CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP017018	Campylobacter pinnipediorum subsp. caledonicus strain RM18020 chromosome, complete genome	1 crisprs	DEDDh	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017018_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017018_1

283944-284018

Orphan

Consensus_repeat	Method
TTCATTATTTAGCGCTGTTATTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017018_1

>merge|NZ_CP017018|1|283944-284018|CRISPRCasFinder
TTCATTATTTAGCGCTGTTATTTGCTTTGCTTGTTGTTTTAAATTATTTATTTCATTATTTAGTGCTGTTATTTG

>NZ_CP017018|1|1|283944-284018|CRISPRCasFinder
TTCATTATTTAGCGCTGTTATTTG	CTTTGCTTGTTGTTTTAAATTATTTAT
TTCATTATTTAGTGCTGTTATTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017018.1\|WP_078422854.1\|268735_269701_-\|transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP017018.1\|WP_078422868.1\|285794_286295_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422860.1\|283119_283776_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422855.1\|270057_270984_-\|phospholipase-A	unknown	unknown	gnl\|CDD\|376748
NZ_CP017018.1\|WP_078422863.1\|284394_284667_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374352
NZ_CP017018.1\|WP_078422859.1\|281563_283117_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422866.1\|285054_285414_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422869.1\|286304_288431_-\|BspA-family-leucine-rich-repeat-surface-protein	unknown	unknown	gnl\|CDD\|308794
NZ_CP017018.1\|WP_078422865.1\|284851_285058_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422864.1\|284669_284855_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_157886648.1\|288427_288565_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078424018.1\|269958_270039_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|181662
NZ_CP017018.1\|WP_078422858.1\|278699_279680_+\|TRC40/GET3/ArsA-family-transport-energizing-ATPase	unknown	unknown	gnl\|CDD\|349755
NZ_CP017018.1\|WP_078422867.1\|285410_285779_-\|DUF1353-domain-containing-protein	unknown	unknown	gnl\|CDD\|377774
NZ_CP017018.1\|WP_078424019.1\|278417_278690_+\|DNA-helicase	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422857.1\|276681_278367_+\|carbon-starvation-protein-A	unknown	unknown	gnl\|CDD\|224877
NZ_CP017018.1\|WP_078422856.1\|270976_271597_-\|molybdenum-cofactor-guanylyltransferase	unknown	unknown	gnl\|CDD\|133000
NZ_CP017018.1\|WP_078422862.1\|284046_284391_-\|M15-family-metallopeptidase	unknown	unknown	gnl\|CDD\|350620
NZ_CP017018.1\|WP_078422870.1\|288557_288941_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017018.1\|WP_078422852.1\|268122_268563_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP017018.1\|WP_078424018.1\|269958_270039_+\|hypothetical-protein	gnl\|CDD\|181662	PRK09125, PRK09125, DNA ligase; Provisional.	8.13988e-13
NZ_CP017018.1\|WP_078422858.1\|278699_279680_+\|TRC40/GET3/ArsA-family-transport-energizing-ATPase	gnl\|CDD\|349755	cd02035, ArsA, Arsenical pump-driving ATPase ArsA. ArsA ATPase functions as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes, respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.	1.85449e-75
NZ_CP017018.1\|WP_078422854.1\|268735_269701_-\|transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	3.06964e-24
NZ_CP017018.1\|WP_078422862.1\|284046_284391_-\|M15-family-metallopeptidase	gnl\|CDD\|350620	cd14845, L-Ala-D-Glu_peptidase_like, L-Ala-D-Glu peptidase, also known as L-alanyl-D-glutamate endopeptidase. This L-Ala-D-Glu peptidase family includes L-alanyl-D-glutamate peptidase (bacteriophage T5) (also known as L-alanoyl-D-glutamate endopeptidase), and Ply118 and Ply500 L-Ala-D-Glu peptidase. Bacteriophage endolysin degrades the peptidoglycan of the bacterial host from within, leading to cell lysis and release of progeny virions. The bacteriophage endolysin Ply118 cleaves between L-Ala and D-Glu residues of Listeria cell wall peptidoglycan. This family belongs to the MEROPS peptidase M15 subfamily C.	3.83904e-12
NZ_CP017018.1\|WP_078422863.1\|284394_284667_-\|hypothetical-protein	gnl\|CDD\|374352	pfam16083, Phage_holin_3_3, LydA holin phage, holin superfamily III. Phage_holin_3_3 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as those of the bacteriophages of these organisms. Their primary function appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis. When chromosomally encoded, these enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases. LydA and lydB are encoded on the dar operon. The phenotype of a rapid lysis in the absence of active LydB suggests that this protein might be an antagonist of the holin LydA.	0.00559651
NZ_CP017018.1\|WP_078422857.1\|276681_278367_+\|carbon-starvation-protein-A	gnl\|CDD\|224877	COG1966, CstA, Carbon starvation protein, predicted membrane protein [Signal transduction mechanisms].	2.58192e-136
NZ_CP017018.1\|WP_078422856.1\|270976_271597_-\|molybdenum-cofactor-guanylyltransferase	gnl\|CDD\|133000	cd02503, MobA, MobA catalyzes the formation of molybdopterin guanine dinucleotide. The prokaryotic enzyme molybdopterin-guanine dinucleotide biosynthesis protein A (MobA). All mononuclear molybdoenzymes bind molybdenum in complex with an organic cofactor termed molybdopterin (MPT). In many bacteria, including Escherichia coli, molybdopterin can be further modified by attachment of a GMP group to the terminal phosphate of molybdopterin to form molybdopterin guanine dinucleotide (MGD). This GMP attachment step is catalyzed by MobA, by linking a guanosine 5'-phosphate to MPT forming molybdopterin guanine dinucleotide. This reaction requires GTP, MgCl2, and the MPT form of the cofactor. It is a reaction unique to prokaryotes, and therefore may represent a potential drug target.	2.74738e-45
NZ_CP017018.1\|WP_078422855.1\|270057_270984_-\|phospholipase-A	gnl\|CDD\|376748	pfam02253, PLA1, Phospholipase A1. Phospholipase A1 is a bacterial outer membrane bound acyl hydrolase with a broad substrate specificity EC:3.1.1.32. It has been proposed that Ser164 is the active site for Escherichia coli phospholipase A1.	4.63797e-79
NZ_CP017018.1\|WP_078422867.1\|285410_285779_-\|DUF1353-domain-containing-protein	gnl\|CDD\|377774	pfam07087, DUF1353, Protein of unknown function (DUF1353). This family consists of several hypothetical bacterial proteins of around 100 residues in length. The function of this family is unknown.	5.00483e-21
NZ_CP017018.1\|WP_078422869.1\|286304_288431_-\|BspA-family-leucine-rich-repeat-surface-protein	gnl\|CDD\|308794	pfam03382, DUF285, Mycoplasma protein of unknown function, DUF285. This region appears distantly related to leucine rich repeats.	1.83249e-32

>NZ_CP017018.1|WP_078422860.1|283119_283776_-|hypothetical-protein
MSTYSEEYKKILKEVLALSVEENSPYNKTIAFFEEKFNEYQLSANERIRVFAEMLPVMTTSFTTTAMQISIELANQSLSFDTNLDNLKKQGESLTANIEGIKEQTKGTQIKNEEAQEQRPDKLANLHKQGLMLDAQIAKLAQEQTLAEEQHKAIKEQVKDNKLIKGANIIENLITGNQQGGLVVPTDMSRYLFDLVGKLVEAGATPNKPSTYTMTKRS
>NZ_CP017018.1|WP_078422859.1|281563_283117_-|hypothetical-protein
MYIAFENSLNATFNAENTLESDVFSYMAGGAMDSTLAGGFGYSAFNETGADYRAIFLNKSGNLSGAITSLNEDFAEFALMSIQMSVMNDDIDTTIEIMQDIEGVIKDVILPLKRQFTNKGQGYNAIFGEDRATLQANGYTNSLEAFVKEKQFDGIIENKLEYVGNTIMPGIGGTVLGTIYDGLTTGKLNLSANAVENLSDTLLSKATNVAVKKTMSAIGTSIAPIGGMFVAEIVKMAVTEAFEVMTKLDRHYGFGGELMGFAEVDGKRMALYQQPKTIGEFLKDLVGSVNSLFGDEVESKLEMLTDWDGNMAGFGVDGRVSATYGTDGTITSTMTGNTFKGSLVDMRAYNLITTGRSDGDWLRNGKSSLYGGIIKNKSVEDIAKNYGYNTTINSPFTNAINDNLSSNWASSSGNSRRSRSRDRWHTNGSGGFYRENDKTKKSEYKSGLETTIDKSFKDKFGSSFGSSWASSSGSSRDKDSSKSSNRRSGMSDGKPGGRSRASRERSRNRERGGSSWG
>NZ_CP017018.1|WP_078422858.1|278699_279680_+|TRC40/GET3/ArsA-family-transport-energizing-ATPase
MKNKQLPKVIFVGGKGGVGKSTTSSSLAVALSSGKNTKKVLLVSTDPAHNLSDIFDVEFKNSITKVDENLSVVEIDSALEARKYVQKVAKDMRGFVGASSYAQIDNYFAKIADSSSTLEAALFERLSTILTKEISSYDHIIIDTAPTGHTLRLFFMPKELRDWSKTLLSMQERGGMSEKVLGHLDGGDKNRFSDPDGFIRGRLIEKLDERYARYSAFSNLVKDSNKCGIVLVLNASKLAIAETQRAIQSLEQKELKPYAVVLNKVLPDSSNDDFLSSRISQEAQYVKQSDNEFGKYHYAKIPLFKEDITNKENLKIFGEKVLESII
>NZ_CP017018.1|WP_078424019.1|278417_278690_+|DNA-helicase
MQMIKKIIKFSQDLESFYVGMHKSAIMKENSEIDDFFMIITFSEIYGIENPYSLYTLEMLPALMPKFHRWHQKVGLKHSFFENFPCSCCC
>NZ_CP017018.1|WP_078422857.1|276681_278367_+|carbon-starvation-protein-A
MNAVWLMLVGFAVFSFGWFVYSRLYASKVLELDDNFTTPAHEYRDNVDFVPANKFVLWGHHFTAVAGAAPIVGPAIAVQWGWLPAFLWVIIGTVAFAGIHDMSALWASVKNEGKSIGTICTRFVGSKVGQLFMIVIFLVLLMVNGAFGVIIAKESVEHTSTIIPAWGAVAIALIMGQAIYKFKMKLVPVTIVAVIALYALVPLGVAVPLSLPDSMFGLNQNAQWVVLLYIYAGIASILPVWALLQPRDYVNGIQLFVGLILLYTSIIIVHPTVAAPTFIPAITDNPGGWHVVVPVLFITVACGAISGFHGIVSSGTTSKQVDKMKDVRFVGYLGAMGEGSLSLATIIACVAGLSLINADLNLDTWADLYKGGTASFVAGGGAIIYEGLGIPQEASATLLSLMVILFAATTMDAGIRLQRYIIQEWGDIYNIGFLRGKGIATIVAVITSFTISMNGVSDGKVAIWPLFGATNQLLASLTLLVVAVILLKSKKFSGSLIALIPMSFILVMSFWGAIIKLGDYYNDQNYLLTTLNAIVIVVTLLVVLSALKVISKILADKKAAA
>NZ_CP017018.1|WP_078422856.1|270976_271597_-|molybdenum-cofactor-guanylyltransferase
MGYSCGDNGCDGFLLIKQQQSCVVLAGGKSSRMGVDKALMPFKDKASLSAYVTDKLSNIFKEVYISTKTNKFNNAKLNQSIKFIADESNESSPMIALASILHHFNEPVFIQPVDMPFLKPESIKDMSKLKDDFEIVIACEAERDHVLCGYFSPSVADKAKKLAKDGKHKIKELLKICDVVRVELSGDDEGINLNNPDDLKKALRYE
>NZ_CP017018.1|WP_078422855.1|270057_270984_-|phospholipase-A
MNKSLFILFVFSFYLFANDSSKFKLANELEKAGDIKGAMSIYKSLAAKNIKKDSRSEEYIKSDTINNSKAKDEALFRELFAGSSISFHELNYLLLGTYASSVPNNDRQKFETKFNISIKKPIEISLLPKWANLYMAYSQTSWWQTGKHSSPFRETNYRPEVFMRLYTNNERINSFDIGVLHESNGLGKDKSRSWNRVYASSKLNFSNLSITPRVWYHIGDLSDNKDIYRYLGYGDIQARYTTKNISFELLLRNNFRIKDNKGAVQASLIFPLFGGILGYLQYFNGYSESLIDYNHSTNKIGIGFTLLR
>NZ_CP017018.1|WP_078424018.1|269958_270039_+|hypothetical-protein
MITFKYQNLTKNGIPRFATFLRVRKD
>NZ_CP017018.1|WP_078422854.1|268735_269701_-|transposase
MKKCYFCGVDVSKNTLDLCFLTNNDNIKPKYEKLPNNKEVLKAYFNSFISDDILVVLEYTNNYHIALQEALSELKIKYSVLNPNKTSHFLKHLTHIKSDLTDSYGLALYCKMFKSYINPSKYNKEYILIKSYNTTSELLSKITTQLKNLKKSQSLTYDKDIEIIVKDLIKHIDSIKEKLNNIAFELLKQYIPQTEQIIKDSKGIGKDLALKLFPQLHFNRFKNAKEFISFIGLSPRIYESGTSVKKTKKINKIGSSTIRKALFMSALSCIRFNDKFKTRYNRLIDSGKNKKVAIVAVMCAIVRFLKSYFKNETNTYKFNTV
>NZ_CP017018.1|WP_078422852.1|268122_268563_-|hypothetical-protein
MAKATEALLNTEKEQEIKNIWNALNQNNDLFEQKIKVTGLKLQEGKEKIDKDGNILTDEFGEPQKWDNTYRLSYVSLNSGGEHSTRITQEQYLNLKLDEVYIASGSIKYVLYKDTYNTTPTVVFEKFTPASELFVTAMLKLEGLKK
>NZ_CP017018.1|WP_078422862.1|284046_284391_-|M15-family-metallopeptidase
MSLGKEQELFMKDVEKLLHYIHTNGYSVRGGELLRTKEQQEIYLKTGKSKTNNSNHLIKCAIDLFIFKEGNWLTNKDDLKEIGAFWESLTPINKWGGNYKNFTDCPHFERRVNG
>NZ_CP017018.1|WP_078422863.1|284394_284667_-|hypothetical-protein
MLETYIIYILIVGIVGSFVSWSKAENHNLRNIFFRVIDGCFSAYVVYEIAYYFTTNEKLSLAICGVGAFSGSDMLVSLKEFALNFFQRKI
>NZ_CP017018.1|WP_078422864.1|284669_284855_-|hypothetical-protein
MKKVLALFIGGIISIAVSIGAFYFFDVMFEDENTTFIAWLVSVGTYSAVLSPAKWLMIFKI
>NZ_CP017018.1|WP_078422865.1|284851_285058_-|hypothetical-protein
MKSILIIALMLFSGCASATKQIVYKDVLVPTKCIAEIPNKPKYESIEDAKGLMEYYLKVEALLLECVK
>NZ_CP017018.1|WP_078422866.1|285054_285414_-|hypothetical-protein
MISIIFNLLKNSKLNYAIIGLILTLCMLLYKTYTINNELLNSKNELSNLKLDNALLGVKIREKDEIIYKQNEAVKKLKVDNHNIQKALNKKIKVESVSKNASCEKKLAYFEALFKEVSR
>NZ_CP017018.1|WP_078422867.1|285410_285779_-|DUF1353-domain-containing-protein
MKDINCVVVKPFNKDRFEVVEDFIFEGIKVPKGYKSNGANVPRLLWPIFPPNSPEYLSATILHDYLCDVADSTIKYDTLKNVSFKYADDMLLKALLALGVNKFKTRLFYYSCRLYHKIKYRQ
>NZ_CP017018.1|WP_078422868.1|285794_286295_-|hypothetical-protein
MKKYFDKKEKRFVFDSYVTTDDGIFYLDRLSKEELNKIGLLPVVEVQINPDYQTVEYKEVDGEYVAQIIETKSIQEYTKEKLIQEFKDRAGEYLDKKAQEHGYDNILSASSYAGYENDFQEEGKAFGVWKSKVWKTGYMFLAEKGDQDPSTINLDELLEGLPELEI
>NZ_CP017018.1|WP_078422869.1|286304_288431_-|BspA-family-leucine-rich-repeat-surface-protein
MISMHELKLADETLEALKFLLTQTTELESAIKTINLTEIKGINESITQAKDRVETIEQGINEVKNTFENEKGDFDSKYSLFNEFHNTLDTLKSTLESLKQSALTAERNAISKADESKRYANDIKQKHDEITNATNDFRKNAEKVNQTLTSVDSAKRHIDLKTDELRAYTDDKHTKFTQIEKHLENIQQEKSDEVLQIVKSAKAETNELKEQIQDFMQNVNSANDELDQKKAELKELGSSLSEIKEQINQVISGGVINDNVVSQTQTYSSNKIEQKLADINVDEKLTNLINDNSSAINKVYSSNKINELLGDVYTKAQSDGKYALSSALANYLTTVNANNTYATKNELNSVRSAIPSTSGFLTQSSADSRYIRSENANYTTVTDNLASSSPKEALSANQGKVLKELIDKKIDKTSAEFLYLKKAGQTAFDKREQTSLSADLRQSNNFVITPSTKETLSLNNAIAGQTGMIVVMDGSKISGFSSMCKFKAIPKNLYGYELFIYFAVSPTDIKMSHITVNNSNSVESKVQRFKGTYFPLTHTTKDPVYPKYVERGGTPYTFKPNDGLYFSKPPTSFKYLFKNDPSANNSLYFNDPDISLWDTTQITNMADMFYGCKKFNQSLNNLNTENVTDMNSMFWDCYEFNQTLEHFKTDKVIDMSFMFHDCKKFNKNITNWSVGRVTIYQYFAQGSALSKSNVPSKFRNKNANTAWR
>NZ_CP017018.1|WP_157886648.1|288427_288565_-|hypothetical-protein
MINEKDKIHLIDNVKSIADIDLLKFLKNMAKHFIECKETIKKAKL
>NZ_CP017018.1|WP_078422870.1|288557_288941_-|hypothetical-protein
MIASEFKKLLSLRGKSGINLPSDELLNELVKEAIVFVATKCVPSELVVKDTTNIRLLRRLSNGFGLRIPDKVDINSTEKHIQIDEVLTYAVMYEVLFLLNKDMGFRQLAMDIINQFNANDGIEVYYD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN693273	Marine virus AFVG_25M382, complete genome	15295-15321	4	0.852
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN693503	Marine virus AFVG_25M343, complete genome	15302-15328	4	0.852
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN694088	Marine virus AFVG_250M454, complete genome	24357-24383	4	0.852
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN694007	Marine virus AFVG_250M456, complete genome	24402-24428	4	0.852
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN694027	Marine virus AFVG_250M455, complete genome	27738-27764	4	0.852
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	427341-427367	5	0.815
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NC_012547	Staphylococcus aureus plasmid pGO1, complete sequence	49256-49282	6	0.778
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NZ_CP026963	Staphylococcus aureus strain FDAARGOS_6 plasmid unnamed1	52588-52614	6	0.778
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NC_005566	Staphylococcus epidermidis SK398 plasmid pSK639, complete sequence	147-173	6	0.778
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NC_013387	Staphylococcus sp. CDC25 plasmid SAP018A, complete sequence	31965-31991	6	0.778
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN694519	Marine virus AFVG_250M726, complete genome	43046-43072	6	0.778
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NZ_CP019365	Borrelia turicatae 91E135 isolate Oz1 plasmid lpE43, complete sequence	30810-30836	7	0.741
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NZ_CP019366	Borrelia turicatae 91E135 isolate Oz1 plasmid lpF33.5, complete sequence	33119-33145	7	0.741
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NC_015712	Clostridium perfringens plasmid pCPPB-1, complete sequence	60600-60626	7	0.741
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	NZ_CP019369	Borrelia turicatae 91E135 isolate Oz1 plasmid lpU43, complete sequence	3237-3263	7	0.741
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	MN694645	Marine virus AFVG_250M761, complete genome	5577-5603	7	0.741
NZ_CP017018_1	1.1\|283968\|27\|NZ_CP017018\|CRISPRCasFinder	283968-283994	27	KC465899	Pelagibacter phage HTVC008M, complete genome	44081-44107	7	0.741

1. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN693273 (Marine virus AFVG_25M382, complete genome) position: , mismatch: 4, identity: 0.852

ctttgcttgttgttttaaattatttat	CRISPR spacer
ttctgcttgtttttttaaattattaat	Protospacer
.*.******** ************ **

2. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN693503 (Marine virus AFVG_25M343, complete genome) position: , mismatch: 4, identity: 0.852

ctttgcttgttgttttaaattatttat	CRISPR spacer
ttctgcttgtttttttaaattattaat	Protospacer
.*.******** ************ **

3. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN694088 (Marine virus AFVG_250M454, complete genome) position: , mismatch: 4, identity: 0.852

ctttgcttgttgttttaaattatttat	CRISPR spacer
ctttgcttgttgaattaaattatcaat	Protospacer
************  *********. **

4. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN694007 (Marine virus AFVG_250M456, complete genome) position: , mismatch: 4, identity: 0.852

ctttgcttgttgttttaaattatttat	CRISPR spacer
ctttgcttgttgaattaaattatcaat	Protospacer
************  *********. **

5. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN694027 (Marine virus AFVG_250M455, complete genome) position: , mismatch: 4, identity: 0.852

ctttgcttgttgttttaaattatttat	CRISPR spacer
ctttgcttgttgaattaaattatcaat	Protospacer
************  *********. **

6. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 5, identity: 0.815

ctttgcttgttgttttaaattatttat	CRISPR spacer
gttagcttgttgtattaaattattatt	Protospacer
 ** ********* **********  *

7. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NC_012547 (Staphylococcus aureus plasmid pGO1, complete sequence) position: , mismatch: 6, identity: 0.778

ctttgcttgttgttttaaattatttat	CRISPR spacer
aaacgcttgttattttaaattattaat	Protospacer
   .*******.************ **

8. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NZ_CP026963 (Staphylococcus aureus strain FDAARGOS_6 plasmid unnamed1) position: , mismatch: 6, identity: 0.778

ctttgcttgttgttttaaattatttat	CRISPR spacer
aaacgcttgttattttaaattattaat	Protospacer
   .*******.************ **

9. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NC_005566 (Staphylococcus epidermidis SK398 plasmid pSK639, complete sequence) position: , mismatch: 6, identity: 0.778

ctttgcttgttgttttaaattatttat	CRISPR spacer
aaacgcttgttattttaaattattaat	Protospacer
   .*******.************ **

10. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NC_013387 (Staphylococcus sp. CDC25 plasmid SAP018A, complete sequence) position: , mismatch: 6, identity: 0.778

ctttgcttgttgttttaaattatttat	CRISPR spacer
aaacgcttgttattttaaattattaat	Protospacer
   .*******.************ **

11. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN694519 (Marine virus AFVG_250M726, complete genome) position: , mismatch: 6, identity: 0.778

ctttgcttgttgttttaaattatttat	CRISPR spacer
attaatttgttgttttaaattatttgg	Protospacer
 ** ..*******************.

12. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NZ_CP019365 (Borrelia turicatae 91E135 isolate Oz1 plasmid lpE43, complete sequence) position: , mismatch: 7, identity: 0.741

ctttgcttgttgttttaaattatttat	CRISPR spacer
tagagattgttgttttaaattatttta	Protospacer
.   * *******************

13. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NZ_CP019366 (Borrelia turicatae 91E135 isolate Oz1 plasmid lpF33.5, complete sequence) position: , mismatch: 7, identity: 0.741

ctttgcttgttgttttaaattatttat	CRISPR spacer
tagagattgttgttttaaattatttta	Protospacer
.   * *******************

14. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NC_015712 (Clostridium perfringens plasmid pCPPB-1, complete sequence) position: , mismatch: 7, identity: 0.741

ctttgcttgttgttttaaattatttat	CRISPR spacer
aaagattagttgttttaaattatttat	Protospacer
    ..* *******************

15. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to NZ_CP019369 (Borrelia turicatae 91E135 isolate Oz1 plasmid lpU43, complete sequence) position: , mismatch: 7, identity: 0.741

ctttgcttgttgttttaaattatttat	CRISPR spacer
tagagattgttgttttaaattatttta	Protospacer
.   * *******************

16. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to MN694645 (Marine virus AFVG_250M761, complete genome) position: , mismatch: 7, identity: 0.741

ctttgcttgttgttttaaattatttat	CRISPR spacer
aaagtattgttgttttaaattttttat	Protospacer
      *************** *****

17. spacer 1.1|283968|27|NZ_CP017018|CRISPRCasFinder matches to KC465899 (Pelagibacter phage HTVC008M, complete genome) position: , mismatch: 7, identity: 0.741

ctttgcttgttgttttaaattatttat	CRISPR spacer
agacatttcttgttttaaattatttat	Protospacer
   ...** ******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

202758 : 269701

Campylobacter_phage(18.52%)

integrase,plate,tail,capsid,terminase,transposase

attL 201044:201062|attR 236202:236220

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
201044:201062	attL	NA	NA	NA	NA
WP_078422781.1\|202758_204777_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0M4U788	Ralstonia_phage	2.3e-17	26.9
WP_078422782.1\|204850_205771_+	AAA family ATPase	F6MII7	Haemophilus_phage	3.2e-27	32.6
WP_078422783.1\|205785_206031_+	hypothetical protein	NA	NA	NA	NA
WP_078422784.1\|206097_206475_+	DUF1937 family protein	NA	NA	NA	NA
WP_078422785.1\|206664_207084_+	hypothetical protein	NA	NA	NA	NA
WP_078422786.1\|207162_207795_+	hypothetical protein	NA	NA	NA	NA
WP_078422787.1\|207791_208199_+	DUF1018 domain-containing protein	NA	NA	NA	NA
WP_078422788.1\|208191_208470_+	hypothetical protein	NA	NA	NA	NA
WP_157886643.1\|208499_208676_+	hypothetical protein	NA	NA	NA	NA
WP_078422789.1\|208672_209359_+	hypothetical protein	NA	NA	NA	NA
WP_078422790.1\|209380_209740_+	hypothetical protein	NA	NA	NA	NA
WP_078422791.1\|209764_209998_+	hypothetical protein	X2KQ78	Campylobacter_phage	5.8e-10	50.7
WP_078422792.1\|210425_211073_+	hypothetical protein	B6SD57	Bacteriophage	1.2e-12	41.4
WP_078422793.1\|211069_211282_+	hypothetical protein	NA	NA	NA	NA
WP_078422794.1\|211300_211762_-	phage virion morphogenesis protein	A7YGZ0	Campylobacter_phage	3.8e-21	42.6
WP_078422795.1\|211885_213100_-\|capsid	minor capsid protein	A0A0M4UTA3	Ralstonia_phage	1.1e-32	35.1
WP_078422796.1\|213092_214451_-	DUF935 family protein	A0A2H4JHL1	uncultured_Caudovirales_phage	9.5e-20	27.9
WP_078422797.1\|214454_216098_-\|terminase	phage terminase large subunit	Q6TM76	Pseudomonas_phage	2.7e-93	39.8
WP_078422798.1\|216097_216595_-	DUF1804 family protein	NA	NA	NA	NA
WP_078422799.1\|216604_217000_-	DUF1320 family protein	NA	NA	NA	NA
WP_078422800.1\|217131_218103_-\|capsid	major capsid protein	NA	NA	NA	NA
WP_078422801.1\|218106_218436_-	hypothetical protein	NA	NA	NA	NA
WP_078422802.1\|218438_219254_-	hypothetical protein	A0A2K9VH54	Faecalibacterium_phage	1.4e-26	31.1
WP_078422803.1\|219250_219739_-	hypothetical protein	NA	NA	NA	NA
WP_078422804.1\|219897_220317_+	hypothetical protein	A0A1S5RFB5	Helicobacter_phage	2.3e-12	39.0
WP_078422805.1\|220316_220670_+	hypothetical protein	NA	NA	NA	NA
WP_078422806.1\|220662_220902_+	hypothetical protein	NA	NA	NA	NA
WP_078422807.1\|220898_221084_+	hypothetical protein	NA	NA	NA	NA
WP_078422808.1\|221085_221358_+	hypothetical protein	NA	NA	NA	NA
WP_078424016.1\|221370_221976_+\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	7.0e-15	36.8
WP_078422809.1\|222077_222362_+	GPW/gp25 family protein	Q75QM0	Wolbachia_phage	4.1e-10	42.5
WP_078422810.1\|222358_223444_+\|plate	baseplate J/gp47 family protein	V5YTH6	Pseudomonas_phage	9.9e-20	28.4
WP_078422811.1\|223440_224061_+\|tail	phage tail protein	A0A2K9V471	Faecalibacterium_phage	1.3e-11	34.3
WP_078422812.1\|224057_225500_+\|tail	phage tail protein	A0A193GYM0	Enterobacter_phage	2.7e-36	30.3
WP_078422813.1\|225509_226121_+	hypothetical protein	F5B3N7	Synechococcus_phage	4.6e-06	48.2
WP_078422814.1\|226507_227668_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A7YGY2	Campylobacter_phage	1.6e-84	46.7
WP_078422815.1\|227842_228358_+\|tail	phage major tail tube protein	A7YGZ4	Campylobacter_phage	2.7e-31	44.6
WP_078422816.1\|228579_228822_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_078422817.1\|229191_229440_+	hypothetical protein	NA	NA	NA	NA
WP_078422818.1\|229456_231742_+\|tail	phage tail tape measure protein	A0A097I4X9	Vibrio_phage	5.4e-76	38.3
WP_078422819.1\|231746_232118_+\|tail	phage tail protein	NA	NA	NA	NA
WP_078422820.1\|232114_232306_+\|tail	tail protein X	NA	NA	NA	NA
WP_078422821.1\|232299_233274_+\|tail	phage tail protein	A0A088FRU7	Escherichia_phage	1.4e-17	29.3
WP_078422822.1\|233367_234123_+	DNA adenine methylase	A7YGI9	Campylobacter_phage	6.8e-84	61.8
WP_078422823.1\|234200_234860_+	S24 family peptidase	E8ZDN4	Streptococcus_phage	1.7e-06	35.5
WP_078422824.1\|235318_236062_-	HugZ family heme oxygenase	NA	NA	NA	NA
WP_089503397.1\|236393_237101_-	plasminogen-binding N-terminal domain-containing protein	NA	NA	NA	NA
236202:236220	attR	NA	NA	NA	NA
WP_078422826.1\|237225_238395_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2P1JY73	Gordonia_phage	5.9e-18	44.2
WP_078422827.1\|238406_239774_+	magnesium transporter	NA	NA	NA	NA
WP_078422828.1\|239758_240355_+	NUDIX hydrolase	NA	NA	NA	NA
WP_078422829.1\|240351_240867_+	sel1 repeat family protein	NA	NA	NA	NA
WP_157886644.1\|240902_242714_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_078422831.1\|242726_243149_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_078422832.1\|243418_244078_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_157886680.1\|244173_245289_+	AAA family ATPase	A0A127AWE7	Bacillus_phage	1.4e-53	37.1
WP_069638044.1\|245533_246004_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_078422833.1\|245981_246248_+	DUF493 domain-containing protein	NA	NA	NA	NA
WP_078422834.1\|246260_247478_+	hypothetical protein	NA	NA	NA	NA
WP_078422835.1\|247490_247877_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_078424017.1\|247892_249524_+	multidrug ABC transporter permease/ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	5.7e-11	28.9
WP_078422836.1\|249573_250287_+	NADH dehydrogenase	NA	NA	NA	NA
WP_078422837.1\|250286_252656_+	flagellar protein	NA	NA	NA	NA
WP_162272893.1\|252682_255607_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_157886645.1\|258484_259252_+	DNA ligase	A0A1X9VNU1	Mimivirus	4.2e-33	35.4
WP_078422840.1\|259290_259632_-	M15 family metallopeptidase	A0A0F7IJZ9	Polaribacter_phage	1.2e-11	33.0
WP_069637346.1\|259634_259865_-	hypothetical protein	NA	NA	NA	NA
WP_069637347.1\|259876_260215_-	hypothetical protein	NA	NA	NA	NA
WP_078422841.1\|260236_260590_-	hypothetical protein	NA	NA	NA	NA
WP_078422842.1\|261327_261684_-	hypothetical protein	NA	NA	NA	NA
WP_078422843.1\|261699_262428_-	hypothetical protein	NA	NA	NA	NA
WP_157886646.1\|262430_262592_-	hypothetical protein	NA	NA	NA	NA
WP_078422844.1\|262588_263350_-	hypothetical protein	NA	NA	NA	NA
WP_157886647.1\|263349_263511_-	hypothetical protein	NA	NA	NA	NA
WP_078422845.1\|263507_264635_-	hypothetical protein	NA	NA	NA	NA
WP_078422846.1\|264692_265358_-	hypothetical protein	NA	NA	NA	NA
WP_078422847.1\|265354_265681_-	hypothetical protein	NA	NA	NA	NA
WP_078422849.1\|266060_266363_-	hypothetical protein	NA	NA	NA	NA
WP_078422850.1\|266352_267801_-	hypothetical protein	NA	NA	NA	NA
WP_078422851.1\|267797_268016_-	hypothetical protein	NA	NA	NA	NA
WP_078422852.1\|268122_268563_-	hypothetical protein	NA	NA	NA	NA
WP_078422854.1\|268735_269701_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

297792 : 321230

Campylobacter_phage(15.79%)

integrase,tRNA

attL 314804:314819|attR 319914:319929

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078424020.1\|297792_299094_-	phosphatase	A0A1Y0T3N1	Sinorhizobium_phage	1.1e-20	26.7
WP_078422878.1\|299086_299557_-\|tRNA	glutamyl-tRNA amidotransferase	NA	NA	NA	NA
WP_078422879.1\|299558_299933_-	DUF1064 domain-containing protein	B5AX30	Iodobacteriophage	4.8e-06	43.4
WP_078422880.1\|299910_300321_-	hypothetical protein	NA	NA	NA	NA
WP_078422881.1\|300314_300509_-	hypothetical protein	NA	NA	NA	NA
WP_078422882.1\|300510_301128_-	hypothetical protein	NA	NA	NA	NA
WP_078422883.1\|301117_302074_-	hypothetical protein	I6PDJ3	Cronobacter_phage	7.2e-06	31.2
WP_078422884.1\|302331_302547_-	hypothetical protein	NA	NA	NA	NA
WP_069637506.1\|302527_302812_-	hypothetical protein	NA	NA	NA	NA
WP_078422885.1\|302926_303619_+	S24 family peptidase	A0A0E3U270	Fusobacterium_phage	2.6e-05	31.2
WP_078422886.1\|303734_304478_+	LexA family transcriptional regulator	A0A1B0RXB1	Streptococcus_phage	2.6e-11	29.2
WP_078422887.1\|304649_305015_+	hypothetical protein	NA	NA	NA	NA
WP_078422888.1\|305002_305596_+	ImmA/IrrE family metallo-endopeptidase	A0A142KB62	Gordonia_phage	3.9e-10	36.8
WP_157886651.1\|305655_305940_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_141080419.1\|306724_307033_-	hypothetical protein	NA	NA	NA	NA
WP_078424021.1\|307281_307914_+	DUF3560 domain-containing protein	NA	NA	NA	NA
WP_078422891.1\|307923_308136_+	hypothetical protein	NA	NA	NA	NA
WP_078422892.1\|308248_309043_+	PD-(D/E)XK nuclease-like domain-containing protein	M4SQR8	Cyanophage	2.0e-38	40.3
WP_078422893.1\|309104_310064_+	RelA/SpoT domain-containing protein	A0A1B0VBT5	Salmonella_phage	1.6e-21	30.1
WP_078422894.1\|310056_310302_+	hypothetical protein	NA	NA	NA	NA
WP_078422895.1\|310432_310810_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1X9I6C0	Streptococcus_phage	2.1e-09	34.4
WP_078422896.1\|310819_311011_+	hypothetical protein	NA	NA	NA	NA
WP_078422897.1\|311052_311322_-	hypothetical protein	NA	NA	NA	NA
WP_078422898.1\|311408_311648_+	hypothetical protein	NA	NA	NA	NA
WP_078422899.1\|311662_311899_+	hypothetical protein	M5A9C2	Nitratiruptor_phage	1.7e-09	57.6
WP_078422900.1\|312051_312798_+	hypothetical protein	NA	NA	NA	NA
WP_157886652.1\|312772_312913_+	hypothetical protein	NA	NA	NA	NA
WP_089503398.1\|312938_313751_+	phage recombination protein Bet	A0A1P8BKG8	Lactococcus_phage	8.8e-13	32.8
WP_078422902.1\|313750_314002_+	hypothetical protein	X2CY11	Brucella_phage	1.1e-09	44.4
WP_078422903.1\|314013_314232_+	hypothetical protein	NA	NA	NA	NA
WP_078422904.1\|314224_314740_+	single-stranded DNA-binding protein	Q4ZC22	Staphylococcus_virus	3.5e-15	46.2
314804:314819	attL	NA	NA	NA	NA
WP_078422905.1\|314853_315270_+	type II toxin-antitoxin system PemK/MazF family toxin	X2KLV2	Campylobacter_phage	2.8e-39	57.8
WP_078422906.1\|315514_316510_+	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	9.9e-75	46.3
WP_078422907.1\|316511_316742_+	hypothetical protein	X2KQ78	Campylobacter_phage	7.0e-08	47.1
WP_078422908.1\|317168_317885_+	Rha family transcriptional regulator	X2KM03	Campylobacter_phage	1.2e-32	45.9
WP_078422909.1\|317992_318199_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078422910.1\|318149_319334_-\|integrase	site-specific integrase	B7SYF8	Stenotrophomonas_phage	7.0e-43	30.5
WP_078422911.1\|319930_320335_-	Hpt domain-containing protein	NA	NA	NA	NA
319914:319929	attR	NA	NA	NA	NA
WP_078397618.1\|320432_321230_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	9.5e-44	38.6

DBSCAN-SWA_3

1573453 : 1582592

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078423902.1\|1573453_1574536_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.5e-12	27.2
WP_078423903.1\|1574532_1575594_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.2e-16	35.6
WP_078423904.1\|1575676_1576294_+	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	1.9e-23	34.6
WP_141080396.1\|1576833_1577142_+	hypothetical protein	NA	NA	NA	NA
WP_078423906.1\|1577138_1577993_+	deoxyribonuclease IV	M1PMK4	Moumouvirus	3.6e-33	33.1
WP_078423907.1\|1577985_1579248_+	outer membrane protein transport protein	NA	NA	NA	NA
WP_078423908.1\|1579257_1580874_+	long-chain-fatty-acid--CoA ligase	A0A1V0SBX8	Catovirus	1.9e-35	28.5
WP_078423909.1\|1580873_1582592_+	ATP-binding protein	A0A0R6PCP6	Moraxella_phage	2.4e-20	33.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage