CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP012546	Campylobacter pinnipediorum subsp. pinnipediorum strain RM17260 chromosome, complete genome	2 crisprs	DEDDh	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP012546_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012546_1

1036704-1036838

Orphan

Consensus_repeat	Method
GTCTAAAATTAGCTATAAAGTTTTGCAACTTATTAATTTCTTCTTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012546_1

>merge|NZ_CP012546|1|1036704-1036838|CRISPRCasFinder
GTCTAAAATTAGCTATAAAGTTTTGCAACTTATTAATTTCTTCTTTTTCAGCATCTGTTAATTCTTCTTTTTCTTCTAATTCTTTTAGTCTAAAATTAGCTATGAAGTTTTGCAACTTATTAATTTCTTCTTTTT

>NZ_CP012546|1|1|1036704-1036838|CRISPRCasFinder
GTCTAAAATTAGCTATAAAGTTTTGCAACTTATTAATTTCTTCTTTTT	CAGCATCTGTTAATTCTTCTTTTTCTTCTAATTCTTTTA
GTCTAAAATTAGCTATGAAGTTTTGCAACTTATTAATTTCTTCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012546.1\|WP_078440694.1\|1034474_1034741_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
NZ_CP012546.1\|WP_157887337.1\|1033869_1034031_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_069636634.1\|1025711_1026881_+\|alpha-hydroxy-acid-oxidizing-protein	unknown	unknown	gnl\|CDD\|376451
NZ_CP012546.1\|WP_078440697.1\|1040830_1041496_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372509
NZ_CP012546.1\|WP_157887338.1\|1034109_1034262_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|130902
NZ_CP012546.1\|WP_069632003.1\|1029956_1031357_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273581
NZ_CP012546.1\|WP_153300939.1\|1037847_1038006_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440696.1\|1039739_1040825_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078397937.1\|1023592_1024927_-\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
NZ_CP012546.1\|WP_069632004.1\|1028534_1029941_+\|dNTP-triphosphohydrolase	unknown	unknown	gnl\|CDD\|234934
NZ_CP012546.1\|WP_069637480.1\|1041660_1042074_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440699.1\|1042969_1043338_-\|DUF1353-domain-containing-protein	unknown	unknown	gnl\|CDD\|377774
NZ_CP012546.1\|WP_078406073.1\|1027746_1028328_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078388205.1\|1042377_1042593_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440698.1\|1041476_1041671_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_069637481.1\|1042070_1042385_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_157887336.1\|1033133_1033295_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_157887339.1\|1035048_1035198_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440654.1\|1042637_1042973_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_157887340.1\|1038160_1038655_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP012546.1\|WP_078440694.1\|1034474_1034741_+\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	0.000312531
NZ_CP012546.1\|WP_078440699.1\|1042969_1043338_-\|DUF1353-domain-containing-protein	gnl\|CDD\|377774	pfam07087, DUF1353, Protein of unknown function (DUF1353). This family consists of several hypothetical bacterial proteins of around 100 residues in length. The function of this family is unknown.	2.35385e-19
NZ_CP012546.1\|WP_069636634.1\|1025711_1026881_+\|alpha-hydroxy-acid-oxidizing-protein	gnl\|CDD\|376451	pfam01070, FMN_dh, FMN-dependent dehydrogenase.	9.39418e-143
NZ_CP012546.1\|WP_078440697.1\|1040830_1041496_-\|hypothetical-protein	gnl\|CDD\|372509	pfam13166, AAA_13, AAA domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. This family includes the PrrC protein that is thought to be the active component of the anticodon nuclease.	0.00630995
NZ_CP012546.1\|WP_157887338.1\|1034109_1034262_+\|hypothetical-protein	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	3.12128e-13
NZ_CP012546.1\|WP_069632003.1\|1029956_1031357_+\|hypothetical-protein	gnl\|CDD\|273581	TIGR01369, Carbamoyl-phosphate_synthase_large_chain, carbamoyl-phosphate synthase, large subunit. Carbamoyl-phosphate synthase (CPSase) catalyzes the first committed step in pyrimidine, arginine, and urea biosynthesis. In general, it is a glutamine-dependent enzyme, EC 6.3.5.5, termed CPSase II in eukaryotes. An exception is the mammalian mitochondrial urea-cycle form, CPSase I, in which the glutamine amidotransferase domain active site Cys on the small subunit has been lost, and the enzyme is ammonia-dependent. In both CPSase I and the closely related, glutamine-dependent CPSase III (allosterically activated by acetyl-glutamate) demonstrated in some other vertebrates, the small and large chain regions are fused in a single polypeptide chain. This model represents the large chain of glutamine-hydrolysing carbamoyl-phosphate synthases, or the corresponding regions of larger, multifunctional proteins, as found in all domains of life, and CPSase I forms are considered exceptions within the family. In several thermophilic species (Methanobacterium thermoautotrophicum, Methanococcus jannaschii, Aquifex aeolicus), the large subunit appears split, at different points, into two separate genes. [Purines, pyrimidines, nucleosides, and nucleotides, Pyrimidine ribonucleotide biosynthesis].	0.00907104
NZ_CP012546.1\|WP_078397937.1\|1023592_1024927_-\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	8.34061e-148
NZ_CP012546.1\|WP_069632004.1\|1028534_1029941_+\|dNTP-triphosphohydrolase	gnl\|CDD\|234934	PRK01286, PRK01286, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	3.00175e-61

>NZ_CP012546.1|WP_157887339.1|1035048_1035198_+|hypothetical-protein
MVISSIKINSLDKLDDFSDEMGIYNFTDFNNTYKAKLLKSKLKNNELLK
>NZ_CP012546.1|WP_078440694.1|1034474_1034741_+|TolC-family-protein
MFAKEALYDYEYLLNKAKKDSPTINIKKLDIKIAKEDTKFQKADFYPRLLFSALSQYSDTFDKNYNSIHVRELTSKLYLLSKSNINHT
>NZ_CP012546.1|WP_157887338.1|1034109_1034262_+|hypothetical-protein
MLNKDIGFLKLNQNVSIKIDAFNFQKYGKIDGKLIHIANDSIKDEKLGEI
>NZ_CP012546.1|WP_157887337.1|1033869_1034031_+|hypothetical-protein
MKYLKVLSKSKRADKLLSKKKEASLVRAETNALNFQTKQQIITSPADGYIENF
>NZ_CP012546.1|WP_157887336.1|1033133_1033295_+|hypothetical-protein
MFKIFKDIKDDSHEFKPTIIEIEETPLNPIGRSVIWIVIAIIIFGFFGYSLQK
>NZ_CP012546.1|WP_069632003.1|1029956_1031357_+|hypothetical-protein
MKELLKDDKLFEIIKSNYGNIAQFISISPKNIEKPKLVVINNLNSYESLNTKSLIMKLIDSSRSGMVNIRSFSKVSAKGHKLHYGKEKKDIEEILQIIKANASNNMYSIINENIDIKDGGVSGVVLGNIIEFSPDDTPKCVEKDGICKFGKELGYMLLKKVYGFVPNINFTKDYRVEFSIHPNKEGVNKEHTILWEYEKFENYNYNEKISWPNNFSKFLGDKVFGLLIADCLGFNIPYTTVISRRVAPFTFGKHTGSSEKWFRTCPLVKEPGKYITKDSWLDPFDTIASEEKKGNQKMNLASVISQESVEAKFSGASIVSKNFKDDIIEGVIGKGDSFMVGLEPSQKLPKNILNKILEVHNKLRSHMDILGNKLSIEWVCDGKKVWVVQLNQLKNDSTITSQHTIVDKHASSFIKFNTDEGLDALRLLINEIKNTDVGIELVGNIGITSHFGDILRQNNISSYISN
>NZ_CP012546.1|WP_069632004.1|1028534_1029941_+|dNTP-triphosphohydrolase
MNDEAKSCKKLENEADNCMCEYAYKHKNVNNCDKDKEETYRTTLRRQRDKILYTGGFRRLQDKTQVMPVLKMGDHRTRLTHTLEVEQIAISVADALSLNKDLVSAIALGHDVGHTPFGHSGERTLNDLLEGNGGFYHSIQSVKYIWGNYGSKIDNKVYEGILKHDSDMFSINKQIADNQDLITFNIELDENFKKEFIDFLKDELGTPPSTLEAQIVIWADKIAYITHDFEDFYKSELYNEIIKKDKTCQEQLENILKKITGKNIIELQTRDLIRSLTNNLIESSFKNLQKHKINMDTKDETGKKIDQCINDITKDEKEHFKNNKEILEKLEKLEKNLQNAEDSEKENIKKDIKKLNKIQRQAYLKGQIINIDTEIFNEYLELREIVDKYYIGNIKIKKSDIKGEKIIKYLFEDLMKHPEILPKEYNCDKHTEEKDRQKKIAYYISTMTDDYARKMYLHLNSLIDDFEI
>NZ_CP012546.1|WP_078406073.1|1027746_1028328_+|hypothetical-protein
MLSIKEYLIKKYKEYTNQNINDCIRISYHYNKIRINLYFDAYDEDCPNLTIVLINNNVHYNSIINIDKLENGTPYLPEITKELLSSILDENKKLASFYNDFKNKILNSDFNIYSYANVHINRNIRDYNEGLFLHHIRRAKMSNAQFERLSKLLNIDTKILRKIQASGKTIVLTSNYEKRKKLIVILEKENINI
>NZ_CP012546.1|WP_069636634.1|1025711_1026881_+|alpha-hydroxy-acid-oxidizing-protein
MGRPQKPFHIDVRYPSVEHLRIKAKKRMPRFAYDYLTEGCNDDLNVTKNTSEIREIEMVSRYLTDFRDSDPQVELFGETYDAPFGISAVGLQSLMWPKTPQYLAKAAKEHNIPFMLSTVTTMSIEEAAKITDGKFWFQLYYPKDKERREDILKRAWDNGCKVLCLLSDVPTFGYRPKDVYNGLGMPPAMYIRNILNAMTKPTWAFETLLNGGMPRFETLEKYMTEKMNLQQLGMFMDDFFDGKLTVDRIKDIQDIWPGKIVIKGISTVEDTQTAIDLGVDGIIVSNHGGRQLDAGPTSIKTLPDIVKVGKGKIKIMIDSGMRTGPDIARVIASGAEFCFLGRPFMYGTGALGSKGGDQVAQILKREFIQVMQQLNCPKVENLPNFLYKK
>NZ_CP012546.1|WP_078397937.1|1023592_1024927_-|sodium-dependent-transporter
MTDKFSKIGFVLAMAGSAVGLGNAWKFPTMVGNNGGSAFIVIYLLLTFFVAFVAFLAELSIGKLGETDPVHSFEKLAPRYKKQWSLAGFFMIGGILIASFYLLVIGWILKYVILSFDKLPTTTQEAGKAFNNLISNEFLNSFLCFSVVFAMVFFVVSKGIKSGIEKLNFWMMPSLFILLIIMLAYSLSIGDGFVKAASFLFVPDFSKITPDIILQALGLAFFSLSMGVCTVPTYAASLPDGTNLVKSTLSIITINILVGVMMGLVVFTFVFEYGGDTTQGGPGLIFVSLATLFAKLGIMGNILSFMFFISLLFAGITSAVSMIEPFTFYLINKLKISRKRALLYIACFVYILGFMCILSFYEPTSFNVLGKPFFDILDYLTSNIIMPIGAIVFSFFVGFVIKKDGLYILFSSFMNKTFFEIWYFLLRFVAPVAILLIMIYQIYK
>NZ_CP012546.1|WP_153300939.1|1037847_1038006_+|hypothetical-protein
MYYTSNYDRKNIINYINSTYKSIVDVACKSLLTQTRLKEYMDVAALNVDEKR
>NZ_CP012546.1|WP_157887340.1|1038160_1038655_+|hypothetical-protein
MLENFTTRAKDKELLTEYLTTLSKDTSIKFFTSSGTKNDKALIGRNDNDNPYGNEDSDGDNDTIKFKEGISRNDLIFIDNSQNSLIIKIKYTTDSITIQEIFRYKDNRKGINKIELSEGNFISSTQINKVTKQLKSYTQDNGLTSITQNDIQNNQDMMQIGMNR
>NZ_CP012546.1|WP_078440696.1|1039739_1040825_-|hypothetical-protein
MYIAFKDFVNTTYNFSDDVFNELAGSNFDESYASGSLYNAFSLPMPNLKGLFIEQGGSLTEAILQLNEDFAEFALSAIQISLEYKDYERSLDGFVNAAEVAINAINDLRHYGNELSNRDSENVRFSKTNPLTSGEFGNIGISGNGYYKAGSLAGLADEIHKDSALENVLESIGGAYLGSLGSIFAGIAFDYAKDGKFNASNIAEHVYSGLLKKSVDVAISKSLSALGTTISPIGGFIALKAVQTLVTEALEVATGLDNRFGFGGDLVGAVNIDNKQVDAYIGDRSFLQGLKSIIGLDMGAEFLTDIDKNVLGFAYNEKISAVYQGDKLVSNITNNVFSGTIVDKRLGAFLETGFNSFSVRH
>NZ_CP012546.1|WP_078440697.1|1040830_1041496_-|hypothetical-protein
MTNTNYNEVYKERLKDLLELSTKKDSPYSETIKFLEEKFNEYNITNDYRIKILIALLPQMTLQFTQTAMQVALQLADEDLSFAVKLENLKKQGSAMDANIEGIKEQTKNQEIKNAKLSEQRADELENLKKQGRMLEAQIKKLEKENKLAQSQQEAIDRQVKDNRVIKVLSVLGSFIEGNQQGGMIVPSDMTKFFFDLQSELIKNDVSITKPTEMKMTERKK
>NZ_CP012546.1|WP_078440698.1|1041476_1041671_-|hypothetical-protein
MSDEELQALKNKINYLEQQIENLSNAVDRINNNGMSSRVRDINNTLTLQNAKIRRIQRDDKYKL
>NZ_CP012546.1|WP_069637480.1|1041660_1042074_-|hypothetical-protein
MILHIMRIKDINDGSIGEFELKNSDDEIMLNGYTLEPAGPDTIERNKDKRIPKGLYHVSWHSSPKFKTTLPLLHNENVAKDRFVLIHAGNYPKDTKGCILLGASYDDKGVYKSKDTLNKFLKLTRCKELKVVISDVR
>NZ_CP012546.1|WP_069637481.1|1042070_1042385_-|hypothetical-protein
MNDILIFFEKNSYLLWIAIIGLVAGFLNDKYSEDKTNTRKIANFFTGAISSMFFCWIAYEISYYFTDHERLSLAVGGFVAWRGAEWINSIVDKFIETKTNKGIR
>NZ_CP012546.1|WP_078388205.1|1042377_1042593_-|hypothetical-protein
MFVVVFLIILAGCADKQVIVKTEYKDVYVPVKCKVELPNKPAFDEKNPQTAKELSKYYKQIEILLKECIDE
>NZ_CP012546.1|WP_078440654.1|1042637_1042973_-|hypothetical-protein
MIKDYINYISYSLIVVCFLWINHLNNKIDELRYRLNTSKITNELYISNLSDCNSKIKLQNEKLKILRVDKEKLNNELIKLDDKFKKITTPKANSKCNVKLKYYEQLFKELS
>NZ_CP012546.1|WP_078440699.1|1042969_1043338_-|DUF1353-domain-containing-protein
MNKLNRVIVKPFGKDKFEVVEDFIFESIKVPKGYKSNGANVPRLLWSIFPPNSPEYLSATILHDYLCDVADSTVKDNILKNVNFKYADDMLLKALLTLSVNKFKSRLFYYSCRAYHKLRYKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP012546_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP012546_2

1066358-1066487

Orphan

Consensus_repeat	Method
ACTAGAAAGAGAAAAACAAGAAGCTATACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP012546_2

>merge|NZ_CP012546|2|1066358-1066487|CRISPRCasFinder
CGAAGAAAGAGCAAGACAAAGAGAAATAGAACTAAGAGAAATACTAGAAAGAGAAAAACAAGAAGCTATACAAAGAGCTAAAATTGAAGAACAAAAAAGACTAGAAAGAGAAAAACAAGAAGCTATACAA

>NZ_CP012546|2|2|1066358-1066487|CRISPRCasFinder
CGAAGAAAGAGCAAGACAAAGAGAAATAGAA	CTAAGAGAAATACTAGAAAGAGAAAAACAAGAAGCTATACAAAGAGCTAAAATTGAAGAACAAAAAAG
ACTAGAAAGAGAAAAACAAGAAGCTATACAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP012546.1\|WP_078440710.1\|1064010_1064352_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_069637521.1\|1071164_1071410_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440707.1\|1061851_1062067_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440705.1\|1060255_1061161_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440709.1\|1062396_1063140_+\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|119397
NZ_CP012546.1\|WP_078387807.1\|1069891_1070122_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440714.1\|1068125_1068857_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214989
NZ_CP012546.1\|WP_069637508.1\|1063218_1063398_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440716.1\|1070179_1070641_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_153300941.1\|1064908_1065217_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440711.1\|1065465_1065678_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_069637509.1\|1063363_1063825_+\|DUF2335-domain-containing-protein	unknown	unknown	gnl\|CDD\|274528
NZ_CP012546.1\|WP_157887341.1\|1061246_1061417_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440715.1\|1069677_1069911_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440713.1\|1066662_1067496_+\|PD-(D/E)XK-nuclease-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|378917
NZ_CP012546.1\|WP_069637522.1\|1071714_1072092_+\|type-II-toxin-antitoxin-system-death-on-curing-family-toxin	unknown	unknown	gnl\|CDD\|226180
NZ_CP012546.1\|WP_078387805.1\|1068866_1069667_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078388208.1\|1067710_1067953_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440706.1\|1061420_1061762_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP012546.1\|WP_078440717.1\|1070633_1071143_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236275

Protein	Function_ID	Function_description	E-value
NZ_CP012546.1\|WP_078440709.1\|1062396_1063140_+\|LexA-family-transcriptional-regulator	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	9.21691e-18
NZ_CP012546.1\|WP_078440717.1\|1070633_1071143_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|236275	PRK08486, PRK08486, single-stranded DNA-binding protein; Provisional.	3.03657e-58
NZ_CP012546.1\|WP_078440714.1\|1068125_1068857_+\|hypothetical-protein	gnl\|CDD\|214989	smart01040, Bro-N, BRO family, N-terminal domain. This family includes the N-terminus of baculovirus BRO and ALI motif proteins. The function of BRO proteins is unknown. It has been suggested that BRO-A and BRO-C are DNA binding proteins that influence host DNA replication and/or transcription. This Pfam domain does not include the characteristic invariant alanine, leucine, isoleucine motif of the ALI proteins.	6.37404e-05
NZ_CP012546.1\|WP_069637522.1\|1071714_1072092_+\|type-II-toxin-antitoxin-system-death-on-curing-family-toxin	gnl\|CDD\|226180	COG3654, Doc, Prophage maintenance system killer protein [General function prediction only].	3.39897e-16
NZ_CP012546.1\|WP_069637509.1\|1063363_1063825_+\|DUF2335-domain-containing-protein	gnl\|CDD\|274528	TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	0.00495798
NZ_CP012546.1\|WP_078440713.1\|1066662_1067496_+\|PD-(D/E)XK-nuclease-like-domain-containing-protein	gnl\|CDD\|378917	pfam12684, DUF3799, PDDEXK-like domain of unknown function (DUF3799). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are typically between 265 and 420 amino acids in length. It appears that these proteins are distantly related to the PDDEXK superfamily and so these domains are likely to be nucleases. This family has a C-terminal cysteine cluster similar to that found in pfam01930.	5.05397e-37

>NZ_CP012546.1|WP_078440711.1|1065465_1065678_+|hypothetical-protein
MILESYEKDLMTHEQMQARADALFDEFSSKLDDILANASEEIEHLVSNYEEYIKYKDLQDEIRTQARAFF
>NZ_CP012546.1|WP_153300941.1|1064908_1065217_-|hypothetical-protein
MEWINYLKTLNAYELIIFVAGFCCGWLVAFKYFRFKDKKIFITQSTGNCTIPVKINGQVMDYTTNVVITYENNKPVRVGCPHFNKGKCELAKTDCEALNKQV
>NZ_CP012546.1|WP_078440710.1|1064010_1064352_-|hypothetical-protein
MNRLFVVICIMAFVGCSQYDLENNINTYFTSRDVRHGVDLDWDRISHNSTKSGLIASGIGLGVGIIGAVFGKAKQMIDEYQYEKEMEEYEKELESENNATAKDNNTTIPLQAE
>NZ_CP012546.1|WP_069637509.1|1063363_1063825_+|DUF2335-domain-containing-protein
MPNKKIPKKQNNNLENTPKAFIDKAIQQNLNINFIPSELSDIIKQNPNYTERVLEYLEKEQTHRHNSDDRILTLEEKEQVLRAEEAPKIAKYNFRGQIFITLILFALIAVTAFAIQKGEVGIAIAGLISSIVAMTPAIIGNRPKQKDNSKKQQ
>NZ_CP012546.1|WP_069637508.1|1063218_1063398_+|hypothetical-protein
MSETLKAFIFGFKNAFRFVNTSEISTLNERGELSEKIFNARIQEFKKHYAEQKNTEKTK
>NZ_CP012546.1|WP_078440709.1|1062396_1063140_+|LexA-family-transcriptional-regulator
MSLSSKIKKARKLKGLTQLQLSELLGINRASITQYETDVAIPPIATLKLIADACGVAMTFFFDDELEINRQIVKQELKNNFAKYADLIPNQAQIKNTVFLPKSEMLIGAGAEGAFDLSLFESETRVAVDKKFIGALNPANLKLFEVVGDSMFPEYDEGDLAIVDMVNHRYDFVKIAGIYVVRVGDVVYIKRVEFLPNNAVKLISLNPKYGDMYPHKDGYEYEILGKVCGKIKFEISKGLTFSDSGIK
>NZ_CP012546.1|WP_078440707.1|1061851_1062067_-|hypothetical-protein
MTTQKYDNSRSFKLSNQNIANIVEIQNKKGFKSDSEVIRFCLDFVKAFIDKDLETQTIAKILEDVNSGSKR
>NZ_CP012546.1|WP_078440706.1|1061420_1061762_-|hypothetical-protein
MSEDEIYKAFLDIEIALLSVDNCVATDDTKAEPVDGYSWRIDNKNSFDALCKLRKILKAKEEIMEKTRNERKRQKLKDKAFKKIVKELRKIEDWHDQTSVLRAVSCYLRLALT
>NZ_CP012546.1|WP_157887341.1|1061246_1061417_+|hypothetical-protein
MTDKELILELTKAVIAKNENITNKPTNELGEIASQIFNEIAKEIKNTLSDLEKTNK
>NZ_CP012546.1|WP_078440705.1|1060255_1061161_-|hypothetical-protein
MKEIIKQLSERPIAYYPAYARLAGSITAGLLLSQLMYWFTKQDKIFKTDAEIMAETMLSKDELRSAKSKLKNLDFLTISREGIPAKTFYEIDWDLLENALNFDKKVVKNNETRQVKTPKQDVVNSQDKIREFPETGLGKFTKQDELNSQISYYNAENTTENTTENKKEKIKKEKIKAVENEIVLPKFLNPEIWSNYLIYKKERREKLTPMGIKMKFAEWEKWHNQGIDVNQCIVTAMANNWQGVFKPKPKQEYKSSNNYDNQEISQEDMKRFGFKDYSKAPDIDLDSVFNANRFLIGAVNE
>NZ_CP012546.1|WP_078440713.1|1066662_1067496_+|PD-(D/E)XK-nuclease-like-domain-containing-protein
MLDIDLNIALTNKEYHSRSEISKSDLDKLAKSPFHFKFKSEFETEPSQTLILGSLVHKLVLEPQDFNNEFIIEPVCDKRTKAGKEAYQEFLTSVGDKTIVPQSLNETAQEIALKVLSMKETGLFLKNGLAEQSYFGEIEGVKVKCRPDFYNESLGLAIDLKTTSDASATGFAKSVANFNYHIQASFYSDILRQNGKEVNNFLFIAVETKKPYMVGFYELDQTAIDKGRDDYLRLLDLYKVCEAKNEWWGYAEFKDNEVNHIQTLALPNWKFYQEVGA
>NZ_CP012546.1|WP_078388208.1|1067710_1067953_+|hypothetical-protein
MYYGNENIVKHTCRILGITQKELAEMIGVADNTPAQWATQKEPPEMAIKFMNLLLAHNKVKKQLDKFKQAFKLLDEAKQS
>NZ_CP012546.1|WP_078440714.1|1068125_1068857_+|hypothetical-protein
MKNLFTATNKAHTFQTFTTEQVANGYGVALTTIRNHKAEHSDEIAENIHFVYEVISTNGGKQEMLKWTLRGIVKLGMFIRSKEAKKFRLWAEQELEKSILAELEKANEIREKNITYVNEISNLKAYQMAQGKHHNYQVLGYKSQISQKNKEIVALKQELVKAQKIYTAQVDDDSYKAMYKNAILERNYYYQKCQKLKECFFTKEQKTFQILNDIRTQLDKTYTDVGALIAYVWEDNDYFIQNR
>NZ_CP012546.1|WP_078387805.1|1068866_1069667_+|hypothetical-protein
MSTEITEIQTQMQRFELEQRQAKAFSMSVFFPQHLKGQGPNAQLISTSNAVVVYDLAYRMNVSPLEIAQSIFIIYGKPSFETKFLVARLNMSGKIKGRLKTIISDDKKSAYCEAIDAETGETYRGSTITLDMAAAEGWLSKSGSKWKTMPELMLRYRAQSFFINEYYPEVKLGIKSKEELQDSDEITIQPKKPNLNEIVSEKEKKELLEVEIEPQTLPHDELEKELVARGIDEDLAEDVVSRFSKEQVLQLLSDPNAIDNLIEQSA
>NZ_CP012546.1|WP_078440715.1|1069677_1069911_+|hypothetical-protein
MNIMTPTKYLYDVEPSELLDLTPIGNERIKLARELLTKLQKAPLKARDDERISKVYKAINFWQDLLIERYNDELLKN
>NZ_CP012546.1|WP_078387807.1|1069891_1070122_+|hypothetical-protein
MSSLKISKEIVSDFIKFGKEMTATDFKRSNANQYLAPLAKQGILQSRWHTNDKGTKCKMYRINDMKKALKFLGRTA
>NZ_CP012546.1|WP_078440716.1|1070179_1070641_+|hypothetical-protein
MSTQDTRSTAQPCGLVLLSKKYKTVDSRFGYDNYCLSSDGLCLAEGLEDSKKYLIDLAQEMNKKFIPLINDIKEDDELEEFLDSHNYEFDSIHYNAVKTSWECDPNDFFFTFSNEEAKQHENKHTKSYMVYLGASPKTKRLVEILLKIGAKDV
>NZ_CP012546.1|WP_078440717.1|1070633_1071143_+|single-stranded-DNA-binding-protein
MFNKIVLVGNLTRDIELRYTESGLALGNSAIAVTRKFTTNGEKREETCFVDITFFGKGAEIANQYLSKGSKLLIEGRLKQDVWQDQQGNNKSKHSVIVENMEMLGNTNNNANNTYNTNGNCNTNAKNSHQSYQMNNYQRPSQKQTIQENQQIDEEYNDRYEQSDNTVPF
>NZ_CP012546.1|WP_069637521.1|1071164_1071410_+|hypothetical-protein
MISSINPIKALIKHKRYTYKELGDKLDYSIEEVKQLEQSSFYNLLLPYRKDIFLYKETLKIEEQIYNDYKEELIKEYGMPF
>NZ_CP012546.1|WP_069637522.1|1071714_1072092_+|type-II-toxin-antitoxin-system-death-on-curing-family-toxin
MNYFTIADAIELHDQIISNMGGANGYNEVSIGYLDSALEQIQNDEYYPTFIDKLTHLVFSCVKFHPFLDGNKRTSIYLGIFFLELNDLEGYFVYFADKMEDVVVDLASGKVSKEELKEIITNIIY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

413404 : 510417

Escherichia_phage(10.71%)

transposase,plate,capsid,tail,integrase,portal,tRNA

attL 415341:415360|attR 496285:496304

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078387464.1\|413404_414781_+\|tRNA	glutamate--tRNA ligase	A0A222YZ70	Escherichia_phage	7.9e-14	28.8
WP_078387465.1\|414794_416051_+	malate dehydrogenase	NA	NA	NA	NA
415341:415360	attL	NA	NA	NA	NA
WP_069636598.1\|416055_416682_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_069633074.1\|416846_417890_+	GTPase ObgE	NA	NA	NA	NA
WP_078388194.1\|421497_422325_+	DNA ligase	A0A1X9VNU1	Mimivirus	1.7e-35	33.6
WP_078440444.1\|422343_423270_-	phospholipase A	NA	NA	NA	NA
WP_078440445.1\|423262_423883_-	molybdenum cofactor guanylyltransferase	NA	NA	NA	NA
WP_078440504.1\|428014_428821_-	helix-turn-helix domain-containing protein	M5A9D2	Nitratiruptor_phage	8.1e-27	49.2
WP_069637869.1\|429062_429515_-	hypothetical protein	NA	NA	NA	NA
WP_153300945.1\|429587_429755_+	hypothetical protein	NA	NA	NA	NA
WP_078387956.1\|429754_432022_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_069637871.1\|432095_432959_+	AAA family ATPase	A0A2D1GNS0	Pseudomonas_phage	7.6e-31	31.2
WP_069637872.1\|432962_433178_+	hypothetical protein	NA	NA	NA	NA
WP_069637873.1\|433147_433387_+	hypothetical protein	NA	NA	NA	NA
WP_069637874.1\|433496_433811_+	hypothetical protein	NA	NA	NA	NA
WP_069637875.1\|433822_434596_+	DUF2303 family protein	NA	NA	NA	NA
WP_069637876.1\|434657_435023_+	DUF1937 family protein	NA	NA	NA	NA
WP_069637877.1\|435218_435638_+	hypothetical protein	NA	NA	NA	NA
WP_069637878.1\|435719_436358_+	hypothetical protein	NA	NA	NA	NA
WP_069637879.1\|436354_436795_+	DUF1018 domain-containing protein	NA	NA	NA	NA
WP_069637880.1\|436820_437021_+	hypothetical protein	NA	NA	NA	NA
WP_099046651.1\|437010_438216_+	hypothetical protein	NA	NA	NA	NA
WP_069637882.1\|438212_438596_+	hypothetical protein	NA	NA	NA	NA
WP_078387954.1\|438665_439106_+	hypothetical protein	G8I4M9	Mycobacterium_phage	3.2e-09	34.5
WP_069637883.1\|439117_440689_-	hypothetical protein	S5MBV8	Brevibacillus_phage	1.8e-38	28.9
WP_069637884.1\|440782_441841_-\|portal	phage portal protein	Q9HH53	Methanothermobacter_phage	2.2e-11	28.6
WP_069637885.1\|441966_442704_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	4.4e-19	40.4
WP_086936834.1\|442700_443633_+\|capsid	P2 family phage major capsid protein	NA	NA	NA	NA
WP_069637887.1\|443616_443919_+	hypothetical protein	NA	NA	NA	NA
WP_069637888.1\|443920_444298_+	hypothetical protein	NA	NA	NA	NA
WP_069637889.1\|444294_444714_+	hypothetical protein	A0A1S5RFB5	Helicobacter_phage	1.5e-11	35.0
WP_069637890.1\|444713_445067_+	hypothetical protein	NA	NA	NA	NA
WP_069637891.1\|445059_445299_+	hypothetical protein	NA	NA	NA	NA
WP_069637892.1\|445295_445481_+	hypothetical protein	NA	NA	NA	NA
WP_069637893.1\|445482_445755_+	hypothetical protein	NA	NA	NA	NA
WP_069637958.1\|445779_446301_+\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	1.3e-12	35.3
WP_069637894.1\|446297_446582_+	GPW/gp25 family protein	Q75QM0	Wolbachia_phage	2.9e-11	45.2
WP_069637895.1\|446722_447808_+\|plate	baseplate J/gp47 family protein	A4JWL6	Burkholderia_virus	1.0e-16	27.3
WP_069637896.1\|447804_448425_+\|tail	phage tail protein	A0A2K9V471	Faecalibacterium_phage	3.3e-12	35.8
WP_069637897.1\|448421_449576_+\|tail	phage tail protein	F1BUP1	Erwinia_phage	6.0e-23	42.9
WP_069637898.1\|449588_450341_+	hypothetical protein	NA	NA	NA	NA
WP_069637899.1\|450352_451555_+	radical SAM protein	A0A1B2IA90	Erwinia_phage	5.1e-49	31.6
WP_069637900.1\|451554_452409_+	radical SAM protein	NA	NA	NA	NA
WP_078440505.1\|452800_453961_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A7YGY2	Campylobacter_phage	1.2e-82	45.4
WP_078440506.1\|454128_454644_+\|tail	phage major tail tube protein	A7YGZ4	Campylobacter_phage	5.9e-31	44.0
WP_069637904.1\|454645_454888_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_153300943.1\|455179_455470_-	hypothetical protein	NA	NA	NA	NA
WP_078440508.1\|455499_457920_+\|tail	phage tail tape measure protein	A0A097I4X9	Vibrio_phage	5.2e-77	39.4
WP_078440509.1\|457910_458282_+\|tail	phage tail protein	NA	NA	NA	NA
WP_078440510.1\|458278_458470_+\|tail	tail protein X	NA	NA	NA	NA
WP_078440511.1\|458463_459438_+\|tail	phage tail protein	D5LGY1	Escherichia_phage	1.7e-18	28.7
WP_078387942.1\|459532_460288_+	DNA adenine methylase	A7YGI9	Campylobacter_phage	4.7e-85	62.2
WP_078387941.1\|460367_461027_+	S24 family peptidase	A0A1B0RXB1	Streptococcus_phage	4.8e-09	28.4
WP_153300920.1\|462800_462950_+	hypothetical protein	NA	NA	NA	NA
WP_078415696.1\|463381_464308_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	9.0e-46	36.5
WP_078415724.1\|464385_465291_+	radical SAM protein	NA	NA	NA	NA
WP_078440512.1\|465287_466118_+	pyridoxamine kinase	NA	NA	NA	NA
WP_069632876.1\|467014_467491_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_069636472.1\|467724_467985_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078440513.1\|468103_469819_-	urease subunit alpha	NA	NA	NA	NA
WP_069632879.1\|469815_470202_-	urease subunit beta	NA	NA	NA	NA
WP_069632880.1\|470211_470514_-	urease subunit gamma	NA	NA	NA	NA
WP_069637914.1\|470532_471318_-	urease accessory protein UreD	NA	NA	NA	NA
WP_069636474.1\|471323_471935_-	urease accessory protein UreG	NA	NA	NA	NA
WP_078440514.1\|471944_472649_-	hypothetical protein	NA	NA	NA	NA
WP_069636476.1\|472660_473158_-	hypothetical protein	NA	NA	NA	NA
WP_157887323.1\|473344_476806_-	S8 family serine peptidase	NA	NA	NA	NA
WP_078415705.1\|476919_477324_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078440931.1\|477456_478590_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_078415726.1\|478647_479004_+	hypothetical protein	NA	NA	NA	NA
WP_078440516.1\|479003_479633_+	nitroreductase family protein	NA	NA	NA	NA
WP_078440517.1\|479726_480221_+	flavodoxin	NA	NA	NA	NA
WP_078388190.1\|480273_481101_-	biotin synthase	NA	NA	NA	NA
WP_157887324.1\|481981_483484_+	4Fe-4S binding protein	NA	NA	NA	NA
WP_078440518.1\|483708_484308_+	hypothetical protein	NA	NA	NA	NA
WP_078440519.1\|484332_486789_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	1.4e-61	26.8
WP_069632891.1\|487024_488374_+	4Fe-4S binding protein	NA	NA	NA	NA
WP_069632892.1\|488388_488736_+	iron hydrogenase small subunit	NA	NA	NA	NA
WP_078440520.1\|488728_489412_+	cytochrome b/b6 domain-containing protein	NA	NA	NA	NA
WP_078387481.1\|489426_490899_+	[FeFe] hydrogenase H-cluster radical SAM maturase HydG	NA	NA	NA	NA
WP_078423047.1\|490886_491936_+	[FeFe] hydrogenase H-cluster radical SAM maturase HydE	NA	NA	NA	NA
WP_078440521.1\|491932_493117_+	[FeFe] hydrogenase H-cluster maturation GTPase HydF	NA	NA	NA	NA
WP_078387482.1\|493135_495223_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	5.4e-99	37.3
WP_078387483.1\|495414_496506_+	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
496285:496304	attR	NA	NA	NA	NA
WP_069636481.1\|496550_498218_-	anaerobic C4-dicarboxylate transporter	NA	NA	NA	NA
WP_069636482.1\|498565_499552_+	iron ABC transporter permease	NA	NA	NA	NA
WP_099046664.1\|499554_500322_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-15	31.6
WP_069637929.1\|500325_501123_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_069632901.1\|501159_502380_+	radical SAM protein	NA	NA	NA	NA
WP_078387485.1\|502376_502889_+	flavodoxin	NA	NA	NA	NA
WP_069636485.1\|503020_503809_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_069632904.1\|503808_504873_+	elongation factor Ts	NA	NA	NA	NA
WP_069636487.1\|504872_505517_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.7e-23	34.8
WP_069632906.1\|505507_506269_+	flagellar type III secretion system protein FliR	NA	NA	NA	NA
WP_078440522.1\|506330_507983_+	hypothetical protein	NA	NA	NA	NA
WP_078440523.1\|507983_508595_+	guanylate kinase	G0XXC0	Cowpox_virus	1.5e-20	35.0
WP_069632909.1\|508620_508821_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_069637934.1\|508830_510417_+\|tRNA	arginine--tRNA ligase	M1PAX3	Moumouvirus	2.6e-16	22.2

DBSCAN-SWA_2

920932 : 966610

Campylobacter_phage(22.73%)

plate,capsid,tail,terminase,protease,portal,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078440638.1\|920932_921811_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_078440639.1\|921827_922835_+	AI-2E family transporter	NA	NA	NA	NA
WP_078440938.1\|922923_923727_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_069632063.1\|923744_924014_+	NifU family protein	NA	NA	NA	NA
WP_069636708.1\|924006_924552_+	histidine kinase	NA	NA	NA	NA
WP_078440640.1\|924535_925819_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_069632060.1\|925820_926171_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_069632059.1\|926170_926779_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.2e-26	34.1
WP_069632058.1\|926742_927453_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_069632057.1\|927457_927673_+	hypothetical protein	NA	NA	NA	NA
WP_069632056.1\|927983_928739_-	DNA adenine methylase	A7YGI9	Campylobacter_phage	4.4e-83	61.0
WP_069632055.1\|929592_930660_-	peptide chain release factor 1	NA	NA	NA	NA
WP_069632054.1\|930667_930937_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_078440641.1\|932554_932737_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078387682.1\|932741_932951_-	hypothetical protein	NA	NA	NA	NA
WP_078387683.1\|933063_933318_-	hypothetical protein	NA	NA	NA	NA
WP_110109156.1\|933322_933481_-	DNA cytosine methyltransferase	A0A173H0P2	Pseudoalteromonas_phage	6.2e-08	74.3
WP_078440642.1\|933484_934201_-	DNA (cytosine-5-)-methyltransferase	W8CQ31	Croceibacter_phage	5.5e-51	56.7
WP_078415509.1\|934197_934413_-	DUF3310 domain-containing protein	A0A1B1IWF3	uncultured_Mediterranean_phage	2.7e-14	59.3
WP_078387686.1\|934415_935807_-	DEAD/DEAH box helicase	F4YCV3	Synechococcus_phage	3.4e-105	45.9
WP_078387687.1\|935817_936744_-	DNA methylase	F4YCV3	Synechococcus_phage	1.6e-98	58.3
WP_078440643.1\|936748_937087_-	single-stranded DNA-binding protein	I6NRL7	Burkholderia_virus	3.9e-15	44.3
WP_078387689.1\|937089_937587_-	hypothetical protein	NA	NA	NA	NA
WP_153300935.1\|937583_937730_-	hypothetical protein	NA	NA	NA	NA
WP_078440644.1\|937741_938638_-	hypothetical protein	X2KQ45	Campylobacter_phage	3.4e-34	45.5
WP_078387691.1\|938634_938844_-	hypothetical protein	NA	NA	NA	NA
WP_078387692.1\|938830_939142_-	hypothetical protein	NA	NA	NA	NA
WP_078387694.1\|939477_939759_-	hypothetical protein	NA	NA	NA	NA
WP_078387695.1\|940124_940370_-	hypothetical protein	NA	NA	NA	NA
WP_078387696.1\|940353_940617_-	hypothetical protein	NA	NA	NA	NA
WP_078387697.1\|940626_940812_-	hypothetical protein	NA	NA	NA	NA
WP_078387698.1\|940926_941268_+	hypothetical protein	NA	NA	NA	NA
WP_099046655.1\|941273_941576_+	hypothetical protein	X2KX12	Campylobacter_phage	2.3e-14	49.4
WP_078440645.1\|941613_942816_+	hypothetical protein	NA	NA	NA	NA
WP_078387701.1\|942805_942991_+	hypothetical protein	NA	NA	NA	NA
WP_078440646.1\|942980_943520_+	hypothetical protein	NA	NA	NA	NA
WP_078440647.1\|943526_943751_+	hypothetical protein	NA	NA	NA	NA
WP_078440648.1\|943741_945445_+	AAA family ATPase	NA	NA	NA	NA
WP_078387705.1\|945532_945742_-	hypothetical protein	NA	NA	NA	NA
WP_078440649.1\|945849_946149_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.0e-19	47.9
WP_078387707.1\|946141_946426_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	1.4e-13	38.7
WP_078440650.1\|946428_947355_-	hypothetical protein	A0A1S6L010	Salmonella_phage	1.7e-12	30.3
WP_078387709.1\|947353_947620_+	hypothetical protein	NA	NA	NA	NA
WP_078387710.1\|947772_948855_-\|tail	phage tail tape measure protein	Q75QK7	Wolbachia_phage	6.4e-51	41.2
WP_078387711.1\|948931_949114_+	hypothetical protein	NA	NA	NA	NA
WP_078415519.1\|949218_949482_-	hypothetical protein	NA	NA	NA	NA
WP_078440651.1\|949552_950047_-\|tail	phage major tail tube protein	NA	NA	NA	NA
WP_078440652.1\|950051_950300_-	hypothetical protein	NA	NA	NA	NA
WP_078440653.1\|950302_950539_-	hypothetical protein	NA	NA	NA	NA
WP_078387716.1\|952075_952393_-	hypothetical protein	NA	NA	NA	NA
WP_078388205.1\|952385_952601_-	hypothetical protein	NA	NA	NA	NA
WP_078440654.1\|952645_952981_-	hypothetical protein	NA	NA	NA	NA
WP_078440655.1\|952977_953346_-	DUF1353 domain-containing protein	X2KQ25	Campylobacter_phage	1.2e-22	47.5
WP_078387719.1\|953348_953960_-	hypothetical protein	F5B3N7	Synechococcus_phage	2.1e-06	50.0
WP_078387720.1\|953975_954602_-\|tail	tail fiber protein	A0A2K9VNA0	Shigella_phage	1.1e-23	42.2
WP_078440656.1\|954823_955498_-\|tail	phage tail protein	F1BUP1	Erwinia_phage	1.7e-22	42.5
WP_078387722.1\|955494_955971_-\|tail	phage tail protein	NA	NA	NA	NA
WP_078387723.1\|956085_957141_-\|plate	baseplate J/gp47 family protein	NA	NA	NA	NA
WP_157887335.1\|957137_957428_-	GPW/gp25 family protein	NA	NA	NA	NA
WP_078440657.1\|957497_957995_-\|plate	phage baseplate assembly protein V	A0A0E3Y4V1	Fusobacterium_phage	3.4e-07	30.5
WP_078387726.1\|957996_958443_-	hypothetical protein	NA	NA	NA	NA
WP_078440658.1\|958445_958742_-	hypothetical protein	NA	NA	NA	NA
WP_078440659.1\|958747_959005_-	hypothetical protein	NA	NA	NA	NA
WP_078440660.1\|959026_960778_-\|capsid	phage major capsid protein	X2KXE1	Campylobacter_phage	1.7e-13	31.6
WP_078440661.1\|960770_962186_-\|portal	phage portal protein	A0A0K1LM50	Rhodobacter_phage	1.2e-17	22.9
WP_078440662.1\|962185_962413_-	hypothetical protein	NA	NA	NA	NA
WP_078440663.1\|962480_962921_-	hypothetical protein	NA	NA	NA	NA
WP_078440664.1\|963159_964884_-\|terminase	phage terminase large subunit family protein	A0A067ZJA1	Vibrio_phage	5.2e-87	34.1
WP_078440665.1\|965488_965860_+	hypothetical protein	NA	NA	NA	NA
WP_078440666.1\|965852_966410_+	hypothetical protein	NA	NA	NA	NA
WP_078440667.1\|966406_966610_+\|tail	tail protein X	NA	NA	NA	NA

DBSCAN-SWA_3

1662382 : 1671521

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069632756.1\|1662382_1663465_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.0e-12	28.7
WP_078398151.1\|1663461_1664523_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.5e-16	35.6
WP_069632755.1\|1664605_1665223_+	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	9.9e-25	35.7
WP_153300807.1\|1665762_1666071_+	hypothetical protein	NA	NA	NA	NA
WP_078388092.1\|1666067_1666922_+	deoxyribonuclease IV	M1PMK4	Moumouvirus	2.8e-33	33.5
WP_078406256.1\|1666914_1668177_+	outer membrane protein transport protein	NA	NA	NA	NA
WP_078406257.1\|1668186_1669803_+	long-chain-fatty-acid--CoA ligase	A0A1V0SBX8	Catovirus	6.6e-36	27.7
WP_078406258.1\|1669802_1671521_+	ATP-binding protein	A0A0R6PCP6	Moraxella_phage	7.1e-20	31.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP012546

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection