELHTGAYADAPDEAARAIELGRLTTGAAHAAHCGLEVHAGHGLTYDNVAPIAALPQVVELNIGHFLIGQAIFDGLPAVIGHMKAVIAAARSA
>NZ_CP019875.1|WP_078525684.1|1987034_1988105_-|heme-A-synthase
MGRTPPSAQDLRNRQRISTWLFAICFMLVGMIALGGYTRLTGSGLSIMDWRPITGMIPPLSHAEWERQFELYKTIPQYKILHDGFGLAGFQQIFWAEWTHRFWGRLMGFVLLVPLVWFSITGALSRGLALRLVLFFVLGGLQGAIGWFMVASGFNPDSTAVAPVRLVLHLCCAFALYIAILWTALSVRTPRPAFIPATPEVRRMHALVWAICVLVGMTVIAGGFTAGTHAGFAYNTFPLMDGHLIPQGYAKLHPFWLNWFQNIPAIQFDHRLLATTTAVLIGVTIVLGLRTPQLGKDVHAALAMLGWLVLLQYALGVTTLLLVVPVWAGTVHQTCAAIVLTAAIITLHRLRGVGRP
>NZ_CP019875.1|WP_078525686.1|1988222_1988915_+|VTT-domain-containing-protein
MTAPHAAPPVPGLQGSLRVLVRPLLLLAAFVALTVVLGRLPAVREMLTAGHGLHARAGSEIMFVLAASAFCGLGLPRQAVCFAAGAAYGIGAGCALATLATVTGCVWGYGWGRWAGRMRMPARLGATLARVEGCVRAAPFASVLALRLMPVGSALLLNLAAGMLGVRVMPFMLATLLGSLPQTVVFVLVGTGMQLGGGARIGVAIGLFGLSALVGLWLMRRMRGLRPWQE
>NZ_CP019875.1|WP_078525688.1|1989001_1990300_+|multidrug-effflux-MFS-transporter
MGSSATAGRPAETPVPETTGRPMGWIAILLGFLTAVGPVSTDIYLPAFPELEATLHGRAGSAQMTLAVWFVGLAIGQITMGPLSDRFGRRRPMLLGTLVYTLASVGCAMARDIPTFSFFRFVASLGASASLIIPSACVRDMSHGNESARLMSRLVLVMGVVPILAPTLGGLVLSIASWRSIFWAAAVYGVICIGLIWRVLPETLQPANRSEFSPVTLFSRYVMLARDRGFITHAMIAGFACFMSFTYLSAAPSVFIHQFGLSPAHFGMMFGVFAVCMIGASQLNGVLVGRIDAARILGASVGVAVAGTMAMTVMAVVIAFAMQHGGHPPLWMMGLLILAMMVSLGTTGIVGPNATVGALADHPRFAGSASAFVGTLQYVLGAVAGAFVGMLPANSPLPMAGVMLMGAAIMMVMVLLRPVRAPTPIPAGAAEE
>NZ_CP019875.1|WP_078525690.1|1990484_1991015_+|adenine-phosphoribosyltransferase
MTTAQIDLKQYIRHIPDFPKPGILFYDISTLMRNADAWQIAMGRLAAAVAPWAPDVLAAIESRGFLTAAPLASRLGCGLVMLRKPGKLPGETVSYSYDLEYGSDSLHIQADAIKPGQRVVVMDDLLATGGTLVASVALLHKVGANVVGAATLIELTGLGGRDRLDVPVKTLVSYDE
>NZ_CP019875.1|WP_078525692.1|1991151_1993386_+|FUSC-family-protein
MKGLELSLTRFQDQIRAFFRRLWPPGMTLRQDHLRWLYAPGIFTFGYALRTTITSLIALGIALWWELGSPQWAALTVWMVAQGTRGKSVAKARWHLFGMVVGTICAVLLVAAFPQAPLMFILLLAIGIGTFCFIGTLLPGPATMTNYRIHGMRASGFTYAIISLDGIADPQNIFMTAMSRATYIVLGIVLESTVSSLFQFKLAKRAEDRLADNFMTAINGAAQTLASLLSGDTQVLKQARGVFSNITTLSDQIEFAEVEMGAHRGHEGDHARAALARVAMLLSRGLDLAALMQGPVGRPDAAFNATSSKVQAFLKDMAGELEASDDIHPVLARLAELQAACRQSVVDSLNQEMGSPGSLPVDPQLVQMLSQQRMLNYALGQILDELEQALIQFDASRNPLAHDHFHYRLKTFRDWQQAFTNSLRASVTIFGAGVIWITTAWSAGLTFIMFVSIVCSLFSTLEKPALATRAFLGGAIIASVVAGVLVLWRLASPTTYEIMALCLFLPMLAGGLAFAYPALILGAVSYNLFLPILLGPGNQSRLDEVAFFNTAMPLIVGLWYAMWAFRLVLPFDTNDMRWQMRTGILRGLRYVARARTLPTTLYVVEHNVDRFVRLLTNAENTPDTIIDAYLQGILSAMTIGLNVIRLRAILERHLLPPEAQRVVGEMMGRMAQFSGRYGGHYGRTARSAKFAIMHLQQLAGQADNLGVRLEIDSALGCLYVISFELDHNQKFFDASSPYLDPVMA
>NZ_CP019875.1|WP_078525694.1|1993563_1994913_-|acetyl-CoA-carboxylase-biotin-carboxylase-subunit
MFSKILIANRGEIALRILRACRELGIRTVAVHSTADTDAMYVRLADEAVCIGPPASRDSYLNVAAILSAATITGADAIHPGYGFLSENADFAETVEAHGLTFIGPTAEHIRMMGDKITAKTTMMALGVPLVPGSDGALESLEQAREVAAKVGYPVLIKAAAGGGGRGMKVAPTEADLEEAWSVARTEARAAFGNDEVYLEKYLDKPRHIELQIMADTHGNVVHYGERDCSLQRRHQKLLEEAGSPALTARQRDEIGAIATAALTKLGYRNAGTLEFLYQDGQFCFIEMNTRLQVEHPVTEMVCDVDLVREQIRIAAGEPIGYSQSDIKFSGHAIECRINAEDPQTFMPTPGTITVYHPPGGLGVRIDSALYAGYRVPPYYDSMIAKLIVRAPTRLEAIERMRRALDEFVIEGVKTVIPLHRKILEDPQFRKGDYTIHWLENFVARQQQG
>NZ_CP019875.1|WP_078525696.1|1994912_1995377_-|acetyl-CoA-carboxylase-biotin-carboxyl-carrier-protein
MSRLLVDADAIRALAEILTDTGLTEIEIAEKDNRIRVVRAAAPVAHAVPAPAPVAAAPAAPTPVAPPAANPADLSKHPGAVTSPMVGVAYLAPDPSSPAFVSEGQQVAAGQTLLLIEAMKTFNQIKAPRAGTVSRILVQSGDPVEFGEALVIIE
>NZ_CP019875.1|WP_061274471.1|1995373_1995829_-|type-II-3-dehydroquinate-dehydratase
MERPLIAVLNGPNLNMLGLRQPEVYGHATLDDVEQVCVQAAERLDVAIDFRQTNGEGELVSWIQECRGRARGIIINPAAYSHTSVAILDALLAVDLPVIEVHISNIHRREAFRHHSYVSQAAIGVICGLGVRGYALALQAMTDMILDEDDQ
>NZ_CP019875.1|WP_078527897.1|1995961_1996504_+|septal-ring-lytic-transglycosylase-RlpA-family-protein
MTGKTDHQRAGGERSGNTARFGATVAVACLMLATSGLLNAAQAAARHAVATTRHGGRASVRRPPAMAHVPANWNQHGLASWYGTGRQSGHATASGEQFDPDALTAAHAQLPLGTRVRVHALSTGRSVVVRVNDRGPYHGHRIIDLSPEAARQLGILGRGVSTVEIEPARGADEEVASATR
>NZ_CP019875.1|WP_078525698.1|1996628_1997570_-|YihY/virulence-factor-BrkB-family-protein
MTDIPPPARHLPHFSMQQVRKVLRQVARNIVSDQITLAAAGCAFYATLSLFPAMSTLISLYGLLFDPQTVEPQLVVLRNLLPPAAYDMIGARIHLLVAESHSSLTLNLIISTTIATWSASAATRSLILAMNVAYNTPETRSFLRFQAMGMALTFCSICGGILTLALMVGLPFLLDYLPQKLELAPPPGSVELLVRMGGPMLMLLFVLSLCSVLYRFGPNRPHTYWRCILPGSIGATLLWLLSSAGFSYYVSHIAGYSATYGPLGAFIAIMMWFYVSAYVVLLGAELNAGLEIEMKLRCSPDKIMEGWTKHQRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1276776-1276800	2	0.92
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	536765-536789	2	0.92
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1685279-1685303	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	465833-465857	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1685416-1685440	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	310184-310208	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	335300-335324	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1565759-1565783	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1684984-1685008	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1684930-1684954	3	0.88
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	332953-332977	3	0.88
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2483477-2483501	3	0.88
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_AP023209	Escherichia coli strain TUM18781 plasmid pMTY18781-4, complete sequence	12203-12227	3	0.88
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP034185	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence	250925-250949	3	0.88
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_KU852461	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1004 plasmid pNUC, complete sequence	2564-2588	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_KP689347	Klebsiella pneumoniae strain A60136 plasmid p60136, complete sequence	1666-1690	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_KP205272	Escherichia coli strain EL-231 plasmid pQEL231, complete sequence	6775-6799	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP010164	Escherichia coli strain H2 plasmid A, complete sequence	2652-2676	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1690847-1690871	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	460271-460295	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP042603	Escherichia coli strain NCYU-29-69 plasmid pNCYU-29-69-4, complete sequence	7182-7206	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP022498	Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence	7974-7998	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP022498	Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence	18860-18884	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP022499	Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed2, complete sequence	25367-25391	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP053741	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncQ, complete sequence	4725-4749	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP053727	Escherichia coli strain CP66-6_Sichuan plasmid pCP66-6-IncQ, complete sequence	4725-4749	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP044201	Salmonella enterica subsp. enterica serovar Corvallis strain AR-0406 plasmid pAR-0406-1, complete sequence	6879-6903	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	MN922284	Actinobacillus pleuropneumoniae strain 1144 plasmid pA1144, complete sequence	978-1002	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_010912	Avibacterium paragallinarum strain A14 plasmid pYMH5, complete sequence	3470-3494	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP025338	Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p11k, complete sequence	175-199	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP019262	Escherichia coli strain 13C1065T plasmid p13C1065T-3, complete sequence	122811-122835	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP044303	Escherichia coli strain P59A plasmid pP59A-5, complete sequence	2784-2808	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	MN086778	Escherichia coli plasmid p16EC-IncN, complete sequence	44775-44799	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP023480	Klebsiella quasipneumoniae strain KPC142 plasmid pKQPS142b, complete sequence	7529-7553	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP053239	Escherichia coli strain SCU-106 plasmid pSCU-106-5, complete sequence	41-65	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP049937	Escherichia coli strain JL05 plasmid pARG01, complete sequence	19940-19964	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP046260	Escherichia coli strain ECO2947 plasmid p2974-D, complete sequence	13832-13856	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP053869	Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-3, complete sequence	6255-6279	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1690979-1691003	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	304615-304639	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	329722-329746	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1571337-1571361	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_011378	Pasteurella multocida plasmid pCCK1900, complete sequence	5101-5125	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP010408	Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence	223999-224023	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_013104	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSRC15, complete sequence	5687-5711	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP010245	Escherichia coli strain S56 plasmid C, complete sequence	1097-1121	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_002524	Uncultured eubacterium pIE1115 plasmid pIE1115, complete sequence	7239-7263	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	134706-134730	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP031119	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid p2_000369, complete sequence	4141-4165	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_001740	Escherichia coli plasmid RSF1010, complete sequence	2438-2462	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	219862-219886	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	LC545848	Klebsiella pneumoniae Kp-MW01 plasmid pKp-MW01_KPC DNA, complete sequence	7522-7546	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1690562-1690586	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP040071	Escherichia coli strain A1_181 plasmid p_unnamed4, complete sequence	3955-3979	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	460384-460408	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP030774	Shigella flexneri 1c strain Y394 plasmid pNV-Y394, complete sequence	10822-10846	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP034789	Escherichia coli strain ECCNB20-2 plasmid pTB422, complete sequence	70813-70837	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1690508-1690532	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_016862	Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_S, complete sequence	5669-5693	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	497394-497418	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	211172-211196	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	56166-56190	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	327378-327402	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_005312	Actinobacillus pleuropneumoniae plasmid pMS260, complete sequence	132-156	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NC_021156	Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-2, complete sequence	184-208	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP050719	Salmonella enterica subsp. enterica serovar Enteritidis strain SE95 plasmid pSE95-3, complete sequence	3813-3837	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP037909	Escherichia coli strain LHM10-1 plasmid pLHM10-1, complete sequence	9311-9335	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP045839	Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence	60823-60847	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MH463250	Pseudomonas aeruginosa strain 15.2986 plasmid pPSTRAS1, complete sequence	9662-9686	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MK330869	Klebsiella pneumoniae strain B29 plasmid pB29, complete sequence	1949-1973	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MK330868	Klebsiella pneumoniae strain KPC05 plasmid pKPC05, complete sequence	5171-5195	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MH595533	Klebsiella pneumoniae strain KPN535 plasmid pKPN535a, complete sequence	2158-2182	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MG825383	Escherichia coli strain 1079 plasmid p1079-IncFIB-N, complete sequence	143646-143670	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MH718731	Enterobacter cloacae strain WW13 IncQ1 plasmid pQGU13, complete sequence	15145-15169	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_MH718732	Escherichia coli strain WW16 IncQ1 plasmid pQGU16, complete sequence	13844-13868	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	JN006063	Mycobacterium phage Serendipity, complete genome	20788-20812	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	MH371114	Mycobacterium phage Childish, complete genome	20489-20513	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	KY676783	Mycobacterium phage Chorkpop, complete genome	20485-20509	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	MK112555	Mycobacterium phage Zelda, complete genome	20759-20783	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	KU867907	Mycobacterium phage Potter, complete genome	20482-20506	4	0.84
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	MK112553	Mycobacterium Phage Squiggle, complete genome	20482-20506	4	0.84
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	111611-111635	5	0.8
NZ_CP019875_1	1.1\|1986405\|25\|NZ_CP019875\|CRISPRCasFinder	1986405-1986429	25	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	503541-503565	5	0.8
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP021357	Rhodococcus sp. S2-17 plasmid pRB11, complete sequence	98286-98310	5	0.8
NZ_CP019875_1	1.2\|1986453\|25\|NZ_CP019875\|CRISPRCasFinder	1986453-1986477	25	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	405954-405978	5	0.8

1. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 2, identity: 0.92

accaccaccgcgccagcccccgcca	CRISPR spacer
accaccaccgccacagcccccgcca	Protospacer
***********  ************

2. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 2, identity: 0.92

accaccaccgcgccagcccccgcca	CRISPR spacer
accaccaccgccacagcccccgcca	Protospacer
***********  ************

3. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

4. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

5. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

6. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

7. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

8. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

9. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

10. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

11. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.88

ccatccgccatgccatcca-ccacag	CRISPR spacer
ccatccgccatgccatccaggcact-	Protospacer
*******************  ***

12. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

accaccaccgcgccagcccccgcca	CRISPR spacer
atgaccaccgctccagcccccgcca	Protospacer
*. ******** *************

13. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_AP023209 (Escherichia coli strain TUM18781 plasmid pMTY18781-4, complete sequence) position: , mismatch: 3, identity: 0.88

accaccaccgcgccagcccccgcca	CRISPR spacer
atcaccgccgcgccagcgcccgcca	Protospacer
*.****.********** *******

14. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP034185 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

accaccaccgcgccagcccccgcca	CRISPR spacer
aacaccacctcgcctgcccccgcca	Protospacer
* ******* **** **********

15. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_KU852461 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1004 plasmid pNUC, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

16. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_KP689347 (Klebsiella pneumoniae strain A60136 plasmid p60136, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

17. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_KP205272 (Escherichia coli strain EL-231 plasmid pQEL231, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

18. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP010164 (Escherichia coli strain H2 plasmid A, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

19. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

20. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

21. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP042603 (Escherichia coli strain NCYU-29-69 plasmid pNCYU-29-69-4, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

22. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP022498 (Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

23. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP022498 (Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

24. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP022499 (Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

25. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP053741 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncQ, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

26. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP053727 (Escherichia coli strain CP66-6_Sichuan plasmid pCP66-6-IncQ, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

27. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP044201 (Salmonella enterica subsp. enterica serovar Corvallis strain AR-0406 plasmid pAR-0406-1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

28. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to MN922284 (Actinobacillus pleuropneumoniae strain 1144 plasmid pA1144, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

29. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_010912 (Avibacterium paragallinarum strain A14 plasmid pYMH5, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

30. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP025338 (Salmonella enterica subsp. enterica serovar Typhimurium strain BL10 plasmid p11k, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

31. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP019262 (Escherichia coli strain 13C1065T plasmid p13C1065T-3, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

32. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP044303 (Escherichia coli strain P59A plasmid pP59A-5, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

33. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to MN086778 (Escherichia coli plasmid p16EC-IncN, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

34. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP023480 (Klebsiella quasipneumoniae strain KPC142 plasmid pKQPS142b, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

35. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP053239 (Escherichia coli strain SCU-106 plasmid pSCU-106-5, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

36. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP049937 (Escherichia coli strain JL05 plasmid pARG01, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

37. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP046260 (Escherichia coli strain ECO2947 plasmid p2974-D, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

38. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP053869 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-3, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

39. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

40. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

41. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

42. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

43. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_011378 (Pasteurella multocida plasmid pCCK1900, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

44. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP010408 (Streptomyces vietnamensis strain GIMV4.0001 plasmid pSVL1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccagcaccgcgccagcgcccgccg	Protospacer
.*** ************ ******.

45. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_013104 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSRC15, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

46. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP010245 (Escherichia coli strain S56 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

47. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_002524 (Uncultured eubacterium pIE1115 plasmid pIE1115, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

48. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccaccgcagcagcccccgccg	Protospacer
.**********. ***********.

49. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP031119 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid p2_000369, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

50. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_001740 (Escherichia coli plasmid RSF1010, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

51. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
cccaccgccgcgccagcccgcgccc	Protospacer
 *****.************ ****

52. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to LC545848 (Klebsiella pneumoniae Kp-MW01 plasmid pKp-MW01_KPC DNA, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

53. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

54. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP040071 (Escherichia coli strain A1_181 plasmid p_unnamed4, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

55. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccaccgcgcaggcccccgccg	Protospacer
.************ .*********.

56. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP030774 (Shigella flexneri 1c strain Y394 plasmid pNV-Y394, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

57. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP034789 (Escherichia coli strain ECCNB20-2 plasmid pTB422, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

58. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

59. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_016862 (Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_S, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

60. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

61. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccgccgcggcagcccccgccg	Protospacer
.*****.***** ***********.

62. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccaccgtgcccgcccccgccc	Protospacer
.*********.*** *********

63. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gcgcccaccgcgccggcccccgcca	Protospacer
.*  **********.**********

64. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_005312 (Actinobacillus pleuropneumoniae plasmid pMS260, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

65. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NC_021156 (Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-2, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

66. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP050719 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE95 plasmid pSE95-3, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

67. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP037909 (Escherichia coli strain LHM10-1 plasmid pLHM10-1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

68. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP045839 (Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

69. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MH463250 (Pseudomonas aeruginosa strain 15.2986 plasmid pPSTRAS1, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

70. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MK330869 (Klebsiella pneumoniae strain B29 plasmid pB29, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

71. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MK330868 (Klebsiella pneumoniae strain KPC05 plasmid pKPC05, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

72. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MH595533 (Klebsiella pneumoniae strain KPN535 plasmid pKPN535a, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

73. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MG825383 (Escherichia coli strain 1079 plasmid p1079-IncFIB-N, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

74. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MH718731 (Enterobacter cloacae strain WW13 IncQ1 plasmid pQGU13, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

75. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_MH718732 (Escherichia coli strain WW16 IncQ1 plasmid pQGU16, complete sequence) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
tccaacaccccgccagcccccgccc	Protospacer
 *** **** **************

76. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccacctcgcccgcccccgccg	Protospacer
.******** **** *********.

77. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccacctcgcccgcccccgccg	Protospacer
.******** **** *********.

78. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccacctcgcccgcccccgccg	Protospacer
.******** **** *********.

79. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccacctcgcccgcccccgccg	Protospacer
.******** **** *********.

80. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccacctcgcccgcccccgccg	Protospacer
.******** **** *********.

81. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 4, identity: 0.84

accaccaccgcgccagcccccgcca	CRISPR spacer
gccaccacctcgcccgcccccgccg	Protospacer
.******** **** *********.

82. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP020740 ([Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence) position: , mismatch: 5, identity: 0.8

ccatccgccatgccatccaccacag	CRISPR spacer
agcgccgacatgccatccaccacag	Protospacer
    *** *****************

83. spacer 1.1|1986405|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.8

ccatccgccatgccatccaccacag----	CRISPR spacer
ccatccgccatgccatcca----ggtgct	Protospacer
*******************    .*

84. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP021357 (Rhodococcus sp. S2-17 plasmid pRB11, complete sequence) position: , mismatch: 5, identity: 0.8

accaccaccgcgccagcccccgcca	CRISPR spacer
accaccaccgcgccagcccatctga	Protospacer
******************* . . *

85. spacer 1.2|1986453|25|NZ_CP019875|CRISPRCasFinder matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 5, identity: 0.8

accaccaccgcgccagcccccgcca	CRISPR spacer
accaccaccgcgccagcccatctga	Protospacer
******************* . . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

110492 : 147223

Mycobacterium_phage(14.29%)

integrase,tail,transposase,portal

attL 113142:113201|attR 145822:147231

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078523616.1\|110492_110996_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_078523617.1\|111146_111824_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_078523618.1\|112039_112399_+	DUF937 domain-containing protein	NA	NA	NA	NA
113142:113201	attL	NA	NA	NA	NA
WP_075595799.1\|113199_114543_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078523619.1\|114552_115281_-\|integrase	tyrosine-type recombinase/integrase	K4PAZ9	Burkholderia_phage	1.6e-10	28.8
WP_167370142.1\|115467_115638_-	hypothetical protein	NA	NA	NA	NA
WP_078523620.1\|115634_115874_-	DUF3310 domain-containing protein	A0A088FRG2	Mycobacterium_phage	2.2e-20	62.2
WP_078523621.1\|116020_116923_-	hypothetical protein	A0A1X9SGW9	Bradyrhizobium_phage	5.5e-72	49.4
WP_078523623.1\|117152_117626_-	hypothetical protein	NA	NA	NA	NA
WP_078523624.1\|117622_118027_-	hypothetical protein	NA	NA	NA	NA
WP_078523625.1\|118023_118623_-	hypothetical protein	NA	NA	NA	NA
WP_078523626.1\|118609_118816_-	hypothetical protein	NA	NA	NA	NA
WP_078523627.1\|118812_119490_-	hypothetical protein	G9FH01	Rhodococcus_phage	1.9e-32	48.5
WP_110571365.1\|119486_120179_-	hypothetical protein	A0A2L0HJW4	Mycobacterium_phage	6.3e-44	41.1
WP_078523629.1\|120178_120382_-	hypothetical protein	NA	NA	NA	NA
WP_146220889.1\|120378_120684_-	hypothetical protein	A0A2K8HLR2	Pseudomonas_phage	8.1e-20	52.2
WP_078523631.1\|120942_121290_-	hypothetical protein	NA	NA	NA	NA
WP_078523632.1\|121482_122271_-	hypothetical protein	NA	NA	NA	NA
WP_146220891.1\|122273_123020_-	hypothetical protein	A5LH75	Enterobacteria_phage	4.4e-19	51.9
WP_078523634.1\|123932_124301_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078523635.1\|124393_124609_+	hypothetical protein	NA	NA	NA	NA
WP_078527532.1\|124845_125397_+	hypothetical protein	NA	NA	NA	NA
WP_078523636.1\|125393_125603_+	hypothetical protein	NA	NA	NA	NA
WP_078523637.1\|125602_126061_+	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	2.3e-34	56.6
WP_146220892.1\|126075_126387_+	hypothetical protein	K4F726	Cronobacter_phage	8.5e-17	46.2
WP_167370143.1\|126588_126732_-	hypothetical protein	NA	NA	NA	NA
WP_146220893.1\|126815_127256_+	hypothetical protein	NA	NA	NA	NA
WP_078523640.1\|127537_127753_+	hypothetical protein	NA	NA	NA	NA
WP_078523641.1\|127749_128166_+	hypothetical protein	NA	NA	NA	NA
WP_078523642.1\|128162_128999_+	hypothetical protein	NA	NA	NA	NA
WP_078523643.1\|128995_129466_+	hypothetical protein	NA	NA	NA	NA
WP_167370144.1\|129470_130424_+	YdaU family protein	H2BD69	Pseudomonas_phage	1.3e-31	48.5
WP_078523645.1\|130426_131218_+	hypothetical protein	NA	NA	NA	NA
WP_151892014.1\|131779_132004_+	hypothetical protein	NA	NA	NA	NA
WP_078523650.1\|132396_132612_+	hypothetical protein	NA	NA	NA	NA
WP_078523651.1\|132625_133168_+	hypothetical protein	NA	NA	NA	NA
WP_078527534.1\|133478_133922_+	hypothetical protein	A0A0B5A1T2	Achromobacter_phage	3.0e-15	44.1
WP_078527536.1\|133933_135232_+	DNA packaging protein	A0A0U4IJ26	Arthrobacter_phage	1.7e-34	35.8
WP_078523652.1\|135247_136765_+\|portal	portal protein	NA	NA	NA	NA
WP_078523653.1\|136809_137400_+	hypothetical protein	NA	NA	NA	NA
WP_078523654.1\|137486_138854_+	DUF4043 domain-containing protein	NA	NA	NA	NA
WP_110571367.1\|138883_139105_+	hypothetical protein	NA	NA	NA	NA
WP_078523656.1\|139071_139470_+	hypothetical protein	NA	NA	NA	NA
WP_078523657.1\|139480_139690_+	hypothetical protein	S4TU80	Salmonella_phage	1.0e-10	58.5
WP_078523658.1\|139690_139885_+	hypothetical protein	NA	NA	NA	NA
WP_078523659.1\|139884_140562_+	hypothetical protein	NA	NA	NA	NA
WP_078523660.1\|140561_141443_+	hypothetical protein	NA	NA	NA	NA
WP_078523661.1\|141462_141654_+	hypothetical protein	NA	NA	NA	NA
WP_078523662.1\|141657_143145_+\|tail	phage tail protein	B3GAJ6	uncultured_virus	3.8e-70	37.7
WP_078523663.1\|143195_143627_+	hypothetical protein	NA	NA	NA	NA
WP_078523664.1\|143623_143971_+	hypothetical protein	NA	NA	NA	NA
WP_078523665.1\|143985_144168_+	hypothetical protein	NA	NA	NA	NA
WP_078523666.1\|144164_144677_+	hypothetical protein	NA	NA	NA	NA
WP_075595799.1\|145879_147223_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
145822:147231	attR	NA	NA	NA	NA

DBSCAN-SWA_2

328524 : 344683

EBPR_podovirus(33.33%)

plate,portal,tail,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078523849.1\|328524_328923_+\|terminase	terminase small subunit	F8TUR4	EBPR_podovirus	3.3e-13	40.7
WP_078523851.1\|328906_330223_+	DNA packaging protein	Q1WDG8	Streptomyces_phage	4.0e-31	45.1
WP_078523853.1\|330451_331864_+\|portal	portal protein	NA	NA	NA	NA
WP_078523855.1\|331889_332390_+	hypothetical protein	NA	NA	NA	NA
WP_078527588.1\|333240_334593_+	DUF4043 domain-containing protein	NA	NA	NA	NA
WP_167370244.1\|334822_335206_+	hypothetical protein	NA	NA	NA	NA
WP_078523859.1\|335205_335856_+	hypothetical protein	NA	NA	NA	NA
WP_151892016.1\|335880_336638_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_078523861.1\|336724_337597_+	hypothetical protein	NA	NA	NA	NA
WP_078523863.1\|337696_339184_+\|tail	phage tail protein	B3GAJ6	uncultured_virus	5.4e-77	40.7
WP_078523865.1\|339343_339775_+	hypothetical protein	NA	NA	NA	NA
WP_078523867.1\|339798_340110_+	hypothetical protein	NA	NA	NA	NA
WP_165399179.1\|340121_340283_+	hypothetical protein	NA	NA	NA	NA
WP_146220935.1\|340319_340847_-	hypothetical protein	NA	NA	NA	NA
WP_146220934.1\|340893_341301_+	hypothetical protein	NA	NA	NA	NA
WP_078523872.1\|341351_342269_+	hypothetical protein	NA	NA	NA	NA
WP_078523873.1\|342287_342497_+	hypothetical protein	NA	NA	NA	NA
WP_078523874.1\|342493_343651_+	hypothetical protein	NA	NA	NA	NA
WP_078523876.1\|343643_344324_+\|plate	baseplate assembly protein	NA	NA	NA	NA
WP_078523878.1\|344320_344683_+\|tail	phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_3

1066976 : 1189942

112

Stx2-converting_phage(10.53%)

protease,tRNA,integrase,transposase

attL 1120143:1120202|attR 1194982:1197538

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078524580.1\|1066976_1067660_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_078524581.1\|1067743_1068718_+	D-glycerate dehydrogenase	M1NSB9	Streptococcus_phage	5.2e-20	26.8
WP_078524582.1\|1068743_1068944_+	hypothetical protein	NA	NA	NA	NA
WP_078527708.1\|1069045_1069891_-	EcsC family protein	NA	NA	NA	NA
WP_078524583.1\|1070069_1070483_-	EVE domain-containing protein	NA	NA	NA	NA
WP_078524584.1\|1070492_1070786_-	YciI family protein	NA	NA	NA	NA
WP_078527710.1\|1070963_1071767_+	heme ABC transporter permease	NA	NA	NA	NA
WP_078524585.1\|1071763_1071910_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_078524586.1\|1071906_1072431_+	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_078524587.1\|1072450_1074430_+	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_078524588.1\|1074426_1074999_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_078524589.1\|1074995_1075475_+	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_078524590.1\|1075482_1076205_+	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_078524591.1\|1076290_1076470_+	DUF1674 domain-containing protein	NA	NA	NA	NA
WP_078524592.1\|1076581_1077100_-	hypothetical protein	NA	NA	NA	NA
WP_078524593.1\|1077124_1078294_-	serine hydrolase	NA	NA	NA	NA
WP_078527712.1\|1078485_1081059_+	insulinase family protein	A0A2K9LA15	Tupanvirus	6.2e-12	27.7
WP_078524594.1\|1081156_1082854_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_078524595.1\|1083130_1083772_-	(d)CMP kinase	NA	NA	NA	NA
WP_078524596.1\|1083768_1085121_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_078527714.1\|1085301_1085637_+	TIGR02300 family protein	NA	NA	NA	NA
WP_078524597.1\|1085678_1086077_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_078524598.1\|1086102_1086882_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_078524599.1\|1086878_1087475_-	recombination protein RecR	NA	NA	NA	NA
WP_078524600.1\|1087497_1087821_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_078524601.1\|1087836_1089831_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	8.4e-41	35.7
WP_078527716.1\|1090056_1091832_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_078524602.1\|1091885_1092692_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_078524603.1\|1092829_1093951_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_075595799.1\|1094135_1095479_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078527718.1\|1095687_1096095_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.0e-14	44.7
WP_078524604.1\|1096256_1098587_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-179	44.8
WP_078524605.1\|1098723_1099053_+	YnfA family protein	A0A2H4JF35	uncultured_Caudovirales_phage	3.0e-20	50.0
WP_078524606.1\|1099166_1099757_-	DUF3465 domain-containing protein	NA	NA	NA	NA
WP_078524607.1\|1099814_1100741_-	polyphosphate--nucleotide phosphotransferase	NA	NA	NA	NA
WP_078524608.1\|1100743_1101502_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_078524609.1\|1101631_1102216_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_078524610.1\|1103116_1104193_-	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_078524611.1\|1104237_1105437_-	gluconolactonase	NA	NA	NA	NA
WP_110571436.1\|1105535_1106849_-	cytochrome c	NA	NA	NA	NA
WP_078524613.1\|1106878_1108666_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_078524614.1\|1108662_1109358_-	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_075595799.1\|1109490_1110834_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078524615.1\|1111741_1111990_+	hypothetical protein	NA	NA	NA	NA
WP_078524616.1\|1111986_1112409_+	hypothetical protein	NA	NA	NA	NA
WP_078524617.1\|1112405_1112915_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_078524618.1\|1112911_1114093_+	hypothetical protein	NA	NA	NA	NA
WP_078524619.1\|1114067_1114673_+	hypothetical protein	NA	NA	NA	NA
WP_078524620.1\|1114676_1117019_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_078524621.1\|1117015_1118332_+	DUF1173 family protein	NA	NA	NA	NA
WP_078524622.1\|1118607_1120173_+	cell filamentation protein Fic	NA	NA	NA	NA
1120143:1120202	attL	NA	NA	NA	NA
WP_071406638.1\|1120307_1120691_+\|transposase	transposase	NA	NA	NA	NA
WP_019092242.1\|1120687_1121035_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
WP_078524623.1\|1121100_1122669_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	3.2e-104	44.9
WP_010517031.1\|1123105_1123591_-	transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	4.0e-21	47.5
WP_025440083.1\|1123727_1124951_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.7e-39	42.7
WP_078524624.1\|1125541_1128760_-	relaxase domain-containing protein	NA	NA	NA	NA
WP_026018817.1\|1128759_1129056_-	hypothetical protein	NA	NA	NA	NA
WP_019086977.1\|1129107_1129401_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	7.5e-15	51.7
WP_026018818.1\|1129460_1130213_-	antirepressor	G8I4Q8	Mycobacterium_phage	1.6e-13	37.8
WP_078524625.1\|1130267_1130450_+	hypothetical protein	NA	NA	NA	NA
WP_078524626.1\|1130603_1131179_+	hypothetical protein	NA	NA	NA	NA
WP_078524627.1\|1131182_1132013_+	hypothetical protein	NA	NA	NA	NA
WP_078524628.1\|1132012_1132507_+	hypothetical protein	NA	NA	NA	NA
WP_078524629.1\|1132617_1133430_+	hypothetical protein	NA	NA	NA	NA
WP_078524630.1\|1133443_1133851_+	hypothetical protein	NA	NA	NA	NA
WP_078524631.1\|1134203_1134506_-	hypothetical protein	NA	NA	NA	NA
WP_078524632.1\|1134576_1135257_-	hypothetical protein	NA	NA	NA	NA
WP_078524633.1\|1135778_1136213_-	cupin domain-containing protein	NA	NA	NA	NA
WP_025440083.1\|1136867_1138091_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.7e-39	42.7
WP_078524634.1\|1138653_1139148_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078524635.1\|1139326_1139908_+	NERD domain-containing protein	NA	NA	NA	NA
WP_078524636.1\|1139901_1140336_-	hypothetical protein	NA	NA	NA	NA
WP_146220925.1\|1141680_1142076_-	hypothetical protein	NA	NA	NA	NA
WP_146220924.1\|1142305_1142929_-	hypothetical protein	NA	NA	NA	NA
WP_078524638.1\|1142930_1145165_-	hypothetical protein	NA	NA	NA	NA
WP_078524639.1\|1145371_1145986_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_078524640.1\|1146184_1152283_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_078527720.1\|1152279_1154016_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_167370173.1\|1154045_1154639_-	hypothetical protein	NA	NA	NA	NA
WP_078524642.1\|1155335_1155614_+	hypothetical protein	NA	NA	NA	NA
WP_078524643.1\|1155604_1156012_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_078524644.1\|1156188_1156692_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.0e-19	45.5
WP_078527722.1\|1156943_1157279_-	hypothetical protein	NA	NA	NA	NA
WP_078524646.1\|1157955_1158978_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.5e-21	32.0
WP_014106778.1\|1160741_1161212_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	7.6e-33	51.3
WP_078524647.1\|1161576_1162089_+	hypothetical protein	NA	NA	NA	NA
WP_078524648.1\|1162085_1162592_-	hypothetical protein	NA	NA	NA	NA
WP_078524649.1\|1162588_1162978_-	hypothetical protein	NA	NA	NA	NA
WP_053324062.1\|1162974_1163370_-	hypothetical protein	NA	NA	NA	NA
WP_078524650.1\|1163415_1164315_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	1.1e-59	42.3
WP_167370174.1\|1164387_1164543_-	hypothetical protein	NA	NA	NA	NA
WP_010515655.1\|1164761_1165277_-	DUF3085 domain-containing protein	NA	NA	NA	NA
WP_010515656.1\|1165399_1165708_-	hypothetical protein	NA	NA	NA	NA
WP_078524651.1\|1165739_1166771_-	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_078524652.1\|1166928_1167342_-	hypothetical protein	NA	NA	NA	NA
WP_078524653.1\|1167334_1167673_-	hypothetical protein	NA	NA	NA	NA
WP_078524654.1\|1167856_1169782_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_078524655.1\|1169959_1175059_-	lactate dehydrogenase	I6NW45	Burkholderia_virus	0.0e+00	39.3
WP_010511482.1\|1176200_1177019_-	replication initiator protein A	A0A0K1Y6J9	Rhodobacter_phage	1.3e-40	37.5
WP_075595799.1\|1177642_1178986_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_167370248.1\|1179208_1180015_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078524657.1\|1180019_1180679_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_078524658.1\|1180783_1181353_+	hydrolase	NA	NA	NA	NA
WP_167370249.1\|1181397_1182801_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_078524660.1\|1182858_1183326_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_075595799.1\|1183467_1184811_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078524661.1\|1184874_1185543_+	methyltransferase	NA	NA	NA	NA
WP_167370175.1\|1185649_1185787_+	hypothetical protein	NA	NA	NA	NA
WP_078524662.1\|1185855_1186980_+	alkene reductase	NA	NA	NA	NA
WP_078527724.1\|1187098_1187404_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078524663.1\|1188496_1189942_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1194982:1197538	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1194126 : 1258980

Stx2-converting_phage(28.57%)

protease,integrase,transposase

attL 1183409:1183468|attR 1211668:1213125

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1183409:1183468	attL	NA	NA	NA	NA
WP_078524666.1\|1194126_1195038_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_071406638.1\|1195146_1195530_+\|transposase	transposase	NA	NA	NA	NA
WP_019092242.1\|1195526_1195874_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
WP_078524623.1\|1195939_1197508_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	3.2e-104	44.9
WP_078524667.1\|1198306_1200766_-	S8 family peptidase	NA	NA	NA	NA
WP_078524668.1\|1200785_1201769_-	ATP-binding protein	R4TQL5	Phaeocystis_globosa_virus	2.6e-19	31.3
WP_078524669.1\|1201907_1202204_-\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA
WP_165399223.1\|1202217_1203018_-	hypothetical protein	A1YJ10	Spodoptera_frugiperda_nuclear_polyhedrosis_virus	5.3e-18	30.5
WP_078524671.1\|1203429_1205103_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_078524672.1\|1205105_1206029_+	TniB family NTP-binding protein	NA	NA	NA	NA
WP_078524673.1\|1206025_1207054_+	TniQ family protein	NA	NA	NA	NA
WP_078527728.1\|1207663_1208797_+\|transposase	transposase	NA	NA	NA	NA
WP_078524674.1\|1208786_1209563_+	hypothetical protein	A0A1B1IVW1	uncultured_Mediterranean_phage	1.1e-09	26.5
WP_078527730.1\|1210101_1210881_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	4.3e-33	37.2
WP_075595799.1\|1211726_1213070_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_110571345.1\|1214055_1215121_+\|transposase	IS630 family transposase	NA	NA	NA	NA
1211668:1213125	attR	NA	NA	NA	NA
WP_078524675.1\|1215687_1217025_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_007396721.1\|1217021_1217693_-	response regulator transcription factor	NA	NA	NA	NA
WP_019086193.1\|1217692_1220767_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_019086194.1\|1220766_1221918_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_019086195.1\|1221914_1223171_-	TolC family protein	NA	NA	NA	NA
WP_019086196.1\|1223182_1223524_-	hypothetical protein	NA	NA	NA	NA
WP_075595799.1\|1223663_1225007_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_075595799.1\|1225354_1226698_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078527732.1\|1227795_1228095_-	hypothetical protein	NA	NA	NA	NA
WP_167331482.1\|1228197_1228350_-	transcriptional regulator	NA	NA	NA	NA
WP_019086198.1\|1228419_1229088_-	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	5.9e-15	39.8
WP_039736669.1\|1229472_1229772_-	WGR domain-containing protein	NA	NA	NA	NA
WP_078524676.1\|1230313_1230703_+	hypothetical protein	NA	NA	NA	NA
WP_025440167.1\|1230766_1231771_+	thiol:disulfide interchange protein	NA	NA	NA	NA
WP_025440166.1\|1231767_1232304_+	hypothetical protein	NA	NA	NA	NA
WP_078524677.1\|1232355_1232661_-	hypothetical protein	NA	NA	NA	NA
WP_019086203.1\|1232709_1233207_-	hypothetical protein	NA	NA	NA	NA
WP_078524678.1\|1233231_1235592_-	DotA/TraY family protein	NA	NA	NA	NA
WP_078524679.1\|1235614_1237027_-	hypothetical protein	NA	NA	NA	NA
WP_078524680.1\|1237036_1238221_-	hypothetical protein	NA	NA	NA	NA
WP_010515543.1\|1238220_1238808_-	hypothetical protein	NA	NA	NA	NA
WP_010515542.1\|1238804_1239149_-	hypothetical protein	NA	NA	NA	NA
WP_029329627.1\|1239192_1239570_+	hypothetical protein	NA	NA	NA	NA
WP_048883528.1\|1239913_1240717_+	transcriptional regulator	NA	NA	NA	NA
WP_078524681.1\|1241039_1241843_+	hypothetical protein	NA	NA	NA	NA
WP_014106834.1\|1241975_1242611_+	DotI/IcmL/TraM family protein	NA	NA	NA	NA
WP_078524682.1\|1242607_1243588_+	type IV secretion protein DotH	NA	NA	NA	NA
WP_078524683.1\|1243587_1244826_+	type IV secretion protein DotG	NA	NA	NA	NA
WP_029335995.1\|1245258_1246224_+	hypothetical protein	NA	NA	NA	NA
WP_010511980.1\|1246241_1246787_+	hypothetical protein	NA	NA	NA	NA
WP_048852463.1\|1247695_1247968_+	BrnT family toxin	NA	NA	NA	NA
WP_003625676.1\|1247936_1248215_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078524684.1\|1248402_1248873_+	hypothetical protein	NA	NA	NA	NA
WP_078524685.1\|1248886_1249549_+	hypothetical protein	NA	NA	NA	NA
WP_078524686.1\|1249562_1252646_+	secretion protein	NA	NA	NA	NA
WP_167370176.1\|1252741_1253011_-	DNA-binding protein	NA	NA	NA	NA
WP_010512313.1\|1253442_1254126_+	hypothetical protein	NA	NA	NA	NA
WP_078527736.1\|1254340_1254904_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_048852619.1\|1254906_1255563_-	DUF433 domain-containing protein	NA	NA	NA	NA
WP_078524687.1\|1255783_1256242_+	DotD/TraH family lipoprotein	NA	NA	NA	NA
WP_110095210.1\|1256234_1257275_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_075595799.1\|1257636_1258980_+\|transposase	IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1605383 : 1631719

Thermus_phage(11.11%)

tail,terminase,head,integrase,transposase

attL 1609658:1609717|attR 1638093:1639550

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078524646.1\|1605383_1606406_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.5e-21	32.0
WP_167370184.1\|1606791_1608423_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_061273614.1\|1608537_1608951_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_167370185.1\|1609131_1609656_-\|integrase	tyrosine-type recombinase/integrase	A0A068CCA6	Rhizobium_phage	3.4e-18	36.3
1609658:1609717	attL	NA	NA	NA	NA
WP_075595799.1\|1609714_1611058_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_151892023.1\|1611067_1611466_-	hypothetical protein	NA	NA	NA	NA
WP_167370186.1\|1611528_1611840_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078525146.1\|1611832_1612276_-	hypothetical protein	NA	NA	NA	NA
WP_078525148.1\|1612272_1612512_-	hypothetical protein	NA	NA	NA	NA
WP_078525150.1\|1612508_1613192_-	DUF2786 domain-containing protein	L7P7W8	Pseudomonas_phage	8.7e-22	36.9
WP_078525151.1\|1613188_1614073_-	hypothetical protein	NA	NA	NA	NA
WP_078525153.1\|1614069_1614456_-	hypothetical protein	T1S9H7	Salmonella_phage	9.3e-21	53.4
WP_078525154.1\|1614452_1614965_-	hypothetical protein	NA	NA	NA	NA
WP_078525156.1\|1614961_1615417_-	hypothetical protein	NA	NA	NA	NA
WP_078525157.1\|1615416_1615674_-	hypothetical protein	NA	NA	NA	NA
WP_078525159.1\|1615792_1616113_-	hypothetical protein	NA	NA	NA	NA
WP_078525160.1\|1616109_1616406_-	hypothetical protein	NA	NA	NA	NA
WP_078525162.1\|1616402_1616675_-	hypothetical protein	NA	NA	NA	NA
WP_110569679.1\|1616671_1617067_-	hypothetical protein	NA	NA	NA	NA
WP_078527825.1\|1617152_1617503_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_110569678.1\|1617596_1617857_+	hypothetical protein	NA	NA	NA	NA
WP_078525165.1\|1617904_1618831_-	hypothetical protein	NA	NA	NA	NA
WP_078525167.1\|1619051_1619624_+	hypothetical protein	NA	NA	NA	NA
WP_078525169.1\|1619623_1619833_+	hypothetical protein	NA	NA	NA	NA
WP_078525171.1\|1620014_1620263_+	hypothetical protein	NA	NA	NA	NA
WP_078525173.1\|1620247_1620520_+	hypothetical protein	NA	NA	NA	NA
WP_078525175.1\|1620516_1621722_+	hypothetical protein	NA	NA	NA	NA
WP_078525177.1\|1621843_1622434_-	hypothetical protein	NA	NA	NA	NA
WP_078525179.1\|1622809_1623391_+	hypothetical protein	NA	NA	NA	NA
WP_078525181.1\|1623504_1623912_+	hypothetical protein	NA	NA	NA	NA
WP_146220895.1\|1623965_1624238_+	hypothetical protein	NA	NA	NA	NA
WP_078525183.1\|1624644_1625520_+\|integrase	tyrosine-type recombinase/integrase	Q9ZWV7	Corynephage	6.8e-11	28.3
WP_078525185.1\|1625564_1625744_+	hypothetical protein	NA	NA	NA	NA
WP_078525187.1\|1625740_1626349_+	DUF3164 family protein	A0A1B0T6G5	Thiobacimonas_phage	5.7e-49	46.5
WP_078525189.1\|1626590_1627388_+	DNA adenine methylase	A0A219VHB5	Ochrobactrum_phage	3.4e-78	58.0
WP_078525191.1\|1627413_1628028_+	hypothetical protein	NA	NA	NA	NA
WP_078525193.1\|1628030_1628672_+	hypothetical protein	A0A0K1LMA6	Rhodobacter_phage	2.3e-24	35.5
WP_167370187.1\|1628825_1629398_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078525197.1\|1629375_1631397_+\|terminase	phage terminase large subunit family protein	G8EXZ6	Synechococcus_phage	3.3e-141	46.9
WP_078525199.1\|1631422_1631719_+\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
1638093:1639550	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2283479 : 2336687

Bacillus_virus(15.38%)

tail,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078524646.1\|2283479_2284502_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.5e-21	32.0
WP_078526052.1\|2284816_2285143_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078526054.1\|2285262_2285514_+	hypothetical protein	NA	NA	NA	NA
WP_110571249.1\|2285576_2286089_+	nucleoside deaminase	NA	NA	NA	NA
WP_078526056.1\|2286335_2288444_+	acylase	NA	NA	NA	NA
WP_078526058.1\|2288669_2290709_+	M1 family metallopeptidase	NA	NA	NA	NA
WP_078526060.1\|2290931_2293385_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_078526062.1\|2293655_2294165_-	hypothetical protein	NA	NA	NA	NA
WP_078527979.1\|2294365_2294590_+	hypothetical protein	NA	NA	NA	NA
WP_078526064.1\|2294839_2295790_-	HlyD family secretion protein	NA	NA	NA	NA
WP_061273645.1\|2295802_2295997_-	DUF1656 domain-containing protein	NA	NA	NA	NA
WP_110571255.1\|2295996_2298021_-	FUSC family protein	NA	NA	NA	NA
WP_078526068.1\|2298164_2299562_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_019087433.1\|2299645_2299795_-	hypothetical protein	NA	NA	NA	NA
WP_078526070.1\|2299971_2300829_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_061273711.1\|2300900_2301095_-	Trm112 family protein	NA	NA	NA	NA
WP_078526071.1\|2301131_2301902_-	peptidase	NA	NA	NA	NA
WP_078526073.1\|2301898_2302864_-	tetratricopeptide repeat protein	A0A1J0GW78	Streptomyces_phage	5.7e-11	39.6
WP_146220825.1\|2303123_2303330_+	hypothetical protein	NA	NA	NA	NA
WP_078527981.1\|2303346_2303547_+	hypothetical protein	NA	NA	NA	NA
WP_167370256.1\|2303559_2304582_-	transporter	NA	NA	NA	NA
WP_078527983.1\|2304740_2305139_-	DUF3597 domain-containing protein	NA	NA	NA	NA
WP_078526077.1\|2305204_2306503_-	adenosylhomocysteinase	S4W1G4	Pandoravirus	2.4e-52	33.9
WP_078526079.1\|2306582_2307608_-	membrane dipeptidase	NA	NA	NA	NA
WP_078526081.1\|2307796_2308630_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	8.6e-56	41.2
WP_078526083.1\|2308793_2309927_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
WP_078526085.1\|2309961_2310585_+	peroxiredoxin	NA	NA	NA	NA
WP_078526087.1\|2310880_2311612_+	CbtA family protein	NA	NA	NA	NA
WP_078526089.1\|2311602_2312811_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_078526091.1\|2313005_2314139_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_078527985.1\|2314283_2316521_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.9e-12	28.4
WP_078526093.1\|2316629_2318354_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.4e-15	32.8
WP_078526094.1\|2318350_2318800_+	hypothetical protein	NA	NA	NA	NA
WP_078526098.1\|2320208_2320850_-	hypothetical protein	NA	NA	NA	NA
WP_078526099.1\|2320888_2321275_+	error-prone repair protein UmuD	NA	NA	NA	NA
WP_078526101.1\|2321278_2322541_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	2.1e-85	41.1
WP_078527987.1\|2322545_2323289_-	hypothetical protein	NA	NA	NA	NA
WP_110571252.1\|2323421_2323634_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_078526104.1\|2323636_2324062_+	type II toxin-antitoxin system HicB family antitoxin	Q7Y3V7	Yersinia_phage	2.4e-14	38.8
WP_146220826.1\|2324084_2324372_+	hypothetical protein	NA	NA	NA	NA
WP_078526105.1\|2324620_2325247_-	hypothetical protein	NA	NA	NA	NA
WP_078526107.1\|2325406_2325757_-	hypothetical protein	NA	NA	NA	NA
WP_078526109.1\|2325817_2326156_-	hypothetical protein	NA	NA	NA	NA
WP_078526111.1\|2326157_2326628_-	structural protein	A0A0M4TU77	Ralstonia_phage	2.4e-15	38.4
WP_078526113.1\|2326624_2326933_-	hypothetical protein	NA	NA	NA	NA
WP_078526115.1\|2328652_2329249_-	YmfQ family protein	NA	NA	NA	NA
WP_078526117.1\|2329242_2330367_-\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	7.2e-13	29.3
WP_078526119.1\|2330368_2330869_-	phage GP46 family protein	A0A2P9JZK5	Alteromonadaceae_phage	1.1e-08	32.0
WP_078526121.1\|2330892_2331405_-\|plate	phage baseplate assembly protein	NA	NA	NA	NA
WP_078526123.1\|2331401_2332619_-\|tail	phage tail protein	Q8SBG7	Shigella_phage	3.7e-23	29.3
WP_078526125.1\|2332615_2333914_-	DNA circularization N-terminal domain-containing protein	Q8W619	Enterobacteria_phage	5.0e-18	26.8
WP_078526127.1\|2333915_2335952_-\|tail	phage tail protein	NA	NA	NA	NA
WP_078526129.1\|2336081_2336687_-\|tail	phage tail assembly protein	NA	NA	NA	NA

DBSCAN-SWA_7

2391869 : 2460283

Streptococcus_phage(11.11%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078526221.1\|2391869_2392442_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_078526223.1\|2392448_2393543_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_078526225.1\|2393589_2394873_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	4.7e-93	48.3
WP_078526227.1\|2394892_2395525_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_078527999.1\|2395614_2396064_+	ribosome silencing factor	NA	NA	NA	NA
WP_078526229.1\|2396067_2396529_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_167370209.1\|2396603_2397299_-	CHAP domain-containing protein	NA	NA	NA	NA
WP_078526233.1\|2397683_2398034_-	RidA family protein	NA	NA	NA	NA
WP_078526235.1\|2398114_2398753_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_078526237.1\|2398749_2399835_-	XdhC family protein	NA	NA	NA	NA
WP_078526239.1\|2399964_2400345_+	attachment protein	NA	NA	NA	NA
WP_078528001.1\|2400420_2401080_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_078526240.1\|2401115_2401628_+	DUF192 domain-containing protein	NA	NA	NA	NA
WP_151892034.1\|2407576_2408727_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.1e-56	46.0
WP_078526242.1\|2408863_2409586_-	hypothetical protein	G9IA57	Pseudomonas_phage	4.3e-35	38.3
WP_078526244.1\|2409668_2410370_-	hypothetical protein	NA	NA	NA	NA
WP_078526246.1\|2410375_2411215_-	nucleotide-binding protein	NA	NA	NA	NA
WP_167370210.1\|2411231_2411918_-	type III restriction endonuclease subunit R	NA	NA	NA	NA
WP_167370257.1\|2411914_2412046_-	hypothetical protein	NA	NA	NA	NA
WP_167370211.1\|2412000_2416320_-	DEAD/DEAH box helicase family protein	A0A1V0SLK7	Klosneuvirus	1.4e-24	23.1
WP_075595799.1\|2417356_2418700_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_075595799.1\|2418809_2420153_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078526248.1\|2421169_2421469_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_078526250.1\|2421468_2421711_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_078526252.1\|2422307_2423678_+	hypothetical protein	NA	NA	NA	NA
WP_078526254.1\|2424743_2425424_+	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	6.6e-30	37.7
WP_078526256.1\|2425729_2425984_+	hypothetical protein	NA	NA	NA	NA
WP_078526258.1\|2426033_2426519_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_075595799.1\|2426877_2428221_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_146220926.1\|2428443_2428980_+	hypothetical protein	NA	NA	NA	NA
WP_078528005.1\|2429111_2429720_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_078526262.1\|2429995_2431138_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_078526264.1\|2431143_2434269_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_078526266.1\|2434273_2435770_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_078526268.1\|2435842_2436250_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_078526270.1\|2436383_2436668_+	hypothetical protein	NA	NA	NA	NA
WP_165399157.1\|2436690_2436843_+	hypothetical protein	NA	NA	NA	NA
WP_078526272.1\|2436843_2437140_+	hypothetical protein	NA	NA	NA	NA
WP_078526274.1\|2437122_2438061_-	glycosyl transferase	NA	NA	NA	NA
WP_078526276.1\|2438110_2438914_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_078526284.1\|2438910_2440479_-	hypothetical protein	NA	NA	NA	NA
WP_078528007.1\|2440932_2441601_+	hypothetical protein	NA	NA	NA	NA
WP_078526286.1\|2441733_2443176_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	7.0e-45	29.2
WP_078526287.1\|2443350_2444343_+	phosphate ABC transporter substrate-binding protein PstS	A0A222YW41	Synechococcus_phage	8.7e-39	36.2
WP_167370212.1\|2444507_2445863_+	porin	NA	NA	NA	NA
WP_110571468.1\|2445877_2446934_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_078526289.1\|2447326_2448568_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_078526291.1\|2449227_2449995_+	polyprenol monophosphomannose synthase	A0A0N7A8R9	Sulfolobus_monocaudavirus	1.7e-10	31.0
WP_078526294.1\|2451585_2452605_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_078526296.1\|2452601_2453456_-	hypothetical protein	NA	NA	NA	NA
WP_078528009.1\|2453458_2456092_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.8e-147	38.3
WP_078526298.1\|2456187_2456721_-	DUF3576 domain-containing protein	NA	NA	NA	NA
WP_078528011.1\|2456949_2459010_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_075595799.1\|2458939_2460283_-\|transposase	IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

2890311 : 2902792

Enterobacteria_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151892016.1\|2890311_2891069_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_078526880.1\|2893317_2895381_+	AAA family ATPase	NA	NA	NA	NA
WP_151892016.1\|2897324_2898081_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_078526881.1\|2898012_2898474_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	2.0e-22	49.2
WP_006117282.1\|2898470_2898794_-\|transposase	transposase	B6ETC4	Enterobacteria_phage	1.3e-20	50.5
WP_167370220.1\|2899260_2900061_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.8e-35	56.5
WP_167370221.1\|2900552_2901668_-	DUF1524 domain-containing protein	NA	NA	NA	NA
WP_110571468.1\|2901735_2902792_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2913109 : 2958080

Leptospira_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110571468.1\|2913109_2914167_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_110571456.1\|2914251_2914485_+	hypothetical protein	NA	NA	NA	NA
WP_078526895.1\|2914529_2914682_-\|transposase	transposase	NA	NA	NA	NA
WP_167370224.1\|2914697_2914844_-	hypothetical protein	NA	NA	NA	NA
WP_078526896.1\|2916039_2916954_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_078526897.1\|2917174_2918071_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_078526898.1\|2919943_2921854_-	hypothetical protein	NA	NA	NA	NA
WP_110571468.1\|2921938_2922995_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_078526899.1\|2923174_2923528_-\|transposase	transposase	S5WIU1	Leptospira_phage	9.1e-07	48.0
WP_167370225.1\|2924870_2925311_+	glycoside hydrolase family protein	A0A2I7S753	Vibrio_phage	9.6e-06	37.5
WP_078526901.1\|2925310_2925748_+	hypothetical protein	NA	NA	NA	NA
WP_078526902.1\|2925946_2926954_-	aldo/keto reductase	NA	NA	NA	NA
WP_167370226.1\|2927788_2928229_+	glycoside hydrolase family protein	B7SSN6	Bacillus_phage	1.0e-07	37.8
WP_078526904.1\|2928228_2928666_+	hypothetical protein	NA	NA	NA	NA
WP_078526906.1\|2930210_2930711_-	carboxylesterase family protein	NA	NA	NA	NA
WP_075595799.1\|2930784_2932128_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078526908.1\|2932137_2933187_-	carboxylesterase family protein	NA	NA	NA	NA
WP_078526910.1\|2933220_2934015_-	ABC transporter permease	NA	NA	NA	NA
WP_078526912.1\|2934011_2934860_-	ABC transporter permease	NA	NA	NA	NA
WP_078526914.1\|2934856_2936104_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-22	32.0
WP_078526918.1\|2937019_2938021_-	peptidase M19	NA	NA	NA	NA
WP_078526920.1\|2938059_2939502_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_078526922.1\|2939498_2940512_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_078528108.1\|2942007_2944236_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_078526924.1\|2944309_2946385_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_078526926.1\|2946375_2948367_+	hydantoinase B/oxoprolinase family protein	NA	NA	NA	NA
WP_078526928.1\|2948414_2948618_+	DUF3311 domain-containing protein	NA	NA	NA	NA
WP_110571396.1\|2948607_2949993_+	sodium:solute symporter	NA	NA	NA	NA
WP_146220911.1\|2951176_2951467_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_078526932.1\|2951995_2952799_+	putative hydro-lyase	NA	NA	NA	NA
WP_110571468.1\|2952871_2953928_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_078526933.1\|2954049_2955330_+	MFS transporter	NA	NA	NA	NA
WP_167370227.1\|2955428_2956688_+	MFS transporter	NA	NA	NA	NA
WP_078526935.1\|2956684_2957083_+	DUF2848 family protein	NA	NA	NA	NA
WP_078524646.1\|2957057_2958080_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.5e-21	32.0

DBSCAN-SWA_10

3111842 : 3302010

155

Stx2-converting_phage(18.18%)

holin,tRNA,integrase,transposase

attL 3160241:3160300|attR 3215658:3217114

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075595799.1\|3111842_3113186_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078528151.1\|3114009_3114990_+	acylglycerol kinase family protein	NA	NA	NA	NA
WP_110571197.1\|3114993_3115965_+	hypothetical protein	NA	NA	NA	NA
WP_078527107.1\|3115948_3117151_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	1.4e-35	31.1
WP_007400085.1\|3117157_3117409_-	acyl carrier protein	NA	NA	NA	NA
WP_078527109.1\|3117607_3119407_-	fatty acyl-AMP ligase	NA	NA	NA	NA
WP_078527111.1\|3119403_3120537_-	hypothetical protein	NA	NA	NA	NA
WP_075595799.1\|3125915_3127259_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_078527113.1\|3128264_3131462_-	error-prone DNA polymerase	R4TPF1	Streptomyces_phage	4.0e-93	29.9
WP_167370229.1\|3131434_3132958_-	DNA polymerase Y family protein	NA	NA	NA	NA
WP_078527115.1\|3132872_3133637_-	damage-inducible protein	NA	NA	NA	NA
WP_061471974.1\|3133922_3134684_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_061471972.1\|3134683_3135331_+	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	2.6e-39	44.7
WP_078527117.1\|3135455_3137201_+	oleate hydratase	NA	NA	NA	NA
WP_061471969.1\|3137772_3138276_-	flavin reductase	NA	NA	NA	NA
WP_078527119.1\|3138418_3140158_-	ABC transporter ATP-binding protein/permease	NA	NA	NA	NA
WP_078527120.1\|3140154_3142077_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.3e-119	35.9
WP_078527122.1\|3142073_3142568_-	transcriptional repressor	NA	NA	NA	NA
WP_086654393.1\|3142573_3143305_-	DUF1826 domain-containing protein	NA	NA	NA	NA
WP_025829285.1\|3143389_3144022_+	GTP cyclohydrolase I FolE	A0A2I7S8W4	Vibrio_phage	7.8e-41	46.4
WP_061471959.1\|3144018_3144528_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_061471993.1\|3144541_3145765_+	GTP-binding protein	NA	NA	NA	NA
WP_061471957.1\|3145812_3146976_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	3.3e-29	29.0
WP_061471955.1\|3147030_3147591_+	carbonate dehydratase	NA	NA	NA	NA
WP_167370230.1\|3147630_3148143_+	DUF1176 domain-containing protein	NA	NA	NA	NA
WP_078528160.1\|3148142_3148322_+	hypothetical protein	NA	NA	NA	NA
WP_078524623.1\|3148348_3149917_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	3.2e-104	44.9
WP_019092242.1\|3149982_3150330_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
WP_071406638.1\|3150326_3150710_-\|transposase	transposase	NA	NA	NA	NA
WP_078527126.1\|3150724_3152128_+\|tRNA	cysteine--tRNA ligase	NA	NA	NA	NA
WP_078527128.1\|3152235_3153444_+	dihydroorotase	NA	NA	NA	NA
WP_078524646.1\|3153660_3154683_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.5e-21	32.0
WP_078528163.1\|3155023_3155653_+	Maf-like protein	NA	NA	NA	NA
WP_078527130.1\|3156071_3156680_-	superoxide dismutase	NA	NA	NA	NA
WP_078527133.1\|3157186_3157996_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_078527135.1\|3158415_3159324_+	PIG-L family deacetylase	NA	NA	NA	NA
3160241:3160300	attL	NA	NA	NA	NA
WP_075595799.1\|3160295_3161639_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_167370231.1\|3161664_3162084_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	3.4e-08	35.9
WP_078528166.1\|3162218_3163202_+	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_078527137.1\|3163228_3164257_+	methionine synthase	NA	NA	NA	NA
WP_078527139.1\|3165009_3165672_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_078527141.1\|3165583_3166642_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_078527143.1\|3166859_3167759_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_078527145.1\|3167995_3170077_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_078527147.1\|3170215_3171418_+	DUF932 domain-containing protein	A0A1V0DX75	Synechococcus_virus	2.5e-72	40.9
WP_167370232.1\|3171495_3171789_-	HU family DNA-binding protein	M4SRV7	Rhodobacter_phage	7.1e-13	46.9
WP_078527151.1\|3171860_3172940_+	toprim domain-containing protein	A0A2R4ALE6	Vibrio_phage	1.9e-07	34.3
WP_078527153.1\|3173252_3174188_+	DUF2493 domain-containing protein	NA	NA	NA	NA
WP_078527155.1\|3174725_3174941_+	hypothetical protein	NA	NA	NA	NA
WP_007396851.1\|3174959_3175283_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_167370233.1\|3175626_3175764_+	hypothetical protein	NA	NA	NA	NA
WP_078527157.1\|3175945_3176215_+	hypothetical protein	NA	NA	NA	NA
WP_078527159.1\|3176360_3176624_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_078527161.1\|3176762_3176981_+	hypothetical protein	NA	NA	NA	NA
WP_167370261.1\|3177033_3177549_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_078527163.1\|3177769_3178021_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078528172.1\|3178034_3179114_+	replication initiator protein A	NA	NA	NA	NA
WP_078527165.1\|3179110_3179608_+	DUF2840 domain-containing protein	NA	NA	NA	NA
WP_078527167.1\|3179604_3180162_+	S26 family signal peptidase	NA	NA	NA	NA
WP_039733991.1\|3180163_3180502_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_078527169.1\|3180506_3181223_+	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	7.3e-11	34.6
WP_078527171.1\|3181505_3183245_+	DUF3363 domain-containing protein	NA	NA	NA	NA
WP_078527173.1\|3183257_3183686_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_078527175.1\|3183685_3183940_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_110571351.1\|3184152_3184980_+	abortive infection family protein	NA	NA	NA	NA
WP_165399215.1\|3185074_3185248_-	hypothetical protein	NA	NA	NA	NA
WP_078527179.1\|3185422_3187423_+	conjugal transfer protein TraG	NA	NA	NA	NA
WP_023979799.1\|3187430_3187877_+	hypothetical protein	NA	NA	NA	NA
WP_078528175.1\|3188071_3189028_+	P-type conjugative transfer ATPase TrbB	NA	NA	NA	NA
WP_083819130.1\|3189114_3189393_+	conjugal transfer protein TrbC	NA	NA	NA	NA
WP_078527183.1\|3189392_3189668_+	conjugal transfer protein	NA	NA	NA	NA
WP_078527185.1\|3189681_3192123_+	conjugal transfer protein TrbE	NA	NA	NA	NA
WP_078527187.1\|3192119_3192854_+	P-type conjugative transfer protein TrbJ	NA	NA	NA	NA
WP_078527189.1\|3192859_3194272_+	P-type conjugative transfer protein TrbL	NA	NA	NA	NA
WP_078527191.1\|3194277_3194961_+	conjugal transfer protein TrbF	NA	NA	NA	NA
WP_151892038.1\|3195549_3197117_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.5e-104	44.9
WP_019092242.1\|3197182_3197530_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
WP_071406638.1\|3197526_3197910_-\|transposase	transposase	NA	NA	NA	NA
WP_078527193.1\|3198518_3199697_+	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_078527195.1\|3199693_3199933_+	DUF2274 domain-containing protein	NA	NA	NA	NA
WP_167370234.1\|3199934_3200813_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_078527199.1\|3201034_3201925_-	hypothetical protein	NA	NA	NA	NA
WP_110571427.1\|3201921_3202269_-	copper homeostasis periplasmic binding protein CopC	NA	NA	NA	NA
WP_078527203.1\|3202398_3203739_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_078528177.1\|3203735_3204899_-	di-heme enzyme	NA	NA	NA	NA
WP_110571426.1\|3204912_3205770_-	metallo-mystery pair system four-Cys motif protein	NA	NA	NA	NA
WP_124297930.1\|3205823_3206411_-	hypothetical protein	NA	NA	NA	NA
WP_078527205.1\|3206407_3207214_-	DUF692 family protein	NA	NA	NA	NA
WP_120357830.1\|3207273_3207369_-	methanobactin	NA	NA	NA	NA
WP_078527207.1\|3207469_3209686_-	TonB-dependent receptor	NA	NA	NA	NA
WP_078527209.1\|3209831_3210323_-	DUF2946 family protein	NA	NA	NA	NA
WP_167370262.1\|3210624_3211707_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_078527213.1\|3211787_3212957_-\|integrase	tyrosine-type recombinase/integrase	A0A221SAN4	Ralstonia_phage	3.1e-51	35.9
WP_078527215.1\|3213362_3214058_-	hypothetical protein	NA	NA	NA	NA
WP_078527217.1\|3214056_3214740_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_146220927.1\|3214988_3215633_-	hypothetical protein	NA	NA	NA	NA
WP_075595799.1\|3215712_3217056_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_151892027.1\|3217569_3218326_+\|transposase	IS5 family transposase	NA	NA	NA	NA
3215658:3217114	attR	NA	NA	NA	NA
WP_151892039.1\|3218323_3218656_+	hypothetical protein	NA	NA	NA	NA
WP_167370235.1\|3218921_3219794_+	hypothetical protein	NA	NA	NA	NA
WP_146220943.1\|3219783_3220404_+	hypothetical protein	NA	NA	NA	NA
WP_110571455.1\|3220525_3220786_+	hypothetical protein	NA	NA	NA	NA
WP_078527223.1\|3220767_3221640_+	hypothetical protein	NA	NA	NA	NA
WP_146220944.1\|3221629_3222247_+	hypothetical protein	NA	NA	NA	NA
WP_151892040.1\|3223004_3224235_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.0e-89	59.6
WP_078527230.1\|3226651_3228061_-	APC family permease	NA	NA	NA	NA
WP_078527232.1\|3228490_3229261_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_078527234.1\|3229280_3230228_-	acetamidase/formamidase family protein	NA	NA	NA	NA
WP_110571468.1\|3231875_3232932_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_078527238.1\|3234018_3234474_-	RidA family protein	NA	NA	NA	NA
WP_078528181.1\|3234473_3235304_-	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_078527240.1\|3237719_3238616_+	fructose bisphosphate aldolase	NA	NA	NA	NA
WP_078527242.1\|3238696_3240178_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_078527246.1\|3241198_3243319_+	transketolase	NA	NA	NA	NA
WP_078527248.1\|3243405_3246270_+	bifunctional transaldolase/phosoglucose isomerase	NA	NA	NA	NA
WP_078527249.1\|3246385_3247387_+	decarboxylating 6-phosphogluconate dehydrogenase	E3SIC7	Synechococcus_phage	6.5e-82	47.5
WP_078527251.1\|3247495_3249028_+	glucose-6-phosphate dehydrogenase	M4SP85	Cyanophage	8.1e-76	36.8
WP_078527253.1\|3249086_3249896_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_078527255.1\|3249897_3250653_+	6-phosphogluconolactonase	NA	NA	NA	NA
WP_078528183.1\|3250730_3251435_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_167370236.1\|3251469_3251637_+	hypothetical protein	NA	NA	NA	NA
WP_078527256.1\|3251891_3252134_-	hypothetical protein	NA	NA	NA	NA
WP_110571227.1\|3252248_3252452_-\|transposase	transposase	NA	NA	NA	NA
WP_167370237.1\|3252450_3253560_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_078527260.1\|3253693_3254116_+\|transposase	transposase	NA	NA	NA	NA
WP_078527261.1\|3254246_3255296_+	PAS domain-containing protein	NA	NA	NA	NA
WP_078527263.1\|3255344_3256304_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_078527264.1\|3256425_3257958_+\|holin	choline-sulfatase	A0A2K9L1A5	Tupanvirus	1.8e-19	26.0
WP_078528184.1\|3257968_3260377_+	TonB-dependent receptor	NA	NA	NA	NA
WP_146220812.1\|3260373_3261591_+	MFS transporter	NA	NA	NA	NA
WP_078528187.1\|3261942_3263313_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_078527267.1\|3264141_3266343_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_146220813.1\|3266326_3266629_+	hypothetical protein	NA	NA	NA	NA
WP_078527271.1\|3266625_3268077_+	PepSY domain-containing protein	NA	NA	NA	NA
WP_078527274.1\|3270342_3271557_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_078527275.1\|3271686_3273141_-	hypothetical protein	NA	NA	NA	NA
WP_078527276.1\|3273211_3274234_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_078527278.1\|3274736_3275516_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_078528190.1\|3275555_3276941_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_078527279.1\|3277028_3277976_+	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_078527280.1\|3278267_3280736_+	TonB-dependent receptor	NA	NA	NA	NA
WP_078527281.1\|3280843_3281047_+	DUF3311 domain-containing protein	NA	NA	NA	NA
WP_078527283.1\|3281110_3282523_+	amidase	NA	NA	NA	NA
WP_078528193.1\|3282774_3284196_+	amidase	NA	NA	NA	NA
WP_167370263.1\|3284295_3285738_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_078527285.1\|3285752_3286823_+	phosphotransferase	NA	NA	NA	NA
WP_078527287.1\|3286886_3288158_+	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_078527289.1\|3289696_3291964_-	TonB-dependent receptor	NA	NA	NA	NA
WP_167370264.1\|3292826_3293504_+	hypothetical protein	NA	NA	NA	NA
WP_078527293.1\|3293684_3295271_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_078527295.1\|3295267_3296455_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_078527297.1\|3296454_3299646_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.4e-52	21.2
WP_078527299.1\|3300360_3301428_+	nitronate monooxygenase	NA	NA	NA	NA
WP_078527301.1\|3301571_3301868_+\|transposase	transposase	NA	NA	NA	NA
WP_078527303.1\|3301785_3302010_+\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019879

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP019875

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection