CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019781	Bartonella sp. WD16.2, complete genome	1 crisprs	DEDDh	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019781_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019781_1

749381-749502

Orphan

Consensus_repeat	Method
GGAAAAGTTTATGGTAATGCAAAAAT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP019781_1

>merge|NZ_CP019781|1|749381-749502|PILER-CR
GGTGAAGTTTATGAGAATGCTACGATTGGTGGCCGTGTTAGGATTTACGGTTCCGTTTATGGTAATGCAAAAATTGCTGGTAGTGGATGGGTTTGGGGAAAAGCATATGGTAATGCAAAAAT

>NZ_CP019781|1|1|749381-749502|PILER-CR
GGTGAAGTTTATGAGAATGCTACGAT	TGGTGGCCGTGTTAGGATTTACGGTTCCGTTTAT
GGTAATGCAAAAATTGCTGGTAGTGG	ATGGGTTTGGGGAAAAGCATAT
GGTAATGCAAAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019781.1\|WP_078705398.1\|753351_753672_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_078705387.1\|746647_746974_+\|DUF1376-domain-containing-protein	unknown	unknown	gnl\|CDD\|369218
NZ_CP019781.1\|WP_078705392.1\|750743_751178_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|235782
NZ_CP019781.1\|WP_078705400.1\|754993_757036_+\|phage-portal-protein	unknown	unknown	gnl\|CDD\|293119
NZ_CP019781.1\|WP_078705383.1\|744604_744904_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP019781.1\|WP_078705395.1\|752093_752351_+\|antitoxin	unknown	unknown	gnl\|CDD\|225215
NZ_CP019781.1\|WP_078705399.1\|753683_755009_+\|terminase	unknown	unknown	gnl\|CDD\|335802
NZ_CP019781.1\|WP_078705388.1\|747166_748054_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_153300985.1\|744032_744413_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_078705384.1\|744997_745318_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP019781.1\|WP_078705380.1\|741666_742452_-\|phage-recombination-protein-Bet	unknown	unknown	gnl\|CDD\|273871
NZ_CP019781.1\|WP_078705381.1\|743415_743991_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369825
NZ_CP019781.1\|WP_078705397.1\|752683_752977_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_078705396.1\|752350_752683_+\|pemk-protein	unknown	unknown	gnl\|CDD\|182089
NZ_CP019781.1\|WP_153300986.1\|746963_747116_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_078704976.1\|741044_741665_-\|YqaJ-viral-recombinase-family-protein	unknown	unknown	gnl\|CDD\|378216
NZ_CP019781.1\|WP_078705386.1\|745872_746490_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_078705391.1\|750084_750408_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|162974
NZ_CP019781.1\|WP_078705394.1\|751494_752040_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019781.1\|WP_078705390.1\|749760_750072_-\|addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|226162

Protein	Function_ID	Function_description	E-value
NZ_CP019781.1\|WP_078705387.1\|746647_746974_+\|DUF1376-domain-containing-protein	gnl\|CDD\|369218	pfam07120, DUF1376, Protein of unknown function (DUF1376). This family consists of several hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown.	2.26344e-05
NZ_CP019781.1\|WP_078705400.1\|754993_757036_+\|phage-portal-protein	gnl\|CDD\|293119	pfam16510, P22_portal, Phage P22-like portal protein. The portal protein of P22 and similar Podoviridae tail phages is a dodecameric structure consisting of a hip (2), a leg(1) and a barrel(3). DNA viruses such as bacteriophages and herpesviruses deliver their genome into and out of the capsid through large proteinaceous assemblies, known as portal proteins. Domains 1 and 3 are mostly helical and form the majority of the DNA-translocating channel. Domain 2 adopts an alpha-beta-fold characterized by two sheets of eight beta-strands, which cross each other to form a beta-barrel-like structure.	2.64856e-07
NZ_CP019781.1\|WP_078705383.1\|744604_744904_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	7.87035e-09
NZ_CP019781.1\|WP_078705399.1\|753683_755009_+\|terminase	gnl\|CDD\|335802	pfam04466, Terminase_3, Phage terminase large subunit. Initiation of packaging of double-stranded viral DNA involves the specific interaction of the prohead with viral DNA in a process mediated by a phage-encoded terminase protein. The terminase enzymes are usually hetero-oligomers composed of a small and a large subunit. This region is found on the large subunit and possess an endonuclease and ATPase activity that require Mg2+ and a neutral or slightly basic reaction. This region is also found in bacterial sequences.	6.65595e-21
NZ_CP019781.1\|WP_078705380.1\|741666_742452_-\|phage-recombination-protein-Bet	gnl\|CDD\|273871	TIGR01913, Uncharacterized_protein_UU154, phage recombination protein Bet. This model represents the phage recombination protein Bet from a number of phage, including phage lambda. All members of this family are found in phage genomes or in putative prophage regions of bacterial genomes. [Mobile and extrachromosomal element functions, Prophage functions].	1.29171e-25
NZ_CP019781.1\|WP_078705384.1\|744997_745318_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.94281e-10
NZ_CP019781.1\|WP_078705392.1\|750743_751178_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|235782	PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional.	6.68634e-52
NZ_CP019781.1\|WP_078705381.1\|743415_743991_-\|hypothetical-protein	gnl\|CDD\|369825	pfam08346, AntA, AntA/AntB antirepressor. In E. coli the two proteins AntA and AntB have 62% amino acid identities near their N termini. AntA appears to be encoded by a truncated and divergent copy of AntB. The two proteins are homologous to putative antirepressors found in numerous bacteriophages, such as the hypothetical antirepressor protein encoded by the gene LO142 of the bacteriophage 933W.	2.38941e-14
NZ_CP019781.1\|WP_078705396.1\|752350_752683_+\|pemk-protein	gnl\|CDD\|182089	PRK09812, PRK09812, type II toxin-antitoxin system ChpB family toxin.	4.25977e-31
NZ_CP019781.1\|WP_078705395.1\|752093_752351_+\|antitoxin	gnl\|CDD\|225215	COG2336, MazE, Growth regulator [Signal transduction mechanisms].	1.53882e-10
NZ_CP019781.1\|WP_078704976.1\|741044_741665_-\|YqaJ-viral-recombinase-family-protein	gnl\|CDD\|378216	pfam09588, YqaJ, YqaJ-like viral recombinase domain. This protein family is found in many different bacterial species but is of viral origin. The protein forms an oligomer and functions as a processive alkaline exonuclease that digests linear double-stranded DNA in a Mg(2+)-dependent reaction, It has a preference for 5'-phosphorylated DNA ends. It thus forms part of the two-component SynExo viral recombinase functional unit.	9.69338e-30
NZ_CP019781.1\|WP_078705391.1\|750084_750408_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|162974	TIGR02683, Uncharacterized_protein_HI_1419, putative addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.	2.0222e-43
NZ_CP019781.1\|WP_078705390.1\|749760_750072_-\|addiction-module-antidote-protein	gnl\|CDD\|226162	COG3636, COG3636, Predicted transcriptional regulator [Transcription].	8.90935e-23

>NZ_CP019781.1|WP_078705388.1|747166_748054_+|hypothetical-protein
MLRDQKIVLLEDGRLWSLQVEEELKNFIDKQEHISQVRSEAGRKGAQAKMLKKQSVNDYVEANGKQNNNFVEANDKQNQAIKNKNKNIYKKTNTIVLSKKEIASENLATEVSVQDETTDDAVEQHLDHDTSSSENQSPVSQQKSTEKKTKRSGDRRGCRLPHDFEPNLQYAIDRGLTHDEALLEFEKFKNYWLAKSGQGAIKKDWQLTWYNWVISDYGLVAQKAKLEKEKQNGRDGNYSRREKSVGERIADNIRNLGSRGFFNANLQNDSTGIPITLESWECIDETARNDSVESL
>NZ_CP019781.1|WP_153300986.1|746963_747116_+|hypothetical-protein
MSTKLLWVKSFSSDCLADTSGMKAFQIATYVILQWHMRRSGEPIFVIQVN
>NZ_CP019781.1|WP_078705387.1|746647_746974_+|DUF1376-domain-containing-protein
MATKSPWVKFYPGQFLIELMLLKPKETAIYTTLVLLMLHERAPIFNDASHLSSLCSCSVWTFRNILESLMSRGYIIRLESGRLWYTSSAVDLDISSTSSERKGESYVN
>NZ_CP019781.1|WP_078705386.1|745872_746490_-|hypothetical-protein
MTVFECFSIISIVISSIHASISVWVRYEEQKKKALGRTLQFNCVSYRSPVSPYKNENPEITIKLALHNPTKQVIKVNNIWIDHKSPFQFIEARYINPNPKFPKKPDIIISTKPKHIDLINPQTKPESEHFFDLFSINSKQEIILSLTVLVKQPTTVNPITIILEHTSSNDPSKTLKLLCNLGFFKLSDEQNLNCINKLFKESAPQ
>NZ_CP019781.1|WP_078705384.1|744997_745318_+|helix-turn-helix-transcriptional-regulator
MFKLKSYLSENNITYAAFAVSVGVTQASIARYVNGKRFPHPRIIKKIAKITNNYVSPSDWYQENFTAVTQDLMQKKETSPSCEFVDGCVVSRAGYEQTDGQQSIGG
>NZ_CP019781.1|WP_078705383.1|744604_744904_-|helix-turn-helix-domain-containing-protein
MNNLKFFRKKMGLSSKKLAELVGTSQPQIFRLENGQRKLTKEWAIRLAPHLATTPKQLMFSEQQTNSLDEQIQDMLEHLSYDKKVKLLDFLSSFYQEKK
>NZ_CP019781.1|WP_153300985.1|744032_744413_-|hypothetical-protein
MNERGWKMNKQLFVNADEILLIVSTYDDDYYAKPGPIDKTEIMDIVGQMETVESILRIDLMSNRYDDISEEVAEFYVQKYLNDYDNYYFVEDAPYPFIAHSCAYSDVLDKIEERENTSPFYSTCRQ
>NZ_CP019781.1|WP_078705381.1|743415_743991_-|hypothetical-protein
MKGWKMNKQVSVGYNEVLLIITGDEISHPALYGPFSTAEIMYIVNTLNNVIKIFCINPDESSLDDLSEEIAEIYVKNSDSSLLERETHLFIEDSEVYYNLLRANRKPPKWMNAYALHERLKVKTNFNDWITQRIQEYKLKKEDDFYIKNDDPPKGYYLTIDIAKKLAKAENSDAGKEVYRYLCVISKVYKQ
>NZ_CP019781.1|WP_078705380.1|741666_742452_-|phage-recombination-protein-Bet
MTSSLVEKMAQQYDFSEREFREAIFKTCISCDISNAEFLVFVYLAKKYGLDPLNKEIYAIPKRGGGIISVVSVDGWLKVIHSHDNLDGVELQENFDNEGNLFSVTCAIYLKDKKYPFKITEYLKECKRNTEPWNQCPARMLRHKALIQCARYAFGLSGIYDKDEAERINEAIYLSEVNDNPQNERISDESLAQIKELMEQTKTEEEKVLSYAKVTNLAEMSHETGQIILKRLEAKQHLQMNEAQQALPLPNTPIQQASMGV
>NZ_CP019781.1|WP_078704976.1|741044_741665_-|YqaJ-viral-recombinase-family-protein
MQQRTAEWFQARLGKVTASNINSIVDKTAKGLPTSKYEEYKIKLITERLTGKTVSSYETPAMRWGNEHEDSAIEEYSFLYDTTVTRCGFIPHPTIEMAGASPDGLIGDDGLIEVKCPQEITHVRFLRDGKIKPEYILQMQFQMACTGRKWCDFVSYHPWFIDKSPHLCIRALRIPRDDEQIELINKAVEAFLAEVEQDMQFLTNAA
>NZ_CP019781.1|WP_078705390.1|749760_750072_-|addiction-module-antidote-protein
MKDRNHDDAMAELFYNDPETAAATLDAILADGDQGELLVTLRQMAKAYGGVQTVAKAAELNPTQLYRTLSQKGNPELRSLTALLRTMGLRLAVQPLERSVPHI
>NZ_CP019781.1|WP_078705391.1|750084_750408_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MFKIRHYLTADGKNLITDWLHKLRDVQTKTAIIRRLNRLEQGNFGDFRPLRDGIYELRIHIGPGYRIYYTQLGKTVLLLLCGGTKRTQNTDITRACAYWHDWQNRED
>NZ_CP019781.1|WP_078705392.1|750743_751178_+|single-stranded-DNA-binding-protein
MINKVILVGNLGADPESRTMASGAEVVNFRIATSQSYTDKTTGEKVDKTEWHSVVVFNPHLAKVALQYLSKGSKVYVEGQLQTRKWQDKSGQTRYTTEIVLPQYRGELKILNSIQKDGIDMALEAMEQEDKRYLETTLDDDIPF
>NZ_CP019781.1|WP_078705394.1|751494_752040_+|hypothetical-protein
MKKRKKRGRPRITGQKREPNGRISRAKTPRKPTDQLTLEMRAKHYGISIQDAKNPLMGTYVGRLYLLEKKINQDQYDASQQYIQVRNDYCCAKGFPGAVHDDVTSNHDQDSLEKWVKITTDRYEAVRDVIRETQGLYRQYNLYAALQYIVIEDQQLKHLVSSLYIALNALHKFFSQECKNH
>NZ_CP019781.1|WP_078705395.1|752093_752351_+|antitoxin
MHTTKLRKVGGSVMLSIPPALLDVLHLVENTEVGLTIDNGCLIVEPQVFPSYTLDELLAQCDPLADLYDEETKWLDAEPVGRELL
>NZ_CP019781.1|WP_078705396.1|752350_752683_+|pemk-protein
MNRGEIWLVSLDPSSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGSFARIAGFVVSLMGVGLHTTGVIRCDQPRALDIGARKGKKLETVPVMIMNEVLAKLSTFLT
>NZ_CP019781.1|WP_078705397.1|752683_752977_-|hypothetical-protein
MCFLSIKRAALLGIFISGLALTSCEREVNADKNRIPNNLADALDMFDVGPQNLDDLPDEVLEQFNINRRDLCQTLKQQRKQYYGYDKYENLNCNQYN
>NZ_CP019781.1|WP_078705398.1|753351_753672_+|hypothetical-protein
MASGSDKSVKGTPPNAGAERVKGVPNKTTRILKEAVIKAAEQAGNKYGNEGLISYLERQAVKCPAAYLALLGKILPLQVTGENDEAIKMITRVEIVAPVVKDKKAV
>NZ_CP019781.1|WP_078705399.1|753683_755009_+|terminase
MATAQVVIIEKLIPLFQGAADVRAAWGGRGSGKTRSFALMAALKGYEYGMGGISGIILCARQFQNSLAESSLQEIKRAIETYDFLKDYYCVGESSIKSKDGRISFQFSGLDRNIASIKSMGRILLCWVDEAEPVTETAWQTLIPTLREEGEGWRAELWVTWNPLRENAPVERRFRFTKDENIKGVEVNWSDNPLFPQKLQRVRLDDLQNRPESYKHIWEGDYLKAVQGAYFQKEMLAAEQEGRIGHVARDPLMPIRAFWDIGGTGAKADATAIWIAQFVGREIRVLDYYEAQGQPLSEHIGWLRHNGYDKAVMVLPHDGATRDRVYNVSFESALNEAGFDTQVVPNQGAGAVKMRIEAVRRILPCVWFHEETTVAGRKALNWYHEKWDEKRAIGLGAEHDWASHGADAFGLMCTVYEAPRTPSKPERYSATERETASWMAF
>NZ_CP019781.1|WP_078705400.1|754993_757036_+|phage-portal-protein
MDGILENDLKKTTSLDDDALYRRLKSWYAEDIEHANEWREQAREDFDFYNGRQWAEEDLAVLKAQRRPVMTFNRIAPLVNAIVGAERNNKREVQFQPRQVGAAISNELLTGAAEWFRDEAEAEYADSDAFQDMVICGMGWTDTRLDYEENPEGKPTVRRLDPLKMVWDVNAVRPNLVDAQRMWYVDRKPIEDAKSLFPNVASEDLNADWAIDNTTDLEDYHVSLDAYGDDNNGIDAISRKRYVTLVECRWFEHETYYKAPDLQTGQMRDYSAQEFEQLQMLMPQIQGASFHKKVVKRVFLGRRLLGKPDRPLAPDGQLGWECITGTLDKLKNQFYGIVRPAKDPQKWSNKYFSQVMYILNSQAKGGIMAERDAFDDDRQAVESWAKADTITWLKNGALTRGMIQSKPRAEFPNGFFQLFNESREALTHVTGLSAEFIGTREVNQANVLENTRRQSTLNLLAGLFDNLKLYRCRQGKIILYLIQNYLSDGRLVRISGPEKAEYVPLTREAVTTLEYDIIVDDSPTSPNEKEKTFAAVTQMLPLLGNFLTPDMIPDLLKLSPLPATLVASLTAKAQQAQMQQQQQQMMMQNQGPQLSPEQQAKVAAIQQETQAKGVLNQLDAQSKQAALQQKNIELFLKQEQARMQLEMQRARNAITERELQIRALQIELEGYRAATIRGKT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

121604 : 128145

Mannheimia_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010703127.1\|121604_121886_+	protein killer suppression protein	A0A0M3LQB1	Mannheimia_phage	6.5e-16	47.3
WP_078704974.1\|121903_122203_+	HigA family addiction module antidote protein	A0A0M3LPV0	Mannheimia_phage	1.4e-16	46.6
WP_078704975.1\|123308_123521_-	hypothetical protein	NA	NA	NA	NA
WP_078704976.1\|123639_124260_-	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	2.1e-46	47.5
WP_078704977.1\|124261_125047_-	phage recombination protein Bet	A0A0M3LR26	Mannheimia_phage	1.6e-40	39.1
WP_078704978.1\|125187_125865_-	hypothetical protein	A0A0M3LPL3	Mannheimia_phage	2.6e-10	61.1
WP_078704979.1\|125901_126213_-	hypothetical protein	NA	NA	NA	NA
WP_078704980.1\|126212_126626_-	hypothetical protein	NA	NA	NA	NA
WP_010702522.1\|126817_127129_-	transcriptional regulator	NA	NA	NA	NA
WP_078704981.1\|127223_127565_+	hypothetical protein	NA	NA	NA	NA
WP_078706098.1\|127575_128145_+	hypothetical protein	K4Q356	Edwardsiella_phage	2.0e-11	56.9

DBSCAN-SWA_2

434188 : 443745

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078705152.1\|434188_436075_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.4e-37	27.0
WP_078705153.1\|436189_436888_+	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	4.9e-12	29.3
WP_078705154.1\|436896_437736_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_078705155.1\|437801_438551_-	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.5e-09	28.7
WP_078705156.1\|438553_440047_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.6e-47	33.1
WP_078705157.1\|440164_440707_-	CvpA family protein	NA	NA	NA	NA
WP_078705158.1\|440859_442236_-	DNA repair protein RadA	W5QUL4	Bacillus_phage	5.1e-05	43.1
WP_078705159.1\|442242_443745_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.8e-78	37.0

DBSCAN-SWA_3

562886 : 685303

109

Acidithiobacillus_phage(14.29%)

tail,integrase,capsid,tRNA,plate,portal,terminase,head

attL 590510:590528|attR 641844:641862

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078705244.1\|562886_564314_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_078705245.1\|566810_567293_-	bacterioferritin	NA	NA	NA	NA
WP_078705246.1\|567810_568515_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_078705247.1\|568604_569159_+	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_078705248.1\|569357_570746_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	9.7e-44	28.5
WP_078705249.1\|570822_572202_+	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_078705250.1\|572324_574001_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	6.5e-95	38.4
WP_078705251.1\|574011_575394_+\|tRNA	glutamate--tRNA ligase	A0A2K9L594	Tupanvirus	2.8e-11	32.2
WP_078705252.1\|575470_576874_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.2e-53	33.4
WP_078705253.1\|577016_577790_-	NAD kinase	NA	NA	NA	NA
WP_078705254.1\|580777_582169_+	amino acid permease	NA	NA	NA	NA
WP_078705255.1\|583615_583978_-	response regulator	NA	NA	NA	NA
WP_078705256.1\|584788_585289_+	Hsp20 family protein	M1IPB7	Pelagibacter_phage	4.3e-18	39.4
WP_078705257.1\|586064_586439_+	iron-sulfur cluster assembly accessory protein	A0A0P0CQC4	Ostreococcus_lucimarinus_virus	3.3e-15	41.3
WP_078705258.1\|587330_588260_-	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
WP_078705259.1\|588266_589295_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_078705260.1\|589355_590633_-	beta-ketoacyl-ACP synthase	NA	NA	NA	NA
590510:590528	attL	NA	NA	NA	NA
WP_078706118.1\|590644_591820_-	beta-ketoacyl-ACP synthase	NA	NA	NA	NA
WP_078705261.1\|591831_592116_-	acyl carrier protein	NA	NA	NA	NA
WP_078705262.1\|592311_594645_-	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_078705263.1\|595700_600398_-	hypothetical protein	NA	NA	NA	NA
WP_007477688.1\|601565_601805_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_078705264.1\|601861_603214_+	GTPase HflX	NA	NA	NA	NA
WP_078705265.1\|603345_605109_+	hypothetical protein	NA	NA	NA	NA
WP_078705266.1\|605258_606335_+	heme A synthase	NA	NA	NA	NA
WP_078705267.1\|606355_607291_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_078705268.1\|607610_608924_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	6.9e-100	51.9
WP_078705269.1\|608936_609419_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_078705270.1\|609411_610536_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.9e-34	33.4
WP_078706119.1\|610517_611135_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.9e-24	36.9
WP_078705271.1\|611199_611658_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	8.8e-10	37.0
WP_078705272.1\|611660_612137_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_078705273.1\|612201_612675_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_078705274.1\|612890_613448_+	hypothetical protein	NA	NA	NA	NA
WP_078705275.1\|613583_614612_+	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_078705276.1\|614705_615680_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_078705277.1\|615755_616067_+	integration host factor subunit alpha	Q2A099	Sodalis_phage	1.1e-08	34.8
WP_078705278.1\|616272_616791_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_078705279.1\|616828_618808_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	7.6e-127	38.7
WP_078705280.1\|618928_619273_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.1e-09	47.1
WP_078705281.1\|619265_619703_-	iron-sulfur cluster assembly scaffold protein	NA	NA	NA	NA
WP_078705282.1\|619827_620448_+	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	1.5e-41	43.6
WP_078705283.1\|621494_622367_-	DNA methyltransferase	M4SNK2	Cyanophage	2.7e-15	28.1
WP_078705284.1\|622397_623768_-	hypothetical protein	NA	NA	NA	NA
WP_078706120.1\|625504_626683_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_078705285.1\|626833_627322_+	hypothetical protein	NA	NA	NA	NA
WP_078705286.1\|627767_628967_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_078705287.1\|632904_634062_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1X9HVL9	Ruegeria_phage	1.3e-73	39.1
WP_078705288.1\|634338_634857_+	Rha family transcriptional regulator	B5AX29	Iodobacteriophage	3.6e-20	54.0
WP_078663281.1\|635080_635296_-	hypothetical protein	NA	NA	NA	NA
WP_078705290.1\|635328_636516_-	DUF3380 domain-containing protein	A0A0A8IK88	Aurantimonas_phage	2.9e-28	34.2
WP_078705291.1\|636512_637829_-	late control protein	K4HZC6	Acidithiobacillus_phage	4.1e-68	37.9
WP_078705292.1\|637825_638050_-\|tail	phage tail protein	A0A088FVH7	Escherichia_phage	3.6e-09	47.0
WP_078705293.1\|638046_638436_-\|tail	phage tail protein	A0A1W6JT48	Escherichia_phage	1.8e-24	46.3
WP_078705294.1\|638441_640484_-\|tail	phage tail tape measure protein	A0A2P9HXI8	Yersinia_phage	1.8e-14	27.4
WP_078663274.1\|640480_640594_-\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_078663273.1\|640617_640878_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_078663272.1\|640879_641386_-\|tail	phage major tail tube protein	A0A1B2LRS4	Wolbachia_phage	1.5e-34	43.1
WP_078705295.1\|641385_642777_-\|tail	phage tail protein	A0A088FVH5	Escherichia_phage	8.6e-133	53.6
641844:641862	attR	NA	NA	NA	NA
WP_078705296.1\|642892_643117_-	hypothetical protein	NA	NA	NA	NA
WP_078705297.1\|643148_644498_-	hypothetical protein	NA	NA	NA	NA
WP_078705298.1\|644551_645985_-	hypothetical protein	NA	NA	NA	NA
WP_078705299.1\|645998_649157_-	DUF4815 domain-containing protein	K4ICQ5	Acidithiobacillus_phage	1.1e-148	33.7
WP_078705300.1\|649158_650262_-\|tail	phage tail protein	K4I1F8	Acidithiobacillus_phage	2.8e-17	33.2
WP_078705301.1\|650264_651089_-\|plate	baseplate assembly protein	Q9JML6	Wolbachia_phage	2.1e-38	37.6
WP_078705302.1\|651085_651427_-\|plate	baseplate assembly protein W	Q75QM0	Wolbachia_phage	1.3e-29	57.0
WP_078705303.1\|651423_652161_-\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	5.9e-16	31.3
WP_078663264.1\|652676_653021_-	hypothetical protein	NA	NA	NA	NA
WP_078705304.1\|653022_654099_-\|capsid	major capsid protein	A0A0A8ILA9	Aurantimonas_phage	2.2e-59	37.7
WP_078705305.1\|654112_654478_-\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	8.8e-13	38.7
WP_078706121.1\|654474_654741_-	hypothetical protein	NA	NA	NA	NA
WP_078705306.1\|654941_655802_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	9.8e-63	48.9
WP_078705307.1\|655791_657306_-\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	1.0e-94	41.2
WP_078663260.1\|657305_657554_-	hypothetical protein	NA	NA	NA	NA
WP_078705308.1\|657557_659453_-\|terminase	phage terminase large subunit family protein	K4I3Y9	Acidithiobacillus_phage	1.2e-169	53.6
WP_078663258.1\|659445_660015_-	hypothetical protein	NA	NA	NA	NA
WP_078705309.1\|660275_660863_-	hypothetical protein	A0A0A8IL87	Aurantimonas_phage	2.8e-08	31.8
WP_078705310.1\|661826_662297_-	hypothetical protein	NA	NA	NA	NA
WP_078705311.1\|662628_662907_+	plasmid maintenance system killer	NA	NA	NA	NA
WP_078705312.1\|662917_663226_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_078705313.1\|663248_663794_-	hypothetical protein	NA	NA	NA	NA
WP_078706122.1\|664111_664561_-	single-stranded DNA-binding protein	A0A0K1LLZ9	Caulobacter_phage	8.0e-32	59.0
WP_078705315.1\|664835_665744_+	DUF488 domain-containing protein	A0A1B3AYW8	Gordonia_phage	5.1e-09	32.3
WP_078706123.1\|665820_666123_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.2e-17	47.9
WP_078705316.1\|666109_666421_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	3.4e-13	40.4
WP_078705317.1\|666468_666744_-	hypothetical protein	NA	NA	NA	NA
WP_078705318.1\|666740_667481_-	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	2.0e-43	43.1
WP_078705320.1\|668510_668834_-	hypothetical protein	NA	NA	NA	NA
WP_078705321.1\|668892_669768_-	DNA adenine methylase	M4SNK2	Cyanophage	5.9e-15	27.2
WP_153300984.1\|669990_670392_-	hypothetical protein	NA	NA	NA	NA
WP_078705323.1\|670330_670885_-	hypothetical protein	NA	NA	NA	NA
WP_078705324.1\|670938_671490_-	YdaU family protein	A0A076GD06	Sinorhizobium_phage	2.1e-18	37.1
WP_078663288.1\|671479_671827_-	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_078705325.1\|671816_672299_-	hypothetical protein	K4ICN3	Acidithiobacillus_phage	2.6e-44	61.3
WP_078705326.1\|672304_673177_-	hypothetical protein	F8TV45	EBPR_siphovirus	2.1e-20	51.1
WP_078705327.1\|673331_673838_-	hypothetical protein	NA	NA	NA	NA
WP_078705328.1\|673834_674224_-	hypothetical protein	NA	NA	NA	NA
WP_010704151.1\|674307_674925_+	XRE family transcriptional regulator	A0A1X9HW95	Ruegeria_phage	9.0e-10	31.4
WP_078705329.1\|675198_675606_+	hypothetical protein	NA	NA	NA	NA
WP_078705330.1\|675605_675902_+	hypothetical protein	A0A1I9LJV2	Stx_converting_phage	3.2e-05	36.2
WP_078705331.1\|675966_676707_+	phage antirepressor Ant	A0A139ZPI9	Marinitoga_camini_virus	3.2e-38	41.1
WP_078705332.1\|676718_677510_+	hypothetical protein	A0A0M3LR26	Mannheimia_phage	2.2e-32	34.4
WP_078705333.1\|677511_678132_+	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	8.7e-45	49.7
WP_078663298.1\|678217_678409_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_078705334.1\|678801_680148_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_078705335.1\|680162_680648_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_078705336.1\|680872_681730_-	DsbA family protein	NA	NA	NA	NA
WP_078705337.1\|682403_683921_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_078705338.1\|684322_685303_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA

DBSCAN-SWA_4

885511 : 894463

Moraxella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010704151.1\|885511_886129_-	XRE family transcriptional regulator	A0A1X9HW95	Ruegeria_phage	9.0e-10	31.4
WP_078705497.1\|886598_887102_+	hypothetical protein	NA	NA	NA	NA
WP_078705498.1\|888442_889069_+	hypothetical protein	A0A0P0ZDY7	Stx2-converting_phage	8.8e-29	60.4
WP_078705499.1\|889106_889847_+	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	3.9e-44	43.1
WP_078705500.1\|890166_890595_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJC0	Moraxella_phage	4.6e-13	38.3
WP_078705501.1\|890966_891260_-	HigA family addiction module antidote protein	A0A0M3LPV0	Mannheimia_phage	1.6e-12	43.7
WP_078705502.1\|891276_891558_-	Killer protein	A0A0M3LQB1	Mannheimia_phage	4.1e-18	46.2
WP_078705503.1\|891626_892535_-	DUF488 domain-containing protein	A0A1B3AYW8	Gordonia_phage	3.9e-09	29.6
WP_078705504.1\|892807_893257_+	single-stranded DNA-binding protein	A0A0K1LLZ9	Caulobacter_phage	3.0e-31	57.3
WP_078705505.1\|893271_893802_+	hypothetical protein	NA	NA	NA	NA
WP_010703152.1\|893870_894071_+	type II toxin-antitoxin system HicA family toxin	A0A0R6PJD4	Moraxella_phage	5.1e-07	51.7
WP_078705506.1\|894067_894463_+	CopG family transcriptional regulator	A0A0U4ISP5	Pseudomonas_phage	1.6e-07	31.1

DBSCAN-SWA_5

1194789 : 1201761

Brucella_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078705699.1\|1194789_1195530_+	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	1.3e-47	45.1
WP_078705700.1\|1195526_1195802_+	hypothetical protein	NA	NA	NA	NA
WP_078705701.1\|1195861_1196161_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	7.7e-15	42.6
WP_078705702.1\|1196141_1196450_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	9.0e-19	49.0
WP_078705704.1\|1197334_1197871_+	hypothetical protein	NA	NA	NA	NA
WP_010703919.1\|1197976_1198204_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_078663354.1\|1198187_1198457_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SB46	Streptococcus_phage	2.2e-13	45.1
WP_078705705.1\|1198763_1199264_+	hypothetical protein	NA	NA	NA	NA
WP_153300992.1\|1199267_1200116_+	N-6 DNA methylase	NA	NA	NA	NA
WP_078705706.1\|1200304_1200892_+	hypothetical protein	A0A0A8IL87	Aurantimonas_phage	3.6e-08	31.8
WP_010704172.1\|1201133_1201430_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.2e-12	47.1
WP_078705707.1\|1201446_1201761_-	Killer protein	A0A222YWE2	Escherichia_phage	6.6e-09	38.7

DBSCAN-SWA_6

1240076 : 1293659

Acidithiobacillus_phage(20.51%)

integrase,tail,capsid,tRNA,plate,portal,head

attL 1229528:1229547|attR 1250479:1250498

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1229528:1229547	attL	NA	NA	NA	NA
WP_078705724.1\|1240076_1241033_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	8.9e-65	42.1
WP_078705725.1\|1241025_1241976_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_078705726.1\|1241972_1242731_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.0e-15	25.2
WP_078705727.1\|1242948_1243992_-\|integrase	tyrosine-type recombinase/integrase	A0A291AUF0	Sinorhizobium_phage	8.9e-34	31.9
WP_078705492.1\|1243994_1244246_-	hypothetical protein	NA	NA	NA	NA
WP_078705728.1\|1244374_1244995_-	YqaJ viral recombinase family protein	A0A0U2BXF3	Paracoccus_phage	2.4e-47	47.5
WP_078705729.1\|1244996_1245773_-	phage recombination protein Bet	A0A0M3LR26	Mannheimia_phage	2.1e-40	40.4
WP_078705730.1\|1245784_1246525_-	phage antirepressor Ant	Q7Y5W2	Haemophilus_phage	4.5e-40	41.7
WP_078705731.1\|1246577_1246934_-	hypothetical protein	NA	NA	NA	NA
WP_078705732.1\|1247098_1247719_-	helix-turn-helix transcriptional regulator	A0A1X9HW95	Ruegeria_phage	3.4e-17	41.5
WP_078705733.1\|1247829_1248099_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_078705734.1\|1248095_1248422_+	hypothetical protein	NA	NA	NA	NA
WP_153300995.1\|1249429_1249939_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	4.6e-44	60.6
WP_153300996.1\|1249964_1250228_+	hypothetical protein	NA	NA	NA	NA
WP_078705736.1\|1250217_1250541_+	DUF1376 domain-containing protein	A0A076GD06	Sinorhizobium_phage	1.3e-07	36.4
1250479:1250498	attR	NA	NA	NA	NA
WP_078705738.1\|1250843_1251167_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_078705739.1\|1251156_1252281_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_078705740.1\|1252264_1252618_+	hypothetical protein	NA	NA	NA	NA
WP_078705741.1\|1252812_1253307_+	hypothetical protein	NA	NA	NA	NA
WP_078705742.1\|1253878_1254511_+	hypothetical protein	A0A139ZPI9	Marinitoga_camini_virus	8.9e-29	48.3
WP_078705743.1\|1254541_1255177_+	hypothetical protein	Q7Y5W2	Haemophilus_phage	8.4e-27	54.0
WP_078705744.1\|1255204_1255936_+	phage antirepressor Ant	A0A0R6PHG7	Moraxella_phage	5.0e-23	62.5
WP_078705745.1\|1255932_1256208_+	hypothetical protein	NA	NA	NA	NA
WP_078705746.1\|1256311_1257721_+\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	6.4e-35	28.9
WP_078705747.1\|1257808_1258114_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	5.6e-05	40.0
WP_078664137.1\|1258091_1258391_-	hypothetical protein	NA	NA	NA	NA
WP_078705748.1\|1258436_1259345_-	DUF488 domain-containing protein	A0A1B3AYW8	Gordonia_phage	4.3e-08	31.5
WP_078705504.1\|1259617_1260067_+	single-stranded DNA-binding protein	A0A0K1LLZ9	Caulobacter_phage	3.0e-31	57.3
WP_078705749.1\|1260081_1260627_+	hypothetical protein	NA	NA	NA	NA
WP_078705750.1\|1260630_1261053_-	type II toxin-antitoxin system HicB family antitoxin	Q7Y3V7	Yersinia_phage	4.4e-16	37.9
WP_078663497.1\|1261082_1261265_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_078705705.1\|1261756_1262257_+	hypothetical protein	NA	NA	NA	NA
WP_153300992.1\|1262260_1263109_+	N-6 DNA methylase	NA	NA	NA	NA
WP_078705706.1\|1263297_1263885_+	hypothetical protein	A0A0A8IL87	Aurantimonas_phage	3.6e-08	31.8
WP_078705751.1\|1264230_1264503_-	hypothetical protein	NA	NA	NA	NA
WP_078663675.1\|1264489_1264786_-	hypothetical protein	NA	NA	NA	NA
WP_078705752.1\|1264857_1265427_+	hypothetical protein	NA	NA	NA	NA
WP_078663260.1\|1267317_1267566_+	hypothetical protein	NA	NA	NA	NA
WP_078705753.1\|1267565_1269080_+\|portal	phage portal protein	K4I1F2	Acidithiobacillus_phage	5.0e-94	41.2
WP_153300997.1\|1269069_1269930_+	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	2.0e-63	48.9
WP_078706121.1\|1270130_1270397_+	hypothetical protein	NA	NA	NA	NA
WP_078705754.1\|1270393_1270759_+\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	3.9e-13	39.5
WP_078705755.1\|1270772_1271849_+\|capsid	major capsid protein	A0A0A8ILA9	Aurantimonas_phage	2.2e-59	37.5
WP_078705756.1\|1271850_1272195_+	hypothetical protein	NA	NA	NA	NA
WP_078705757.1\|1272274_1272823_-	hypothetical protein	NA	NA	NA	NA
WP_078705758.1\|1272901_1273219_-	type II toxin-antitoxin system HicB family antitoxin	A0A0K2CZV4	Paenibacillus_phage	1.1e-06	32.0
WP_078705759.1\|1273208_1273463_-	toxin HicA	A0A2P1A0R7	Gordonia_phage	1.1e-06	62.5
WP_078705760.1\|1273552_1273834_-	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_078705761.1\|1273820_1274084_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_153300998.1\|1274219_1274741_+	hypothetical protein	NA	NA	NA	NA
WP_078705762.1\|1274734_1275472_+\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	8.8e-20	33.3
WP_078705763.1\|1275468_1275810_+\|plate	baseplate assembly protein W	Q75QM0	Wolbachia_phage	1.5e-30	56.1
WP_078705764.1\|1275806_1276631_+\|plate	baseplate assembly protein	K4HZB7	Acidithiobacillus_phage	1.6e-38	36.0
WP_078705765.1\|1276633_1277737_+\|tail	phage tail protein	K4I1F8	Acidithiobacillus_phage	2.8e-17	33.2
WP_078705766.1\|1277738_1280897_+	DUF4815 domain-containing protein	K4ICQ5	Acidithiobacillus_phage	1.0e-149	33.9
WP_078705767.1\|1282358_1283666_+	hypothetical protein	NA	NA	NA	NA
WP_078705768.1\|1283700_1283922_+	hypothetical protein	NA	NA	NA	NA
WP_078705769.1\|1283945_1284302_-	transcriptional regulator	A0A222YXG1	Escherichia_phage	2.2e-40	68.4
WP_078706150.1\|1284304_1284574_-	type II toxin-antitoxin system HigB family toxin	A0A0P0ZE17	Stx2-converting_phage	3.1e-15	46.1
WP_078705770.1\|1284748_1286140_+\|tail	phage tail protein	A0A088FVH5	Escherichia_phage	1.3e-133	54.1
WP_078705771.1\|1286139_1286646_+\|tail	phage major tail tube protein	K4I1G5	Acidithiobacillus_phage	1.4e-32	40.7
WP_078705772.1\|1286647_1286911_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_078705773.1\|1286934_1287048_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_078705774.1\|1287044_1289075_+\|tail	phage tail tape measure protein	A0A2P9HXI8	Yersinia_phage	6.9e-14	27.0
WP_078663277.1\|1289080_1289470_+\|tail	phage tail protein	A0A1W6JT48	Escherichia_phage	4.1e-24	46.3
WP_078663278.1\|1289466_1289691_+\|tail	phage tail protein	A0A077K8R0	Ralstonia_phage	3.7e-06	46.8
WP_078705775.1\|1289687_1291004_+	late control protein	K4HZC6	Acidithiobacillus_phage	5.3e-68	37.9
WP_078705776.1\|1291000_1292188_+	DUF3380 domain-containing protein	A0A0A8IK88	Aurantimonas_phage	2.9e-28	34.7
WP_153300999.1\|1292188_1292404_+	hypothetical protein	NA	NA	NA	NA
WP_153301021.1\|1293173_1293659_-	phage antirepressor Ant	A0A0P0ZDY7	Stx2-converting_phage	1.6e-09	49.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage