CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019731	Pseudomonas syringae pv. actinidiae strain CRAFRU 12.29 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP019730	Pseudomonas syringae pv. actinidiae strain CRAFRU 12.29 chromosome, complete genome	2 crisprs	RT,csa3,PD-DExK,DEDDh,cas3,WYL,DinG	0	1	22	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019730_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019730_1

1820727-1820960

Orphan

Consensus_repeat	Method
GTGATTCCACTGGAATCA	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP019730_1

>merge|NZ_CP019730|1|1820727-1820960|PILER-CR
GTGATTCCAGTGGAATCACTCTTGCTGATTACCGAGGTGAATCCAGCCGCAGCATCCAGTTCTGTGTGATGGGTGATTCCAGTGGAATCAATTCTGATGGTGTACAAGGCGAGCTTGGTCTCGCTACCCAGAACGGAGTGACTGGTGATTCCACTGGAATCGCCCTGGTTCGTTTCGGGTGCACTGCCGGAGGTGTCGCCTCGAGCCTGGCCAAAAGTGATTCCACTGGAATCA

>NZ_CP019730|1|1|1820727-1820960|PILER-CR
GTGATTCCAGTGGAATCA	CTCTTGCTGATTACCGAGGTGAATCCAGCCGCAGCATCCAGTTCTGTGTGATGG
GTGATTCCAGTGGAATCA	ATTCTGATGGTGTACAAGGCGAGCTTGGTCTCGCTACCCAGAACGGAGTGACTG
GTGATTCCACTGGAATCG	CCCTGGTTCGTTTCGGGTGCACTGCCGGAGGTGTCGCCTCGAGCCTGGCCAAAA
GTGATTCCACTGGAATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019730.1\|WP_017682920.1\|1814933_1815182_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682929.1\|1822403_1823141_-\|DUF2857-domain-containing-protein	unknown	unknown	gnl\|CDD\|378591
NZ_CP019730.1\|WP_017682926.1\|1819174_1819747_-\|DUF3158-family-protein	unknown	unknown	gnl\|CDD\|314329
NZ_CP019730.1\|WP_017682930.1\|1823177_1824941_-\|chromosome-partitioning-protein-ParB	unknown	unknown	gnl\|CDD\|213858
NZ_CP019730.1\|WP_017682917.1\|1810459_1811818_-\|type-4b-pilus-protein-PilO2	unknown	unknown	gnl\|CDD\|369114
NZ_CP019730.1\|WP_074322669.1\|1817950_1818151_-\|CrpP-family-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682931.1\|1824943_1825207_-\|Arc-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|367702
NZ_CP019730.1\|WP_017682922.1\|1817245_1817692_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682919.1\|1813555_1814698_-\|pilus-biosynthesis-protein-PilL	unknown	unknown	gnl\|CDD\|163460
NZ_CP019730.1\|WP_017682933.1\|1825438_1825840_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682918.1\|1811819_1813559_-\|PilN-family-type-IVB-pilus-formation-outer-membrane-protein	unknown	unknown	gnl\|CDD\|274177
NZ_CP019730.1\|WP_017682928.1\|1821033_1822404_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682938.1\|1828977_1829838_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP019730.1\|WP_017682936.1\|1827525_1828224_-\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP019730.1\|WP_017682925.1\|1818723_1819173_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|169261
NZ_CP019730.1\|WP_017682921.1\|1815280_1817233_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|350677
NZ_CP019730.1\|WP_017682927.1\|1819746_1820526_-\|TIGR03761-family-integrating-conjugative-element-protein	unknown	unknown	gnl\|CDD\|274771
NZ_CP019730.1\|WP_017682934.1\|1825841_1826183_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237910
NZ_CP019730.1\|WP_017704189.1\|1826179_1827526_-\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|273206
NZ_CP019730.1\|WP_017682937.1\|1828220_1828976_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP019730.1\|WP_017682938.1\|1828977_1829838_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.50232e-40
NZ_CP019730.1\|WP_017682929.1\|1822403_1823141_-\|DUF2857-domain-containing-protein	gnl\|CDD\|378591	pfam11198, DUF2857, Protein of unknown function (DUF2857). This is a bacterial family of uncharacterized proteins.	4.32597e-43
NZ_CP019730.1\|WP_017682926.1\|1819174_1819747_-\|DUF3158-family-protein	gnl\|CDD\|314329	pfam11358, DUF3158, Protein of unknown function (DUF3158). Some members in this family of proteins are annotated as integrase regulator R however this cannot be confirmed. This family of proteins with unknown function appear to be restricted to Proteobacteria.	3.83291e-67
NZ_CP019730.1\|WP_017682921.1\|1815280_1817233_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|350677	cd17919, DEXHc_Snf, DEXH/Q-box helicase domain of DEAD-like helicase Snf family proteins. Sucrose Non-Fermenting (SNF) proteins DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	3.59797e-43
NZ_CP019730.1\|WP_017682931.1\|1824943_1825207_-\|Arc-family-DNA-binding-protein	gnl\|CDD\|367702	pfam03869, Arc, Arc-like DNA binding domain. Arc repressor act by he cooperative binding of two Arc repressor dimers to a 21-base-pair operator site. Each Arc dimer uses an antiparallel beta-sheet to recognize bases in the major groove.	2.19807e-07
NZ_CP019730.1\|WP_017682934.1\|1825841_1826183_-\|hypothetical-protein	gnl\|CDD\|237910	PRK15103, PRK15103, membrane integrity-associated transporter subunit PqiA.	0.007506
NZ_CP019730.1\|WP_017682930.1\|1823177_1824941_-\|chromosome-partitioning-protein-ParB	gnl\|CDD\|213858	TIGR03764, ICE_PFGI_1_parB, integrating conjugative element, PFGI_1 class, ParB family protein. Members of this protein family carry the ParB-type nuclease domain and are found in integrating conjugative elements (ICE) in the same class as PFGI-1 of Pseudomonas fluorescens Pf-5.	1.0826e-146
NZ_CP019730.1\|WP_017704189.1\|1826179_1827526_-\|replicative-DNA-helicase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP019730.1\|WP_017682918.1\|1811819_1813559_-\|PilN-family-type-IVB-pilus-formation-outer-membrane-protein	gnl\|CDD\|274177	TIGR02520, putative_Type_IV_pilus_protein, type IVB pilus formation outer membrane protein, R64 PilN family. Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation. This protein family appears to encode a secretin for pilus formation, although it is quite different from PilQ. Members include the PilN lipoprotein of the plasmid R64 thin pilus, a type IV pilus. Scoring between the trusted and noise cutoffs are examples of bundle-forming pilus B (bfpB). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking].	3.54134e-153
NZ_CP019730.1\|WP_017682936.1\|1827525_1828224_-\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	4.3357e-08
NZ_CP019730.1\|WP_017682919.1\|1813555_1814698_-\|pilus-biosynthesis-protein-PilL	gnl\|CDD\|163460	TIGR03748, conj_PilL, conjugative transfer region protein, TIGR03748 family. This model describes the conserved N-terminal region of a variable length protein family associated with laterally transfered regions flanked by markers of conjugative plasmid integration and/or transposition. Most members of the family have the lipoprotein signal peptide motif. A member of the family from a pathogenicity island in Salmonella enterica serovar Dublin strain was designated PilL for nomenclature consistency with a neighboring gene for the pilin structural protein PilS. However, the species distribution of this protein family tracks much better with markers of conjugal transfer than with markers of PilS-like pilin structure. [Mobile and extrachromosomal element functions, Plasmid functions].	2.61951e-58
NZ_CP019730.1\|WP_017682925.1\|1818723_1819173_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|169261	PRK08182, PRK08182, single-stranded DNA-binding protein; Provisional.	9.55541e-68
NZ_CP019730.1\|WP_017682927.1\|1819746_1820526_-\|TIGR03761-family-integrating-conjugative-element-protein	gnl\|CDD\|274771	TIGR03761, ICE_PFL4669, integrating conjugative element protein, PFL_4669 family. Members of this protein family, such as PFL4669, are found in integrating conjugative elements (ICE) of the PFGI-1 class as in Pseudomonas fluorescens.	6.51487e-111
NZ_CP019730.1\|WP_017682917.1\|1810459_1811818_-\|type-4b-pilus-protein-PilO2	gnl\|CDD\|369114	pfam06864, PAP_PilO, Pilin accessory protein (PilO). This family consists of several enterobacterial PilO proteins. The function of PilO is unknown although it has been suggested that it is a cytoplasmic protein in the absence of other Pil proteins, but PilO protein is translocated to the outer membrane in the presence of other Pil proteins. Alternatively, PilO protein may form a complex with other Pil protein(s). PilO has been predicted to function as a component of the pilin transport apparatus and thin-pilus basal body. This family does not seem to be related to pfam04350.	1.59437e-102

>NZ_CP019730.1|WP_017682927.1|1819746_1820526_-|TIGR03761-family-integrating-conjugative-element-protein
MADNFQLNIGSLRSSVNLTLHTHHASRLWFGRQRTEGKPGMIGLSGFANILNRIKRGCEQDDPYSDWFLLLIEEKIESSEQEMTDIDNRLDEVMASLPAMLSIGQNLSVQPVTLPLFLSTPLAFKAVYLLTAYDELVRRILLASHVGLIDNHAKGQWLDEGAAILRRLFGLSQRYKFSGASRGDFAAKNARSELAREMYAPFGEIPQDILEGTRKSKFAPALSTGPASTFNEDDQDEGEDFISMDTAPATPLPRTEPEE
>NZ_CP019730.1|WP_017682926.1|1819174_1819747_-|DUF3158-family-protein
MLNPSHSVTGAHTLQQGAFQPLQQDAFAGLQHAPFLKGLLKPFKGKGGMLQLAELCRSLEGDLNALAEDQVLAQANRHPYTLLPVRMVRQRTSAGTVFLRWQEMGTRQMGVNVWSNLLTDPRTPESLLRDLHSMEQQRVALNMQISLVHTIGRQAVDCAEKMAQADAVYAERLQQISHSSGINPHTEKES
>NZ_CP019730.1|WP_017682925.1|1818723_1819173_-|single-stranded-DNA-binding-protein
MGTSVDWEGNIGSAPEFKEFPNGNKDPRRLLRLNVYFDNSIPKNDGTGFEDRGGFWANVEFWHKDAEHYANVYQKGMRVLIQGRAIMDSWTKDGEDFSALKVQASRVGILPARIEAIHLAASQPQHASRPQPAQNTQDAQPDFDDDIPL
>NZ_CP019730.1|WP_074322669.1|1817950_1818151_-|CrpP-family-protein
MKAESSLRIEASDRRRFNNPHHAVMLAGAQAARDSIPLHECPYRHPAMRASWLKGFAQEQQQSFEF
>NZ_CP019730.1|WP_017682922.1|1817245_1817692_-|hypothetical-protein
MTGRIVGRISPYRLAGVEYLSVDLMGQLSGDMSVTISTAAQSTDYSFDDLERTCFEVPDMTEGLTMISLFLRDANAMVSLDSAHQSSRVPQQGEPVVPVIAAFITSINCPICNTPQLGFIEDPRGGDFDCNDCGRPFHIPADSSVVFG
>NZ_CP019730.1|WP_017682921.1|1815280_1817233_-|DEAD/DEAH-box-helicase
MASPRLMNKRPVLLRKAIYDGYDFGLSLSYLEGANKLLLRRGGFFIRRSEHPLNQFWRVPKTKLLDDLDVLYRELAELAAGKHIESWQAFRDRISSAQSDTHRDAFTWGMKFRLAPLAEGGVILSGDFHPGAVAIAKRMRGVFLSAGKAWRVQGTAELVRSNLILELGLSEDQFEILDTLQELLADGSVSPVREVTSISLGGFSPESTKSEEEVSDSGIYLASVPSIKNTELTSAEIGEALASFSLMDHQPAGIRHLLQRTSALLADDMGLGKTRQAVIAAGIRAQGKPVLVIVLNSLIINWQREILMVFPDAQISMQKFDTAAGWIIVNYERLGDFVMHASSFAVMVIDEAHRLKEPTAAWTRHGFDIAAQVQNRYLLTGTPVLNREAELHTLLRLSGHPIGHLPLNEFCERFAGSPEFRKTLRDEISDWMLRRRKDVLPGLKGKQRQTVPVTLSKEERDEYNQIMRSDQHRFARLGGLRQLLERVKVRIVADLMAELDVDDKVILFCEYQESVATLRDHCTSLGIGCVTLVGSDTPKKRQKAIDAFQEDPDCRVFIGTRSAAGTGYNLTAANYVFFLGLPWTPGLQDQAEDRAYRNGQLRLVVVKIPLAEDTIDQQLWQMLMDKRALASDLIDPEAEDLNKQALALML
>NZ_CP019730.1|WP_017682920.1|1814933_1815182_-|hypothetical-protein
MSKTFTSNMDRVLLRISKAGNGCGFLLIAGYVLLSMVSAVLDPNFNQDHLAQEFAPLIVYAIGVSAVCLVLQIMLRTDSISG
>NZ_CP019730.1|WP_017682919.1|1813555_1814698_-|pilus-biosynthesis-protein-PilL
MIRQLSTLSILALFAGCTSVADKPEGPAYDSSQNPELLSPDLYSSGAKSGQEPMVRYGRYALVNTAPEAEQRDLMAQIIDVSIPPNMHPSVQDAMQYVVSRSGYTLCPPTTGHVNILFTRPLPAAQYKLGPMSLRNTLQVLAGPAWQVKVNEVTRGVCFVLRPGFQLPEPPKALAQTSSVQPAASASNSRSTSTPEVTVLTAPETGTPFSKDSKPAAPAPTKAATQDKAPTAASAATAVPAKEISPAPQNRTAGIAAVAKATPPSSTPKTGVVESTSTSFVKTETAKVVPAPVPQETWKARVGSTLRQTVEEWASRAGWQLIWVPEDLDYQIEAPLSFTGSFDAAIKQIFPLYDNAKRSFVVDGAEGQGQHVLYVSERKK
>NZ_CP019730.1|WP_017682918.1|1811819_1813559_-|PilN-family-type-IVB-pilus-formation-outer-membrane-protein
MIMALMRHIALGVTALIAAGCSVQRVDEAAARAEATANQAGQYAAILRNKQQQERRDTVIFSNKPWVSTQPVVARRGIPAKYDCHVDYRAAGSVGIAEIAQYITSQCGLPVLVSPDALNPGLLNSNAPAQANRAQAVSIAPNPDSLAGLLPAGITGGPGLGSGSAGRSSDFASMLTPNLISGLNYSGKASGMLDDVTARLGLSYKYNPASRSVQVTYFDTKVFDVYAFGDVQEIKSTVRSGMTTSSGTGSSGSSGSSSSGSSSSGVSGDSGSNQSTTVTLNTSILTDIQSNVQAMLSTSPPGRMYLSPSTGTLTVTDRPDVLANVETYLAKTNHSITQQVLFNVKVFEATLTDTDQLALNWAAVYNSLSTKWGLSLSNTVPGISSSAISGSVGIVDTANSAWAGSNAIIQAIAEQARISNVRSPSVTTLNLQPAPLQIGNVQGYIPSVQTNTTASVGSSTAITPGTITSGFNMTLQPRLMDDDEMLLMITINMSSKPTFQPFTSNGSSVQIPNYDAKSLSPKVKLRSGQTLILSGFDELNDNTDKIGTGSPGFFGLGGGRTRTSSQSFLVVLITPIVTN
>NZ_CP019730.1|WP_017682917.1|1810459_1811818_-|type-4b-pilus-protein-PilO2
MAKPFPLFRKRAVRTPAPSDGKVQILTYHGRSFVTGLLWHPLGSLTGYMKEARQFGRQQQMDIVAIRHTESVIQAGFVSQNDGAVKGMYSLAASLAGQLGSSWLAAWKIEDAEDRYALVAVYRGAVIPGADLVGTADEIKRKVAQQLSRSMSFEKVFVPAEFGRGGEPFDAETLLHPSNLKREYKLTPLAFGLSSKELVRVAAMGAVVVGCFIGWHQWHQHQLQIAREAQLAAEAARQAELDALNQRTNSPVVLEALVHPWVKQPSVPAFLAGCNGAIDQLPLAIAGWLFVSAKCDGALMSASYKRTGNSTTLAFTAATAGHFADTPAFYDEGNMAALKLTFELPLAGDDVLDPATQALDSITSWLQAQDLQPKITEVPVTVVQPPALPGQPAPPPPPPPDYRHFEIRYTSQLPPATVLHAVQNTGMRLREIETKFQGGQLTWNVVGDLYVH
>NZ_CP019730.1|WP_017682928.1|1821033_1822404_-|hypothetical-protein
MRSNRRPSLGGAINAAAGALQNHLLLQQMKLAQEQSAGSEHKKTVAEPGTEEAYDGIVFSGNPHETVPRALLLDDRLSPLERNAWQVFRLLINSDGITAFPTYEQLRPYLGSVPGKSASRETVAKALTVLRLTRWLSLGRRVRDSISGRVQGNVYILHDEPVGCVEAMELDRDYMLLIGQALEHANKTVRSVADMTFKEFAADPNHSTGVMPTRLDVIENRWRKQGWHDGSNAIDQSRAEAEFGIRTPSSSDPFSLSSESEPGENPVKADSDTLSSESELSLKSASFSAVRIPNSYSTYTNTNTSVCKSSVPHDPVPGSEELPLGFERFTQEQRIKAATLLQRVEPDLRKPVVDQWQHRCKSGTVNNPFGYLLSCIQKAYSGDFNAQWQAPAAAKNSNTVSVGAPKSSQPTSASYVNAQTQPITSPSPRTRDESSLETGRSSMLDIKKLVRPRTQG
>NZ_CP019730.1|WP_017682929.1|1822403_1823141_-|DUF2857-domain-containing-protein
MSKKHNPLNEAMVAQILHHLRNGEFRRCIDMGLDPEILVMLQHPSSQSVLLNSAVTWCRVAVDPDMVKRLLSNKERTDEENRIVQRALRLGATTPMLQEFFGMSPQEVSLQRVLVGVPGRPGRFRDIPDDAPLWHRFVQLMDEYHVDHTDGVALLDIAMMLTEEVNIPPEEPQSQPSDPITLGLVWNKIQSWLAQDLYPTGQQRKASSLVLLGDSRQQSKANASRRASTHSQTGKPVGKVEGDQM
>NZ_CP019730.1|WP_017682930.1|1823177_1824941_-|chromosome-partitioning-protein-ParB
MASKLTAEEISGKLLTGSFSRSGPSVDRLPDPVADTPMVLTLDEMTAYANNPRTVTNAKYQEIKESIRQRGLDQPPSVTRRPGDTKYTIRNGGNTRLAILRELYTETGEDRFYRHNVLFRPWDSGRGEIIALTGHLAENDLRGALMFIERAVGIENARAIYEAEAGEQISQRELVRRLREDGYPVSQSHISKMQETVRCLLPVIPAALYSGLGKPQIERLLSLRKAGGQTWSTHTEGKEHIPDFEGLFQDVLSLFDGDASEFVYERVQDELISHMQTGTGLTYEQILLTLSENQNQARRSAVIESPVNISPAQPIQSNLPDPNGAEDAGKSTAPTLQPTSTDPEPKFEVPNGSTRPRNIKTDSDWLKPEGGDVVLSEEERAARLAGHVVTPVAITDRVIDMKRQLAALDGENLPDFNANALISIPVQAGGLHPISDVWYIERLIDQPDELRPVIAQLAREIAYLSGIGPDSVVDVPGGLGFLCQEPPQDAELTDLANHALTLLQSISGVYAIALTKETPEQPLDVSEFQFTAALGQLLLGSPRYEDRDAVLEGRMDDACIVKLFRLIRLGRRLVELELGSVREVQTS
>NZ_CP019730.1|WP_017682931.1|1824943_1825207_-|Arc-family-DNA-binding-protein
MLNKDAVSLHDDDKDEKFVIRLPTGMRGRVRGAAKLNRRSMNSEIVSRIEASLRHEQEIARLTAVIDVLLKGGTPASNVIQLPEAGQ
>NZ_CP019730.1|WP_017682933.1|1825438_1825840_-|hypothetical-protein
MEYYHRTDEDLPLQSDRERERLRIEQAMAEFLSRGGSIHTVAPSKRSTESNFIINAEKTAQLKANAASQAKKKADVFTDTELARLLRAHCTAGASLQSAAGTLNQTIKRCELIARRYQIPFRSAAFSKSRAHQ
>NZ_CP019730.1|WP_017682934.1|1825841_1826183_-|hypothetical-protein
MSTHNTPFLITHQCCNCGHHLPRTAVLATPGHQPECPRCHSGEIIELEPLDAEWRVTSINKAPRSNEYTVVFRIKPAGSQKAFMKMLTDTFVDHEVEIVEMQSGNKLTASGGK
>NZ_CP019730.1|WP_017704189.1|1826179_1827526_-|replicative-DNA-helicase
MSISDMSPPHSVEAEQALLGGLMLDNEAWDLIADRVHADDFFKREHKLIFQSISVLAEANKPFDVVTVADSMPSIEEAGGLAYLSDIARNTPSVANIKTYSDIVSNRAHLRRLISHGYACAREASDPQAVASVVQDVIEQNLFALGQGQQTSDFVDVNKMLLQVVDKIDLRFNAGESVVGVPTGIDDLDELTGGLQPADLIIVAARPSMGKTSLALNFVDPALQKDERSTVQIYSLEMPAEALIYRLLSILGHLNLEKLIRGQLEDEDWPKLAMAVAKLNSYGDRLVIDDQAGLTPSAIRARARRGARRFGKPALILIDYLQMMQCPGRENRANEISEISRSLKALAKEFQCPVVALSQLNRELERRPNKRPINADLRDSGAIEQDADLILFVYRDEVYNNDTEHKGIAELILGKHRNGSLGTVRTAFIPQHTRFANLSASTWQGARV
>NZ_CP019730.1|WP_017682936.1|1827525_1828224_-|DUF2786-domain-containing-protein
MTIDRQRIIDKVIKCFALARSAGASPNEAETALRQGRKLMEQYQLDELEVDAHLACEASVPTGTKRAPPTWLHNLASTCASAFDCDCIAVGYSAEWRFKFIGLGVSPDLATYAYSALHQQLILARRQHVSKLKRCNPTTKRRRGRIFAEAWVEAVASNVYQFAGKQDDQTRQTISAYLDLHHPTVIEKELEPTSAKGHDVKSKHQGWEQGSSAALHRGVSQHAASAARIGGA
>NZ_CP019730.1|WP_017682937.1|1828220_1828976_-|hypothetical-protein
MGKPNLTEATGITPELVRKLNEQYNSAQLRAAQTKLTNTSRELRNLSSGHKMGRGLISRLGDYLRVEQRELLTQAAQLLESVNCQVEHAKEKRVRDEKAAKRRQDARNARAKQLIAATYPLPTESLDQKLDVLRTVLLFNRIGAHDSFYSAVELNSEIRSTLLTPFSRLIGWGSLTAYRVSYLSSLRIRLIEALTNDISYDDGSEVEDRLAALQSKVREENAKAALTSDEHETLRLWKEALSVEAAPEVRP
>NZ_CP019730.1|WP_017682938.1|1828977_1829838_-|ParA-family-protein
MFVTSLLSTKGGVGKTTLAANLGGFCADSGLKVLLIDMDPVQPSLSSYYPMAEEVSGGIFDLIAHNQTDPEKIVSRTSIPNLSLILSNDPNNQLINLLLQAPDGRLRLAHLLKAFSDQFDLILIDTQGARSVMLEMVVLASDLAVSPLQPNMLSAREFNRGTLHMLEGLRPYSRLGLNIPPIKVVVNCLDQTNDARAIHSAIRQTFAESDEIEVIQSTVPASVIFRQASTSGMSAHRVEYKQPSNRRAPSALQIIRELAIELLPQWSARFQDMTESAVEALVKGGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019730_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019730_2

1821523-1821683

Orphan

Consensus_repeat	Method
GTTCGGATTCCGAACTCAG	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP019730_2

>merge|NZ_CP019730|2|1821523-1821683|PILER-CR
GTTCGGAATCCGAACTGCGCTGAATGAGGCCGATTTCAGACTGAGTTCGGATTCCGAACTCAGGGTGTCGGAATCCGCTTTCACCGGATTTTCGCCGGGTTCGGATTCCGAACTCAGTGAAAATGGATCGCTGCTCGACGGGGTTCGGATTCCGAACTCAG

>NZ_CP019730|2|2|1821523-1821683|PILER-CR
GTTCGGAATCCGAACTGCG	CTGAATGAGGCCGATTTCAGACTGAGTT
CGGATTCCGAACTCAGGGT	GTCGGAATCCGCTTTCACCGGATTTTCGCCGGGTT
CGGATTCCGAACTCAGTGA	AAATGGATCGCTGCTCGACGGGGTT
CGGATTCCGAACTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019730.1\|WP_017682920.1\|1814933_1815182_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682929.1\|1822403_1823141_-\|DUF2857-domain-containing-protein	unknown	unknown	gnl\|CDD\|378591
NZ_CP019730.1\|WP_017682926.1\|1819174_1819747_-\|DUF3158-family-protein	unknown	unknown	gnl\|CDD\|314329
NZ_CP019730.1\|WP_017682937.1\|1828220_1828976_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682921.1\|1815280_1817233_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|350677
NZ_CP019730.1\|WP_074322669.1\|1817950_1818151_-\|CrpP-family-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682931.1\|1824943_1825207_-\|Arc-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|367702
NZ_CP019730.1\|WP_017682922.1\|1817245_1817692_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682930.1\|1823177_1824941_-\|chromosome-partitioning-protein-ParB	unknown	unknown	gnl\|CDD\|213858
NZ_CP019730.1\|WP_017682933.1\|1825438_1825840_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682918.1\|1811819_1813559_-\|PilN-family-type-IVB-pilus-formation-outer-membrane-protein	unknown	unknown	gnl\|CDD\|274177
NZ_CP019730.1\|WP_020361459.1\|1820518_1821037_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019730.1\|WP_017682936.1\|1827525_1828224_-\|DUF2786-domain-containing-protein	unknown	unknown	gnl\|CDD\|378525
NZ_CP019730.1\|WP_017682919.1\|1813555_1814698_-\|pilus-biosynthesis-protein-PilL	unknown	unknown	gnl\|CDD\|163460
NZ_CP019730.1\|WP_029768382.1\|1830464_1831682_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP019730.1\|WP_017682925.1\|1818723_1819173_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|169261
NZ_CP019730.1\|WP_017682927.1\|1819746_1820526_-\|TIGR03761-family-integrating-conjugative-element-protein	unknown	unknown	gnl\|CDD\|274771
NZ_CP019730.1\|WP_017682934.1\|1825841_1826183_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237910
NZ_CP019730.1\|WP_017704189.1\|1826179_1827526_-\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|273206
NZ_CP019730.1\|WP_017682938.1\|1828977_1829838_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113

Protein	Function_ID	Function_description	E-value
NZ_CP019730.1\|WP_017682938.1\|1828977_1829838_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.50232e-40
NZ_CP019730.1\|WP_017682929.1\|1822403_1823141_-\|DUF2857-domain-containing-protein	gnl\|CDD\|378591	pfam11198, DUF2857, Protein of unknown function (DUF2857). This is a bacterial family of uncharacterized proteins.	4.32597e-43
NZ_CP019730.1\|WP_017704189.1\|1826179_1827526_-\|replicative-DNA-helicase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP019730.1\|WP_017682921.1\|1815280_1817233_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|350677	cd17919, DEXHc_Snf, DEXH/Q-box helicase domain of DEAD-like helicase Snf family proteins. Sucrose Non-Fermenting (SNF) proteins DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	3.59797e-43
NZ_CP019730.1\|WP_017682931.1\|1824943_1825207_-\|Arc-family-DNA-binding-protein	gnl\|CDD\|367702	pfam03869, Arc, Arc-like DNA binding domain. Arc repressor act by he cooperative binding of two Arc repressor dimers to a 21-base-pair operator site. Each Arc dimer uses an antiparallel beta-sheet to recognize bases in the major groove.	2.19807e-07
NZ_CP019730.1\|WP_017682934.1\|1825841_1826183_-\|hypothetical-protein	gnl\|CDD\|237910	PRK15103, PRK15103, membrane integrity-associated transporter subunit PqiA.	0.007506
NZ_CP019730.1\|WP_017682930.1\|1823177_1824941_-\|chromosome-partitioning-protein-ParB	gnl\|CDD\|213858	TIGR03764, ICE_PFGI_1_parB, integrating conjugative element, PFGI_1 class, ParB family protein. Members of this protein family carry the ParB-type nuclease domain and are found in integrating conjugative elements (ICE) in the same class as PFGI-1 of Pseudomonas fluorescens Pf-5.	1.0826e-146
NZ_CP019730.1\|WP_017682926.1\|1819174_1819747_-\|DUF3158-family-protein	gnl\|CDD\|314329	pfam11358, DUF3158, Protein of unknown function (DUF3158). Some members in this family of proteins are annotated as integrase regulator R however this cannot be confirmed. This family of proteins with unknown function appear to be restricted to Proteobacteria.	3.83291e-67
NZ_CP019730.1\|WP_017682918.1\|1811819_1813559_-\|PilN-family-type-IVB-pilus-formation-outer-membrane-protein	gnl\|CDD\|274177	TIGR02520, putative_Type_IV_pilus_protein, type IVB pilus formation outer membrane protein, R64 PilN family. Several related protein families encode outer membrane pore proteins for type II secretion, type III secretion, and type IV pilus formation. This protein family appears to encode a secretin for pilus formation, although it is quite different from PilQ. Members include the PilN lipoprotein of the plasmid R64 thin pilus, a type IV pilus. Scoring between the trusted and noise cutoffs are examples of bundle-forming pilus B (bfpB). [Cell envelope, Surface structures, Protein fate, Protein and peptide secretion and trafficking].	3.54134e-153
NZ_CP019730.1\|WP_017682936.1\|1827525_1828224_-\|DUF2786-domain-containing-protein	gnl\|CDD\|378525	pfam10979, DUF2786, Protein of unknown function (DUF2786). This family of proteins has no known function.	4.3357e-08
NZ_CP019730.1\|WP_017682919.1\|1813555_1814698_-\|pilus-biosynthesis-protein-PilL	gnl\|CDD\|163460	TIGR03748, conj_PilL, conjugative transfer region protein, TIGR03748 family. This model describes the conserved N-terminal region of a variable length protein family associated with laterally transfered regions flanked by markers of conjugative plasmid integration and/or transposition. Most members of the family have the lipoprotein signal peptide motif. A member of the family from a pathogenicity island in Salmonella enterica serovar Dublin strain was designated PilL for nomenclature consistency with a neighboring gene for the pilin structural protein PilS. However, the species distribution of this protein family tracks much better with markers of conjugal transfer than with markers of PilS-like pilin structure. [Mobile and extrachromosomal element functions, Plasmid functions].	2.61951e-58
NZ_CP019730.1\|WP_029768382.1\|1830464_1831682_-\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	7.67911e-32
NZ_CP019730.1\|WP_017682925.1\|1818723_1819173_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|169261	PRK08182, PRK08182, single-stranded DNA-binding protein; Provisional.	9.55541e-68
NZ_CP019730.1\|WP_017682927.1\|1819746_1820526_-\|TIGR03761-family-integrating-conjugative-element-protein	gnl\|CDD\|274771	TIGR03761, ICE_PFL4669, integrating conjugative element protein, PFL_4669 family. Members of this protein family, such as PFL4669, are found in integrating conjugative elements (ICE) of the PFGI-1 class as in Pseudomonas fluorescens.	6.51487e-111

>NZ_CP019730.1|WP_020361459.1|1820518_1821037_-|hypothetical-protein
MNMSTAVRFGSYAFVGSAETLIVDEGDSSGITFGQARGDTSGSAPETNQGDSSGITSHSVLGSETKLALYTIRIDSTGITHHTELDAAAGFTSVISKSDSTGITLGPQLGDARCITRGIVQGDSLMATLASAPAAKKPIRRRNGLLLTTPYGRGQSCLAYSISSYKGSAQHG
>NZ_CP019730.1|WP_017682927.1|1819746_1820526_-|TIGR03761-family-integrating-conjugative-element-protein
MADNFQLNIGSLRSSVNLTLHTHHASRLWFGRQRTEGKPGMIGLSGFANILNRIKRGCEQDDPYSDWFLLLIEEKIESSEQEMTDIDNRLDEVMASLPAMLSIGQNLSVQPVTLPLFLSTPLAFKAVYLLTAYDELVRRILLASHVGLIDNHAKGQWLDEGAAILRRLFGLSQRYKFSGASRGDFAAKNARSELAREMYAPFGEIPQDILEGTRKSKFAPALSTGPASTFNEDDQDEGEDFISMDTAPATPLPRTEPEE
>NZ_CP019730.1|WP_017682926.1|1819174_1819747_-|DUF3158-family-protein
MLNPSHSVTGAHTLQQGAFQPLQQDAFAGLQHAPFLKGLLKPFKGKGGMLQLAELCRSLEGDLNALAEDQVLAQANRHPYTLLPVRMVRQRTSAGTVFLRWQEMGTRQMGVNVWSNLLTDPRTPESLLRDLHSMEQQRVALNMQISLVHTIGRQAVDCAEKMAQADAVYAERLQQISHSSGINPHTEKES
>NZ_CP019730.1|WP_017682925.1|1818723_1819173_-|single-stranded-DNA-binding-protein
MGTSVDWEGNIGSAPEFKEFPNGNKDPRRLLRLNVYFDNSIPKNDGTGFEDRGGFWANVEFWHKDAEHYANVYQKGMRVLIQGRAIMDSWTKDGEDFSALKVQASRVGILPARIEAIHLAASQPQHASRPQPAQNTQDAQPDFDDDIPL
>NZ_CP019730.1|WP_074322669.1|1817950_1818151_-|CrpP-family-protein
MKAESSLRIEASDRRRFNNPHHAVMLAGAQAARDSIPLHECPYRHPAMRASWLKGFAQEQQQSFEF
>NZ_CP019730.1|WP_017682922.1|1817245_1817692_-|hypothetical-protein
MTGRIVGRISPYRLAGVEYLSVDLMGQLSGDMSVTISTAAQSTDYSFDDLERTCFEVPDMTEGLTMISLFLRDANAMVSLDSAHQSSRVPQQGEPVVPVIAAFITSINCPICNTPQLGFIEDPRGGDFDCNDCGRPFHIPADSSVVFG
>NZ_CP019730.1|WP_017682921.1|1815280_1817233_-|DEAD/DEAH-box-helicase
MASPRLMNKRPVLLRKAIYDGYDFGLSLSYLEGANKLLLRRGGFFIRRSEHPLNQFWRVPKTKLLDDLDVLYRELAELAAGKHIESWQAFRDRISSAQSDTHRDAFTWGMKFRLAPLAEGGVILSGDFHPGAVAIAKRMRGVFLSAGKAWRVQGTAELVRSNLILELGLSEDQFEILDTLQELLADGSVSPVREVTSISLGGFSPESTKSEEEVSDSGIYLASVPSIKNTELTSAEIGEALASFSLMDHQPAGIRHLLQRTSALLADDMGLGKTRQAVIAAGIRAQGKPVLVIVLNSLIINWQREILMVFPDAQISMQKFDTAAGWIIVNYERLGDFVMHASSFAVMVIDEAHRLKEPTAAWTRHGFDIAAQVQNRYLLTGTPVLNREAELHTLLRLSGHPIGHLPLNEFCERFAGSPEFRKTLRDEISDWMLRRRKDVLPGLKGKQRQTVPVTLSKEERDEYNQIMRSDQHRFARLGGLRQLLERVKVRIVADLMAELDVDDKVILFCEYQESVATLRDHCTSLGIGCVTLVGSDTPKKRQKAIDAFQEDPDCRVFIGTRSAAGTGYNLTAANYVFFLGLPWTPGLQDQAEDRAYRNGQLRLVVVKIPLAEDTIDQQLWQMLMDKRALASDLIDPEAEDLNKQALALML
>NZ_CP019730.1|WP_017682920.1|1814933_1815182_-|hypothetical-protein
MSKTFTSNMDRVLLRISKAGNGCGFLLIAGYVLLSMVSAVLDPNFNQDHLAQEFAPLIVYAIGVSAVCLVLQIMLRTDSISG
>NZ_CP019730.1|WP_017682919.1|1813555_1814698_-|pilus-biosynthesis-protein-PilL
MIRQLSTLSILALFAGCTSVADKPEGPAYDSSQNPELLSPDLYSSGAKSGQEPMVRYGRYALVNTAPEAEQRDLMAQIIDVSIPPNMHPSVQDAMQYVVSRSGYTLCPPTTGHVNILFTRPLPAAQYKLGPMSLRNTLQVLAGPAWQVKVNEVTRGVCFVLRPGFQLPEPPKALAQTSSVQPAASASNSRSTSTPEVTVLTAPETGTPFSKDSKPAAPAPTKAATQDKAPTAASAATAVPAKEISPAPQNRTAGIAAVAKATPPSSTPKTGVVESTSTSFVKTETAKVVPAPVPQETWKARVGSTLRQTVEEWASRAGWQLIWVPEDLDYQIEAPLSFTGSFDAAIKQIFPLYDNAKRSFVVDGAEGQGQHVLYVSERKK
>NZ_CP019730.1|WP_017682918.1|1811819_1813559_-|PilN-family-type-IVB-pilus-formation-outer-membrane-protein
MIMALMRHIALGVTALIAAGCSVQRVDEAAARAEATANQAGQYAAILRNKQQQERRDTVIFSNKPWVSTQPVVARRGIPAKYDCHVDYRAAGSVGIAEIAQYITSQCGLPVLVSPDALNPGLLNSNAPAQANRAQAVSIAPNPDSLAGLLPAGITGGPGLGSGSAGRSSDFASMLTPNLISGLNYSGKASGMLDDVTARLGLSYKYNPASRSVQVTYFDTKVFDVYAFGDVQEIKSTVRSGMTTSSGTGSSGSSGSSSSGSSSSGVSGDSGSNQSTTVTLNTSILTDIQSNVQAMLSTSPPGRMYLSPSTGTLTVTDRPDVLANVETYLAKTNHSITQQVLFNVKVFEATLTDTDQLALNWAAVYNSLSTKWGLSLSNTVPGISSSAISGSVGIVDTANSAWAGSNAIIQAIAEQARISNVRSPSVTTLNLQPAPLQIGNVQGYIPSVQTNTTASVGSSTAITPGTITSGFNMTLQPRLMDDDEMLLMITINMSSKPTFQPFTSNGSSVQIPNYDAKSLSPKVKLRSGQTLILSGFDELNDNTDKIGTGSPGFFGLGGGRTRTSSQSFLVVLITPIVTN
>NZ_CP019730.1|WP_017682929.1|1822403_1823141_-|DUF2857-domain-containing-protein
MSKKHNPLNEAMVAQILHHLRNGEFRRCIDMGLDPEILVMLQHPSSQSVLLNSAVTWCRVAVDPDMVKRLLSNKERTDEENRIVQRALRLGATTPMLQEFFGMSPQEVSLQRVLVGVPGRPGRFRDIPDDAPLWHRFVQLMDEYHVDHTDGVALLDIAMMLTEEVNIPPEEPQSQPSDPITLGLVWNKIQSWLAQDLYPTGQQRKASSLVLLGDSRQQSKANASRRASTHSQTGKPVGKVEGDQM
>NZ_CP019730.1|WP_017682930.1|1823177_1824941_-|chromosome-partitioning-protein-ParB
MASKLTAEEISGKLLTGSFSRSGPSVDRLPDPVADTPMVLTLDEMTAYANNPRTVTNAKYQEIKESIRQRGLDQPPSVTRRPGDTKYTIRNGGNTRLAILRELYTETGEDRFYRHNVLFRPWDSGRGEIIALTGHLAENDLRGALMFIERAVGIENARAIYEAEAGEQISQRELVRRLREDGYPVSQSHISKMQETVRCLLPVIPAALYSGLGKPQIERLLSLRKAGGQTWSTHTEGKEHIPDFEGLFQDVLSLFDGDASEFVYERVQDELISHMQTGTGLTYEQILLTLSENQNQARRSAVIESPVNISPAQPIQSNLPDPNGAEDAGKSTAPTLQPTSTDPEPKFEVPNGSTRPRNIKTDSDWLKPEGGDVVLSEEERAARLAGHVVTPVAITDRVIDMKRQLAALDGENLPDFNANALISIPVQAGGLHPISDVWYIERLIDQPDELRPVIAQLAREIAYLSGIGPDSVVDVPGGLGFLCQEPPQDAELTDLANHALTLLQSISGVYAIALTKETPEQPLDVSEFQFTAALGQLLLGSPRYEDRDAVLEGRMDDACIVKLFRLIRLGRRLVELELGSVREVQTS
>NZ_CP019730.1|WP_017682931.1|1824943_1825207_-|Arc-family-DNA-binding-protein
MLNKDAVSLHDDDKDEKFVIRLPTGMRGRVRGAAKLNRRSMNSEIVSRIEASLRHEQEIARLTAVIDVLLKGGTPASNVIQLPEAGQ
>NZ_CP019730.1|WP_017682933.1|1825438_1825840_-|hypothetical-protein
MEYYHRTDEDLPLQSDRERERLRIEQAMAEFLSRGGSIHTVAPSKRSTESNFIINAEKTAQLKANAASQAKKKADVFTDTELARLLRAHCTAGASLQSAAGTLNQTIKRCELIARRYQIPFRSAAFSKSRAHQ
>NZ_CP019730.1|WP_017682934.1|1825841_1826183_-|hypothetical-protein
MSTHNTPFLITHQCCNCGHHLPRTAVLATPGHQPECPRCHSGEIIELEPLDAEWRVTSINKAPRSNEYTVVFRIKPAGSQKAFMKMLTDTFVDHEVEIVEMQSGNKLTASGGK
>NZ_CP019730.1|WP_017704189.1|1826179_1827526_-|replicative-DNA-helicase
MSISDMSPPHSVEAEQALLGGLMLDNEAWDLIADRVHADDFFKREHKLIFQSISVLAEANKPFDVVTVADSMPSIEEAGGLAYLSDIARNTPSVANIKTYSDIVSNRAHLRRLISHGYACAREASDPQAVASVVQDVIEQNLFALGQGQQTSDFVDVNKMLLQVVDKIDLRFNAGESVVGVPTGIDDLDELTGGLQPADLIIVAARPSMGKTSLALNFVDPALQKDERSTVQIYSLEMPAEALIYRLLSILGHLNLEKLIRGQLEDEDWPKLAMAVAKLNSYGDRLVIDDQAGLTPSAIRARARRGARRFGKPALILIDYLQMMQCPGRENRANEISEISRSLKALAKEFQCPVVALSQLNRELERRPNKRPINADLRDSGAIEQDADLILFVYRDEVYNNDTEHKGIAELILGKHRNGSLGTVRTAFIPQHTRFANLSASTWQGARV
>NZ_CP019730.1|WP_017682936.1|1827525_1828224_-|DUF2786-domain-containing-protein
MTIDRQRIIDKVIKCFALARSAGASPNEAETALRQGRKLMEQYQLDELEVDAHLACEASVPTGTKRAPPTWLHNLASTCASAFDCDCIAVGYSAEWRFKFIGLGVSPDLATYAYSALHQQLILARRQHVSKLKRCNPTTKRRRGRIFAEAWVEAVASNVYQFAGKQDDQTRQTISAYLDLHHPTVIEKELEPTSAKGHDVKSKHQGWEQGSSAALHRGVSQHAASAARIGGA
>NZ_CP019730.1|WP_017682937.1|1828220_1828976_-|hypothetical-protein
MGKPNLTEATGITPELVRKLNEQYNSAQLRAAQTKLTNTSRELRNLSSGHKMGRGLISRLGDYLRVEQRELLTQAAQLLESVNCQVEHAKEKRVRDEKAAKRRQDARNARAKQLIAATYPLPTESLDQKLDVLRTVLLFNRIGAHDSFYSAVELNSEIRSTLLTPFSRLIGWGSLTAYRVSYLSSLRIRLIEALTNDISYDDGSEVEDRLAALQSKVREENAKAALTSDEHETLRLWKEALSVEAAPEVRP
>NZ_CP019730.1|WP_017682938.1|1828977_1829838_-|ParA-family-protein
MFVTSLLSTKGGVGKTTLAANLGGFCADSGLKVLLIDMDPVQPSLSSYYPMAEEVSGGIFDLIAHNQTDPEKIVSRTSIPNLSLILSNDPNNQLINLLLQAPDGRLRLAHLLKAFSDQFDLILIDTQGARSVMLEMVVLASDLAVSPLQPNMLSAREFNRGTLHMLEGLRPYSRLGLNIPPIKVVVNCLDQTNDARAIHSAIRQTFAESDEIEVIQSTVPASVIFRQASTSGMSAHRVEYKQPSNRRAPSALQIIRELAIELLPQWSARFQDMTESAVEALVKGGQ
>NZ_CP019730.1|WP_029768382.1|1830464_1831682_-|site-specific-integrase
MEHGLVELKVNPLKETRVIPTKRPKKTIKTDAIVRARNWLNILVKEERATENRAEITPAWFWLAVFEMFYYTGIRLNALICLRYSDIDLGERLIRVRGETEKTHREFMIPIPDGLMPHLKLLMDIAHRVGLAPMDQIFNVNKFSGHYSRTQMNTDQVESMYKKLTAMTGVRMTPHRFRHTIASEMMRQPERNIHITKSLLNHSNIATTMEYIEPDYDVMREVMNERGKRPAKINYLAKSDAANRENARASKKAPVKNLTQNSTRITPTPHSDSASGSTRVPAPAANVHPQMKTDEMHRRGERAKNAHSNTTETYRADPVPIDQTDLFGELADPLTGRALAPGDMSPEYLARRLDEFSLWLREAASGRLVMGPTSMGTSIPSGPNEQIANLAPACIQASTWNSRTG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019730_2	2.2\|1821589\|35\|NZ_CP019730\|PILER-CR	1821589-1821623	35	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	40459-40493	10	0.714
NZ_CP019730_2	2.2\|1821589\|35\|NZ_CP019730\|PILER-CR	1821589-1821623	35	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	217346-217380	10	0.714
NZ_CP019730_2	2.2\|1821589\|35\|NZ_CP019730\|PILER-CR	1821589-1821623	35	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	180777-180811	10	0.714

1. spacer 2.2|1821589|35|NZ_CP019730|PILER-CR matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.714

ggtgtcggaatccgctttcaccggattttcgccgg	CRISPR spacer
ttcatcttcgtccgctttcccctgattttcgccgg	Protospacer
  ..**   .********* ** ************

2. spacer 2.2|1821589|35|NZ_CP019730|PILER-CR matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 10, identity: 0.714

ggtgtcggaatccgctttcaccggattttcgccgg	CRISPR spacer
ttcatcttcgtccgctttcccctgattttcgccgg	Protospacer
  ..**   .********* ** ************

3. spacer 2.2|1821589|35|NZ_CP019730|PILER-CR matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 10, identity: 0.714

ggtgtcggaatccgctttcaccggattttcgccgg	CRISPR spacer
ttcatcttcgtccgctttcccctgattttcgccgg	Protospacer
  ..**   .********* ** ************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31829 : 41522

Liberibacter_phage(50.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020313842.1\|31829_32660_+	type III restriction protein res subunit	A0A2D2W2K3	Stenotrophomonas_phage	3.0e-16	28.7
WP_017683428.1\|33115_33715_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	1.4e-23	40.5
WP_032678281.1\|33666_35199_-\|transposase	IS66-like element ISPsy34 family transposase	S5VTD3	Leptospira_phage	8.9e-83	36.8
WP_078983211.1\|35216_35573_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.4e-17	40.0
WP_017684557.1\|35704_36775_+	N-6 DNA methylase	A0A220A2U4	Liberibacter_phage	1.8e-61	41.9
WP_017684558.1\|36771_38091_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_017684559.1\|38237_41522_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	1.2e-65	26.5

DBSCAN-SWA_2

220722 : 324800

104

Pseudomonas_phage(52.63%)

tail,portal,transposase,lysis,head,terminase,integrase,protease,capsid

attL 246987:247046|attR 323488:324861

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003377912.1\|220722_221199_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_020313765.1\|221215_221998_-	EAL domain-containing protein	NA	NA	NA	NA
WP_017683485.1\|222165_222573_+	RNA-binding protein S4	NA	NA	NA	NA
WP_017683486.1\|222732_223635_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003377905.1\|223814_225359_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	1.2e-127	49.0
WP_017683487.1\|225431_225863_-	hypothetical protein	NA	NA	NA	NA
WP_017683488.1\|226619_227804_-	hypothetical protein	NA	NA	NA	NA
WP_074291381.1\|228471_228909_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_074291382.1\|228932_229505_-	hypothetical protein	NA	NA	NA	NA
WP_003382329.1\|229643_230351_-	hypothetical protein	NA	NA	NA	NA
WP_017683492.1\|230478_230928_-	hypothetical protein	NA	NA	NA	NA
WP_003382327.1\|231363_232077_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_003382326.1\|232412_233270_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_074291380.1\|233414_233828_-	hypothetical protein	NA	NA	NA	NA
WP_017683494.1\|233802_234471_+	haloacid dehalogenase type II	NA	NA	NA	NA
WP_003382324.1\|234536_235811_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_003382322.1\|235904_237542_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017683495.1\|237574_238531_+	ABC transporter permease	NA	NA	NA	NA
WP_017683496.1\|238527_239406_+	ABC transporter permease	NA	NA	NA	NA
WP_003382317.1\|239407_241249_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-21	33.2
WP_003382315.1\|241245_241557_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_017683497.1\|241535_242945_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_003382312.1\|242941_244096_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_003382311.1\|244092_245250_+	acetylornithine deacetylase	NA	NA	NA	NA
WP_017683498.1\|245364_246822_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
246987:247046	attL	NA	NA	NA	NA
WP_017682616.1\|247039_248299_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.7e-43	41.7
WP_074291496.1\|250248_251214_-	glyoxylate/hydroxypyruvate reductase A	M1I636	Acanthocystis_turfacea_Chlorella_virus	1.8e-12	26.8
WP_017683995.1\|251462_252767_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_020304346.1\|252848_253505_+	hypothetical protein	NA	NA	NA	NA
WP_002555947.1\|253552_254041_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_017683994.1\|254069_254528_-\|transposase	transposase	NA	NA	NA	NA
WP_017683993.1\|254933_256445_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-33	45.1
WP_017683992.1\|256460_258044_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.5e-21	34.0
WP_017683991.1\|258045_259068_-	ABC transporter permease	NA	NA	NA	NA
WP_005745742.1\|259067_260135_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_017683990.1\|260136_262020_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_078983213.1\|262164_264879_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	3.0e-33	24.3
WP_005739842.1\|265089_265491_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_005887863.1\|265490_266198_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_074556880.1\|266248_267070_-	energy transducer TonB	NA	NA	NA	NA
WP_078983152.1\|268268_269435_-	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7C038	Faustovirus	1.3e-30	30.9
WP_005613713.1\|269779_270250_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_017683986.1\|270333_270588_+	hypothetical protein	NA	NA	NA	NA
WP_017683985.1\|270689_271364_-	HAD family hydrolase	NA	NA	NA	NA
WP_017684969.1\|272973_273837_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_017684971.1\|274534_275479_+	hypothetical protein	NA	NA	NA	NA
WP_017684972.1\|275839_276430_-	hypothetical protein	NA	NA	NA	NA
WP_074291564.1\|276527_277667_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_032685461.1\|277757_278825_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017685226.1\|278916_279156_-	hypothetical protein	A4JWV2	Burkholderia_virus	5.6e-08	46.3
WP_017685014.1\|279719_280421_+	hypothetical protein	NA	NA	NA	NA
WP_017685013.1\|280816_281887_-	hypothetical protein	NA	NA	NA	NA
WP_017685012.1\|282181_282523_-	hypothetical protein	NA	NA	NA	NA
WP_017685011.1\|282522_282834_-	hypothetical protein	NA	NA	NA	NA
WP_020362375.1\|282843_283080_-	hypothetical protein	NA	NA	NA	NA
WP_076611254.1\|283305_284661_+\|transposase	IS4-like element ISPsy33 family transposase	NA	NA	NA	NA
WP_017684990.1\|285060_286893_+	AAA family ATPase	NA	NA	NA	NA
WP_003373168.1\|287159_287450_+	hypothetical protein	NA	NA	NA	NA
WP_005730142.1\|287446_287692_+	hypothetical protein	NA	NA	NA	NA
WP_017684991.1\|287701_288691_-\|integrase	integrase	V9IQN0	Stenotrophomonas_phage	2.3e-63	40.5
WP_099818608.1\|288716_290296_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685236.1\|290390_290621_-	hypothetical protein	NA	NA	NA	NA
WP_017699573.1\|290714_291011_-	hypothetical protein	NA	NA	NA	NA
WP_017684588.1\|291020_293732_-	hypothetical protein	A0A2H4J936	uncultured_Caudovirales_phage	1.1e-282	53.8
WP_017684589.1\|293731_293965_-	hypothetical protein	NA	NA	NA	NA
WP_017684590.1\|294042_294408_-	hypothetical protein	NA	NA	NA	NA
WP_005730150.1\|294404_294905_-	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	5.4e-45	58.3
WP_005730151.1\|294913_295114_-	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	2.5e-09	50.8
WP_010209639.1\|295198_295534_+	helix-turn-helix transcriptional regulator	K4NXA8	Burkholderia_phage	1.7e-10	48.8
WP_003373152.1\|295853_296114_-	ogr/Delta-like zinc finger family protein	Q8HA63	Vibrio_phage	9.6e-14	45.0
WP_025987065.1\|296189_297071_-\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	7.1e-101	77.4
WP_017684592.1\|296967_299022_-\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	1.3e-267	72.0
WP_003373145.1\|299183_300116_+	hypothetical protein	A0A0U4JVV6	Pseudomonas_phage	5.3e-62	55.9
WP_003373144.1\|300117_301140_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	4.7e-120	65.6
WP_017684593.1\|301136_301859_+\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	1.0e-81	70.4
WP_017684448.1\|302003_302303_-	hypothetical protein	NA	NA	NA	NA
WP_017684447.1\|302401_302698_-	hypothetical protein	NA	NA	NA	NA
WP_017684446.1\|302796_303093_-	hypothetical protein	NA	NA	NA	NA
WP_017684445.1\|303128_303590_+\|head	head protein	A0A0U4J933	Pseudomonas_phage	8.7e-42	59.5
WP_010216271.1\|303586_304030_+\|tail	tail protein	A0A0U4IBS7	Pseudomonas_phage	9.3e-49	64.4
WP_017684444.1\|304019_304697_+	virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	7.0e-56	55.7
WP_017684443.1\|304711_305824_+	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	1.9e-135	66.3
WP_017684442.1\|305931_306267_+	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	5.4e-41	72.7
WP_010216281.1\|306266_306479_+	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_017684441.1\|306475_306682_+	hypothetical protein	NA	NA	NA	NA
WP_017684440.1\|306678_307206_+	lysozyme	NA	NA	NA	NA
WP_017684439.1\|307202_307682_+\|lysis	lysis protein	A0A0U4JXC2	Pseudomonas_phage	4.4e-20	44.3
WP_010216289.1\|307715_308006_+	hypothetical protein	A0A0U4B0P2	Pseudomonas_phage	3.7e-22	65.5
WP_017684438.1\|308175_310467_+\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	8.3e-117	44.0
WP_003342289.1\|310466_310784_+	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	1.3e-36	78.4
WP_017684437.1\|310780_311950_+	hypothetical protein	A0A0U4JJ14	Pseudomonas_phage	6.0e-156	70.0
WP_004407232.1\|311946_312471_+\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	2.9e-73	75.9
WP_017684436.1\|312479_314924_+\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	3.3e-119	59.6
WP_017684435.1\|314924_315524_+\|tail	tail protein	B5TK82	Pseudomonas_phage	6.7e-18	41.7
WP_017684434.1\|315520_316447_+	hypothetical protein	NA	NA	NA	NA
WP_017699497.1\|316443_316974_+	hypothetical protein	A0A0U4J942	Pseudomonas_phage	2.5e-48	57.0
WP_017684846.1\|316970_317681_+	hypothetical protein	A0A2I7RNK1	Vibrio_phage	2.6e-37	38.3
WP_017684847.1\|317653_318625_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	3.1e-121	65.0
WP_017684848.1\|318708_319494_-	hypothetical protein	NA	NA	NA	NA
WP_017684850.1\|319882_320131_-	hypothetical protein	NA	NA	NA	NA
WP_017684851.1\|320592_321003_-	hypothetical protein	NA	NA	NA	NA
WP_074322258.1\|321733_322036_-	hypothetical protein	NA	NA	NA	NA
WP_017684853.1\|322436_323450_+	J domain-containing protein	F2Y2Y5	Organic_Lake_phycodnavirus	2.8e-08	45.9
WP_017682616.1\|323540_324800_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.7e-43	41.7
323488:324861	attR	NA	NA	NA	NA

DBSCAN-SWA_3

466369 : 539300

Pseudomonas_phage(42.42%)

tRNA,tail,transposase,plate,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085991147.1\|466369_467948_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017683806.1\|469670_471380_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_017704201.1\|471823_473242_-	hypothetical protein	NA	NA	NA	NA
WP_017683805.1\|474048_474372_-	winged helix-turn-helix transcriptional regulator	A0A0K0PVG9	Roseobacter_phage	1.5e-08	46.7
WP_074291347.1\|475425_477915_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	6.4e-14	37.5
WP_017683803.1\|478161_480012_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	2.6e-36	34.7
WP_003377265.1\|480079_482038_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	2.8e-73	38.0
WP_002551877.1\|482506_482722_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_003377268.1\|482919_483945_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.1e-104	56.1
WP_007244453.1\|483997_484576_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_003377271.1\|484641_484995_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_003377273.1\|484985_485510_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_017683802.1\|485606_486836_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	3.0e-81	46.5
WP_003377278.1\|486933_488496_-	SpoVR family protein	NA	NA	NA	NA
WP_003377280.1\|488492_489764_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.9e-10	40.4
WP_017683801.1\|489885_491808_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_003377284.1\|492093_492414_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_003377287.1\|492410_493313_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	A0A291L9W7	Bordetella_phage	2.8e-07	43.8
WP_003377289.1\|493312_493693_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_003377290.1\|493806_494613_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003377292.1\|494609_495599_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_017683800.1\|495595_496924_-	molecular chaperone SurA	NA	NA	NA	NA
WP_003377296.1\|496898_499679_-	LPS-assembly protein LptD	NA	NA	NA	NA
WP_017683799.1\|499808_500834_+	phosphotransferase	NA	NA	NA	NA
WP_003377300.1\|500913_501585_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_003377303.1\|501585_502353_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_017683797.1\|502383_503364_-	DUF3530 family protein	NA	NA	NA	NA
WP_003377307.1\|503442_505491_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003377309.1\|505487_506117_+	response regulator transcription factor	NA	NA	NA	NA
WP_017683796.1\|506458_507583_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.0e-27	34.0
WP_017683795.1\|507665_508700_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_017683794.1\|508777_510025_+	ABC transporter permease	NA	NA	NA	NA
WP_003377317.1\|510036_510858_+	ABC transporter permease	NA	NA	NA	NA
WP_010218875.1\|510999_511674_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003377321.1\|511670_512489_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_003377323.1\|512558_514040_+	anthranilate synthase component I	NA	NA	NA	NA
WP_050545703.1\|514261_516145_-	autotransporter domain-containing esterase	NA	NA	NA	NA
WP_007244433.1\|517951_518218_-	transcriptional regulator	A0A2H4J8B4	uncultured_Caudovirales_phage	6.2e-16	50.0
WP_003377328.1\|518315_518564_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_017683430.1\|518716_519406_-	helix-turn-helix domain-containing protein	Q8HAG7	Salmonella_phage	7.4e-53	48.4
WP_017683431.1\|519517_519955_+	hypothetical protein	A0A2H4J8A5	uncultured_Caudovirales_phage	1.3e-23	46.7
WP_003377332.1\|520234_520420_+	Com family DNA-binding transcriptional regulator	B5TK59	Pseudomonas_phage	1.5e-13	89.7
WP_017683433.1\|520431_520857_+	hypothetical protein	NA	NA	NA	NA
WP_017683434.1\|520963_521605_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_005614154.1\|521728_522118_+	hypothetical protein	A0A059VK40	Pseudomonas_phage	1.1e-42	74.8
WP_011103202.1\|522095_522437_+	lipoprotein	A0A059VJW1	Pseudomonas_phage	2.6e-19	59.2
WP_017683435.1\|522482_523073_+	hypothetical protein	B5TK65	Pseudomonas_phage	7.7e-51	51.5
WP_017683436.1\|523069_523258_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	4.1e-14	76.6
WP_017683437.1\|523276_524773_+\|tail	tail sheath protein	B5TK67	Pseudomonas_phage	2.1e-233	79.7
WP_005614159.1\|524834_525182_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	5.6e-41	67.8
WP_017683438.1\|525178_525475_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	4.7e-33	75.3
WP_017683439.1\|525605_527750_+\|tail	phage tail tape measure protein	U5P420	Shigella_phage	1.9e-75	40.7
WP_017683440.1\|527746_529159_+	2-hydroxyacid dehydrogenase	B5TK71	Pseudomonas_phage	3.1e-106	44.4
WP_017683441.1\|529162_530272_+	hypothetical protein	B5TK72	Pseudomonas_phage	2.1e-113	59.8
WP_017683442.1\|530268_530781_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	3.7e-65	74.4
WP_005768009.1\|530777_531176_+	hypothetical protein	B5TK74	Pseudomonas_phage	8.0e-44	65.2
WP_017683443.1\|531165_532206_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	1.5e-134	71.5
WP_017683444.1\|532193_532793_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	8.3e-85	71.9
WP_017683445.1\|532803_534681_+	hypothetical protein	A0A077K818	Ralstonia_phage	7.0e-37	52.6
WP_003377342.1\|534691_535237_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_003377344.1\|535333_535879_+	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	1.4e-67	71.1
WP_074291473.1\|535890_536385_+\|lysis	lysis protein	A0A2H4JBH9	uncultured_Caudovirales_phage	1.9e-26	48.8
WP_003377435.1\|536796_537396_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-73	64.7
WP_003377436.1\|537417_538467_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.1e-111	57.7
WP_003377438.1\|538463_539300_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.6e-68	56.2

DBSCAN-SWA_4

694783 : 756612

Ralstonia_phage(28.57%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078983156.1\|694783_696139_+\|transposase	IS4-like element ISPsy33 family transposase	NA	NA	NA	NA
WP_003383177.1\|696903_698457_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-17	29.1
WP_003383176.1\|698980_699574_-	YigZ family protein	NA	NA	NA	NA
WP_003383175.1\|699606_700263_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003383174.1\|700361_701759_-	purine permease	H9YQ34	environmental_Halophage	1.9e-15	38.0
WP_003383173.1\|701945_702866_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003383172.1\|702993_704340_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_003383170.1\|704433_705927_+	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003382200.1\|711947_715424_+	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_017684540.1\|715420_719113_+	exodeoxyribonuclease V subunit beta	S5M596	Bacillus_phage	2.6e-11	22.6
WP_017684539.1\|719109_721203_+	exodeoxyribonuclease V subunit alpha	A0A1P8DII4	Virus_Rctr197k	3.2e-22	26.8
WP_074291525.1\|721445_721826_-	hypothetical protein	NA	NA	NA	NA
WP_017699749.1\|722490_723534_-	hypothetical protein	NA	NA	NA	NA
WP_017684234.1\|726372_726924_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_017684235.1\|726920_728987_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	5.5e-35	28.0
WP_005620610.1\|729364_730708_+	hypothetical protein	NA	NA	NA	NA
WP_074291453.1\|730824_732942_-	Effector protein AvrPphD	NA	NA	NA	NA
WP_017684237.1\|733500_733737_-	carbon storage regulator	NA	NA	NA	NA
WP_017684238.1\|733938_734517_-	AAA family ATPase	NA	NA	NA	NA
WP_032609899.1\|734516_735173_-	hypothetical protein	NA	NA	NA	NA
WP_017684239.1\|735209_736412_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_017684240.1\|736452_737487_-	sulfotransferase	NA	NA	NA	NA
WP_020313563.1\|737504_738425_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_017703697.1\|738570_739218_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_017704392.1\|739558_740494_-	syringolide biosynthetic protein AvrD1	NA	NA	NA	NA
WP_017684243.1\|741442_741862_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_007247668.1\|741858_742170_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_017684244.1\|742470_743127_+	hypothetical protein	L7TKZ9	Rhizobium_phage	6.6e-27	34.1
WP_003381350.1\|743174_743429_+	hypothetical protein	NA	NA	NA	NA
WP_003383614.1\|744245_745208_-	type III effector	NA	NA	NA	NA
WP_074556883.1\|746577_747645_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_078983215.1\|747855_748398_+\|protease	YopT-type cysteine protease domain-containing protein	NA	NA	NA	NA
WP_032685463.1\|748957_750025_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017685026.1\|750110_750497_+	type III chaperone protein ShcF	NA	NA	NA	NA
WP_110455589.1\|750596_751634_+	hypothetical protein	NA	NA	NA	NA
WP_005782565.1\|752103_752664_+	recombinase family protein	A0A1W5LU24	Ralstonia_phage	8.4e-31	41.5
WP_017685028.1\|752647_754306_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_017685029.1\|754295_755267_+	AAA family ATPase	NA	NA	NA	NA
WP_074556885.1\|755544_756612_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1066497 : 1119005

Pseudomonas_phage(15.38%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017682616.1\|1066497_1067757_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.7e-43	41.7
WP_003376571.1\|1068027_1069065_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_003376573.1\|1069106_1069712_-	lipoprotein	NA	NA	NA	NA
WP_017683727.1\|1069801_1072408_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	5.8e-191	42.4
WP_074291415.1\|1072590_1072710_+	hypothetical protein	NA	NA	NA	NA
WP_003376578.1\|1072719_1073070_+	hypothetical protein	NA	NA	NA	NA
WP_003376580.1\|1073140_1073911_+	YdcF family protein	NA	NA	NA	NA
WP_017683726.1\|1073962_1075483_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_003376583.1\|1075524_1076367_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_003376585.1\|1076372_1076873_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_003376587.1\|1076865_1077888_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	9.0e-47	44.5
WP_005620645.1\|1078065_1079394_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_003376593.1\|1079693_1080242_-	sel1 repeat family protein	NA	NA	NA	NA
WP_005620644.1\|1080536_1081820_-	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	7.6e-11	26.3
WP_003376597.1\|1082072_1082690_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_003376599.1\|1082713_1083511_-	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_077142890.1\|1083791_1084010_+	hypothetical protein	NA	NA	NA	NA
WP_017683723.1\|1083945_1085952_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	5.2e-30	33.3
WP_003376603.1\|1086110_1087574_+	AMP nucleosidase	NA	NA	NA	NA
WP_017683722.1\|1087653_1088286_+	pseudouridine synthase	NA	NA	NA	NA
WP_003376607.1\|1088299_1088779_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_074291416.1\|1089186_1090386_+	hypothetical protein	NA	NA	NA	NA
WP_003376613.1\|1090370_1091285_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_017683719.1\|1091300_1091720_-	hypothetical protein	NA	NA	NA	NA
WP_017699117.1\|1092076_1092640_-	RNA 2'-phosphotransferase	A0A2H5BJP0	Erwinia_phage	1.5e-27	40.7
WP_003383522.1\|1092821_1093748_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_074291417.1\|1093780_1094794_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_020365964.1\|1094804_1095344_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_003383519.1\|1095464_1096160_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003383518.1\|1096327_1096711_+	RidA family protein	NA	NA	NA	NA
WP_121509270.1\|1096953_1098533_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685108.1\|1098890_1100261_+	DnaJ domain-containing protein	A0A2K9V7V1	Bandra_megavirus	1.6e-06	47.7
WP_017683955.1\|1100929_1101685_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.6e-71	53.9
WP_032685482.1\|1101705_1103220_-\|transposase	IS21-like element ISPsy40 family transposase	K4I413	Acidithiobacillus_phage	4.8e-145	52.8
WP_017699620.1\|1103679_1104612_+	DEAD/DEAH box helicase	K7YWK7	Megavirus	2.7e-05	28.0
WP_017685110.1\|1104619_1105312_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017699610.1\|1108054_1109362_+	hypothetical protein	Q6NE04	Leptospira_phage	6.9e-84	40.7
WP_017685019.1\|1109381_1111454_+	hypothetical protein	NA	NA	NA	NA
WP_032685463.1\|1111536_1112604_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017685150.1\|1112697_1113888_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_074291269.1\|1115246_1115552_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_017683608.1\|1115958_1117227_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.7e-29	30.1
WP_074556891.1\|1117308_1117455_+\|transposase	transposase	NA	NA	NA	NA
WP_032685468.1\|1117472_1119005_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.4e-82	36.5

DBSCAN-SWA_6

1748789 : 1753579

uncultured_Caudovirales_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017682849.1\|1748789_1749137_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	4.3e-33	58.8
WP_017682850.1\|1749193_1749664_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	7.8e-54	64.7
WP_017682851.1\|1749675_1750377_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.5e-101	77.6
WP_017704282.1\|1750502_1750736_-	hypothetical protein	NA	NA	NA	NA
WP_019334108.1\|1751071_1751764_-	hypothetical protein	A0A2H4J5W2	uncultured_Caudovirales_phage	5.7e-53	47.2
WP_017682854.1\|1751877_1752312_+	ultraviolet light resistance protein RulA	A0A2H4J538	uncultured_Caudovirales_phage	1.7e-15	38.0
WP_017682855.1\|1752298_1753579_+	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	2.0e-104	47.6

DBSCAN-SWA_7

1830464 : 1880317

uncultured_Caudovirales_phage(40.0%)

integrase,transposase

attL 1851657:1851670|attR 1883625:1883638

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029768382.1\|1830464_1831682_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_017685142.1\|1831728_1831914_-	hypothetical protein	NA	NA	NA	NA
WP_017685141.1\|1831910_1833641_-	integrating conjugative element relaxase	NA	NA	NA	NA
WP_085991147.1\|1833707_1835287_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017699761.1\|1835916_1836609_-	hypothetical protein	A0A2H4J991	uncultured_Caudovirales_phage	8.5e-57	52.0
WP_020316415.1\|1836724_1837159_+	peptidase S24	A0A2H4J538	uncultured_Caudovirales_phage	7.7e-16	38.6
WP_074291555.1\|1837759_1838446_-	type III effector	NA	NA	NA	NA
WP_085988115.1\|1838681_1839779_+	DUF4113 domain-containing protein	I6RSM4	Salmonella_phage	3.6e-78	44.4
WP_017684915.1\|1840003_1840390_+	DUF3742 family protein	NA	NA	NA	NA
WP_017684914.1\|1840428_1841961_-	conjugal transfer protein TraG	NA	NA	NA	NA
WP_017684913.1\|1841957_1842332_-	hypothetical protein	NA	NA	NA	NA
WP_074556955.1\|1842334_1843702_-	integrating conjugative element protein	NA	NA	NA	NA
WP_024533459.1\|1843722_1844661_-	TIGR03756 family integrating conjugative element protein	NA	NA	NA	NA
WP_017685197.1\|1844657_1845095_-	TIGR03757 family integrating conjugative element protein	NA	NA	NA	NA
WP_017685198.1\|1845391_1845580_+	hypothetical protein	NA	NA	NA	NA
WP_017685199.1\|1845888_1846113_+	carbon storage regulator	NA	NA	NA	NA
WP_017685160.1\|1847606_1847918_+	hypothetical protein	NA	NA	NA	NA
WP_074291592.1\|1847889_1848192_+	hypothetical protein	NA	NA	NA	NA
WP_017685163.1\|1848337_1848919_-	hypothetical protein	NA	NA	NA	NA
WP_051120731.1\|1848919_1849603_-	DsbA family protein	NA	NA	NA	NA
WP_024533428.1\|1849599_1849899_-	hypothetical protein	NA	NA	NA	NA
WP_017684761.1\|1849895_1852904_-	conjugative transfer ATPase	NA	NA	NA	NA
1851657:1851670	attL	NA	NA	NA	NA
WP_017684760.1\|1852903_1853365_-	TIGR03751 family conjugal transfer lipoprotein	NA	NA	NA	NA
WP_017684759.1\|1853342_1854830_-	TIGR03752 family integrating conjugative element protein	NA	NA	NA	NA
WP_017684758.1\|1854819_1855743_-	TIGR03749 family integrating conjugative element protein	NA	NA	NA	NA
WP_017684757.1\|1855739_1856408_-	TIGR03746 family integrating conjugative element protein	NA	NA	NA	NA
WP_017684756.1\|1856404_1856797_-	TIGR03750 family conjugal transfer protein	NA	NA	NA	NA
WP_017684755.1\|1856812_1857181_-	TIGR03745 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_017684754.1\|1857201_1857441_-	TIGR03758 family integrating conjugative element protein	NA	NA	NA	NA
WP_003381923.1\|1857437_1857800_-	hypothetical protein	NA	NA	NA	NA
WP_017685221.1\|1857879_1858212_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_032685473.1\|1858503_1859571_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_085991147.1\|1859785_1861365_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_074291545.1\|1861629_1862817_+	MFS transporter	NA	NA	NA	NA
WP_017684858.1\|1863753_1864854_+	amidinotransferase	D5GV78	Campylobacter_virus	1.3e-35	30.0
WP_017684857.1\|1864940_1866194_+	HPr kinase	NA	NA	NA	NA
WP_017684856.1\|1866246_1867491_+	HPr kinase	NA	NA	NA	NA
WP_031313254.1\|1867656_1869114_-	ATP-dependent helicase	A0A088C4M0	Shewanella_sp._phage	2.4e-45	31.3
WP_019334008.1\|1869123_1869873_-	TIGR03747 family integrating conjugative element membrane protein	NA	NA	NA	NA
WP_032685506.1\|1869918_1872078_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_020362878.1\|1872088_1872595_-	integrating conjugative element protein	NA	NA	NA	NA
WP_032685505.1\|1872591_1873149_-	lytic transglycosylase	NA	NA	NA	NA
WP_017685219.1\|1873133_1873880_-	TIGR03759 family integrating conjugative element protein	NA	NA	NA	NA
WP_017685218.1\|1873888_1874599_-	hypothetical protein	NA	NA	NA	NA
WP_074556898.1\|1875061_1876129_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_003381911.1\|1876176_1876482_+	hypothetical protein	NA	NA	NA	NA
WP_020314360.1\|1877279_1878320_+	peptidase C55	NA	NA	NA	NA
WP_017704372.1\|1878774_1879431_+	hypothetical protein	NA	NA	NA	NA
WP_074291429.1\|1879474_1880317_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1883625:1883638	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2616972 : 2624924

uncultured_Caudovirales_phage(71.43%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017682679.1\|2616972_2618253_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-96	45.6
WP_003380158.1\|2618253_2619648_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_003380160.1\|2619699_2620698_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_003380162.1\|2620806_2621808_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	4.4e-163	83.5
WP_003380166.1\|2621804_2622140_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	8.3e-42	75.7
WP_017682680.1\|2622136_2622436_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.1e-26	59.6
WP_005738151.1\|2622435_2622798_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	3.9e-37	62.5
WP_003380170.1\|2622799_2623192_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	6.3e-57	82.3
WP_017682682.1\|2623622_2624924_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.3e-61	35.8

DBSCAN-SWA_9

2896802 : 2959639

Tupanvirus(28.57%)

tRNA,integrase,transposase

attL 2894723:2894782|attR 2964800:2966604

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2894723:2894782	attL	NA	NA	NA	NA
WP_003383538.1\|2896802_2898284_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_032685472.1\|2899394_2900762_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.4e-32	30.9
WP_074556909.1\|2901078_2901294_-	hypothetical protein	NA	NA	NA	NA
WP_003382047.1\|2901481_2901943_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_017684178.1\|2901971_2902937_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_003382044.1\|2903065_2903509_+	Hsp20 family protein	A0A0C5AE28	Cyanophage	5.1e-15	36.3
WP_017684179.1\|2903564_2905757_-	phosphodiesterase	A0A127AWB9	Bacillus_phage	3.0e-15	32.6
WP_003382041.1\|2905825_2906698_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003382039.1\|2906843_2908271_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_003382037.1\|2908267_2908909_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_003382036.1\|2909055_2910138_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_003382035.1\|2910208_2911321_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003382034.1\|2911486_2912491_+	2-dehydro-3-deoxygalactonokinase	NA	NA	NA	NA
WP_003382033.1\|2912492_2913128_+	2-dehydro-3-deoxy-6-phosphogalactonate aldolase	NA	NA	NA	NA
WP_003382032.1\|2913188_2914337_+	galactonate dehydratase	Q6A202	Oenococcus_phage	1.1e-56	36.6
WP_074291472.1\|2914357_2914447_-	DUF1534 domain-containing protein	NA	NA	NA	NA
WP_005738096.1\|2914558_2915869_+	MFS transporter	NA	NA	NA	NA
WP_017684180.1\|2915950_2916760_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_017684181.1\|2916771_2917758_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	2.1e-72	43.5
WP_017684182.1\|2918178_2919231_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	5.2e-82	43.3
WP_032685463.1\|2919466_2920534_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017685217.1\|2920741_2921143_-	hypothetical protein	NA	NA	NA	NA
WP_032685473.1\|2921259_2922327_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017704755.1\|2922915_2923257_+\|transposase	transposase	NA	NA	NA	NA
WP_017685113.1\|2923313_2923694_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017685114.1\|2924050_2924557_-	AAA family ATPase	NA	NA	NA	NA
WP_017685115.1\|2924658_2925267_-	DUF1851 domain-containing protein	NA	NA	NA	NA
WP_017685116.1\|2925278_2925764_-	hypothetical protein	NA	NA	NA	NA
WP_017683597.1\|2927384_2927816_+	hypothetical protein	NA	NA	NA	NA
WP_017683598.1\|2927812_2928235_+	hypothetical protein	NA	NA	NA	NA
WP_017683599.1\|2928404_2929889_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_003382023.1\|2930309_2931203_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003382022.1\|2931244_2932900_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_003382021.1\|2933423_2934173_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_017683600.1\|2934173_2935103_+	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
WP_017683601.1\|2935223_2936051_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017683602.1\|2936061_2936415_+	DUF4398 domain-containing protein	NA	NA	NA	NA
WP_003382016.1\|2936411_2937227_+	OmpA family protein	NA	NA	NA	NA
WP_003382014.1\|2937444_2938884_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_074291421.1\|2938918_2939653_+	translation initiation factor 2	NA	NA	NA	NA
WP_017683604.1\|2939747_2940005_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_003382009.1\|2940062_2940668_+	START domain-containing protein	NA	NA	NA	NA
WP_003382008.1\|2940737_2942027_-	citrate (Si)-synthase	NA	NA	NA	NA
WP_005738085.1\|2942390_2942765_+	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_003382006.1\|2942758_2943127_+	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_003382005.1\|2943130_2944903_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_003382004.1\|2944915_2945620_+	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_003382003.1\|2945879_2948711_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_017683605.1\|2948752_2949973_+	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_003382001.1\|2950145_2951582_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.1e-45	27.2
WP_002552981.1\|2951790_2952957_+	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_005617294.1\|2952956_2953838_+	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
WP_003381996.1\|2953938_2954160_-	hypothetical protein	NA	NA	NA	NA
WP_020365722.1\|2954485_2955799_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_017703617.1\|2955931_2957287_+\|transposase	IS4-like element ISPsy33 family transposase	NA	NA	NA	NA
WP_017685214.1\|2957611_2958064_+	hypothetical protein	NA	NA	NA	NA
WP_099818608.1\|2958060_2959639_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
2964800:2966604	attR	NA	NA	NA	NA

DBSCAN-SWA_10

3021514 : 3079310

Salmonella_phage(25.0%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085991147.1\|3021514_3023094_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_031313303.1\|3023148_3024768_+	CHAT domain-containing protein	NA	NA	NA	NA
WP_017703875.1\|3024883_3025387_-	hypothetical protein	I6RSM4	Salmonella_phage	1.9e-29	53.1
WP_017703876.1\|3025376_3025625_-	hypothetical protein	A0A218MNF2	uncultured_virus	6.8e-25	69.3
WP_017685227.1\|3025614_3026046_-	S24 family peptidase	I6S1S3	Salmonella_phage	1.6e-05	42.7
WP_017684806.1\|3026286_3026937_+	HAD family hydrolase	NA	NA	NA	NA
WP_017684805.1\|3027006_3028398_+	hypothetical protein	NA	NA	NA	NA
WP_074291498.1\|3028526_3028862_-	hypothetical protein	NA	NA	NA	NA
WP_017684803.1\|3029270_3032306_-	AAA family ATPase	NA	NA	NA	NA
WP_017684802.1\|3032302_3032902_-	hypothetical protein	NA	NA	NA	NA
WP_017684801.1\|3032903_3034982_-	hypothetical protein	NA	NA	NA	NA
WP_017684800.1\|3035198_3035600_+	hypothetical protein	NA	NA	NA	NA
WP_017684799.1\|3035656_3036175_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_017684798.1\|3036964_3037588_+	hypothetical protein	NA	NA	NA	NA
WP_074291497.1\|3037644_3037911_+	hypothetical protein	NA	NA	NA	NA
WP_032685473.1\|3038295_3039363_-\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017683645.1\|3042719_3044297_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003382189.1\|3044317_3045328_+	ABC transporter permease	NA	NA	NA	NA
WP_003382188.1\|3045324_3046176_+	ABC transporter permease	NA	NA	NA	NA
WP_003382187.1\|3046168_3047017_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-14	31.2
WP_003382186.1\|3047013_3047727_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-24	33.1
WP_017683646.1\|3047831_3048389_+	cytochrome b	NA	NA	NA	NA
WP_017683647.1\|3048457_3048997_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_003382183.1\|3048993_3049782_+	hypothetical protein	NA	NA	NA	NA
WP_003382180.1\|3050017_3050527_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_017683648.1\|3050523_3051489_+	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_017683649.1\|3051558_3053961_+	TonB-dependent receptor	NA	NA	NA	NA
WP_003382174.1\|3054284_3055661_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	4.2e-23	26.0
WP_017683650.1\|3055851_3057636_+	achromobactin biosynthetic protein AcsD	NA	NA	NA	NA
WP_003382171.1\|3057628_3058837_+	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_003382170.1\|3058833_3060240_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_020315044.1\|3060261_3062115_+	achromobactin biosynthetic protein AcsC	NA	NA	NA	NA
WP_074291454.1\|3062111_3062888_+	siderophore biosynthesis protein SbnG	NA	NA	NA	NA
WP_017683653.1\|3062892_3064776_+	IucA/IucC	NA	NA	NA	NA
WP_017683654.1\|3064765_3065686_+	iron-siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017683655.1\|3065682_3066672_+	iron ABC transporter permease	NA	NA	NA	NA
WP_017683656.1\|3066664_3067696_+	iron ABC transporter permease	NA	NA	NA	NA
WP_017683657.1\|3067706_3068498_+	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	3.4e-09	24.3
WP_003382158.1\|3068494_3069274_+	hypothetical protein	NA	NA	NA	NA
WP_017703642.1\|3069270_3069903_+	RraA family protein	NA	NA	NA	NA
WP_017682616.1\|3069974_3071234_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.7e-43	41.7
WP_099818608.1\|3071343_3072923_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_153303628.1\|3072919_3073516_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_017684343.1\|3077080_3078877_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_003382819.1\|3078860_3079310_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_11

3403367 : 3407910

Pseudomonas_phage(50.0%)

tail,integrase

attL 3400514:3400528|attR 3407029:3407043

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3400514:3400528	attL	NA	NA	NA	NA
WP_003376746.1\|3403367_3404345_+\|integrase	site-specific integrase	W6MYA3	Pseudomonas_phage	4.5e-112	65.5
WP_003376744.1\|3404341_3404587_-	hypothetical protein	W6MVE5	Pseudomonas_phage	1.0e-25	66.7
WP_074291386.1\|3405029_3405362_+	hypothetical protein	A0A2H4J4N2	uncultured_Caudovirales_phage	3.8e-23	51.9
WP_017684054.1\|3405377_3406073_+	hypothetical protein	NA	NA	NA	NA
WP_017684055.1\|3406139_3406646_+\|tail	tail protein	A0A2H4J6K6	uncultured_Caudovirales_phage	7.8e-60	86.0
WP_074291387.1\|3406642_3407296_+	hypothetical protein	A0A0S2SY57	Pseudomonas_phage	6.0e-20	73.3
3407029:3407043	attR	NA	NA	NA	NA
WP_017684057.1\|3407298_3407910_+	C40 family peptidase	A0A2H4J1J7	uncultured_Caudovirales_phage	3.7e-96	80.8

DBSCAN-SWA_12

3623199 : 3636970

Acidithiobacillus_phage(100.0%)

integrase,transposase

attL 3623064:3623123|attR 3639348:3639458

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3623064:3623123	attL	NA	NA	NA	NA
WP_032685473.1\|3623199_3624267_-\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_136624444.1\|3624534_3625908_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_074291587.1\|3625909_3626281_+	hypothetical protein	NA	NA	NA	NA
WP_032685503.1\|3626303_3627371_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017699607.1\|3627447_3627921_+	hypothetical protein	NA	NA	NA	NA
WP_110455601.1\|3627922_3628996_+	hypothetical protein	NA	NA	NA	NA
WP_017685005.1\|3629472_3629769_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017685004.1\|3630233_3630620_+	hypothetical protein	NA	NA	NA	NA
WP_032685503.1\|3631369_3632437_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017685222.1\|3632540_3632996_+	hypothetical protein	NA	NA	NA	NA
WP_032685463.1\|3633052_3634120_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_153303625.1\|3635143_3635281_+	hypothetical protein	NA	NA	NA	NA
WP_032685482.1\|3635455_3636970_+\|transposase	IS21-like element ISPsy40 family transposase	K4I413	Acidithiobacillus_phage	4.8e-145	52.8
3639348:3639458	attR	NA	NA	NA	NA

DBSCAN-SWA_13

3643458 : 3703133

Acidithiobacillus_phage(25.0%)

integrase,transposase

attL 3654829:3654888|attR 3688030:3688141

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085991147.1\|3643458_3645038_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_085991147.1\|3645730_3647310_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685074.1\|3648731_3649595_+	DUF4231 domain-containing protein	NA	NA	NA	NA
WP_085991147.1\|3650291_3651870_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017684623.1\|3651871_3652192_-	hypothetical protein	NA	NA	NA	NA
WP_017684622.1\|3652608_3652824_-	NgoFVII family restriction endonuclease	NA	NA	NA	NA
WP_136624496.1\|3652838_3653342_-	hypothetical protein	NA	NA	NA	NA
WP_017684621.1\|3653320_3654610_-	hypothetical protein	NA	NA	NA	NA
3654829:3654888	attL	NA	NA	NA	NA
WP_017684620.1\|3655194_3656475_-	hypothetical protein	NA	NA	NA	NA
WP_017699752.1\|3658458_3659190_+	hypothetical protein	NA	NA	NA	NA
WP_017684618.1\|3659636_3663953_+	hypothetical protein	NA	NA	NA	NA
WP_017684617.1\|3664562_3666299_+	hypothetical protein	A0A1L2BY82	Clostridium_phage	5.6e-57	28.0
WP_017684616.1\|3666495_3666939_+	hypothetical protein	NA	NA	NA	NA
WP_017684615.1\|3667095_3667626_+	hypothetical protein	NA	NA	NA	NA
WP_074291451.1\|3668652_3669003_+	hypothetical protein	NA	NA	NA	NA
WP_017684611.1\|3669139_3669913_-	HNH endonuclease	NA	NA	NA	NA
WP_017684610.1\|3670161_3670824_-	HAD family hydrolase	NA	NA	NA	NA
WP_010434693.1\|3671427_3671859_+	S24 family peptidase	I6S1S3	Salmonella_phage	2.1e-05	44.0
WP_017683955.1\|3673157_3673913_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.6e-71	53.9
WP_032685482.1\|3673933_3675448_-\|transposase	IS21-like element ISPsy40 family transposase	K4I413	Acidithiobacillus_phage	4.8e-145	52.8
WP_017684985.1\|3676345_3677431_+	ATP-dependent endonuclease	NA	NA	NA	NA
WP_017684984.1\|3677427_3679110_+	ATP-dependent helicase	A0A1V0SG90	Hokovirus	3.4e-11	24.6
WP_017684983.1\|3679234_3680233_-	hypothetical protein	NA	NA	NA	NA
WP_017684982.1\|3680310_3680988_-	hypothetical protein	NA	NA	NA	NA
WP_017684981.1\|3681259_3682246_-	AAA family ATPase	NA	NA	NA	NA
WP_017684980.1\|3682242_3684255_-\|integrase	integrase	NA	NA	NA	NA
WP_017684979.1\|3684251_3684986_-	hypothetical protein	NA	NA	NA	NA
WP_136624442.1\|3685836_3687417_+	hypothetical protein	NA	NA	NA	NA
WP_017706217.1\|3688122_3688446_-	hypothetical protein	NA	NA	NA	NA
3688030:3688141	attR	NA	NA	NA	NA
WP_074556959.1\|3688452_3688758_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_017683608.1\|3689164_3690433_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.7e-29	30.1
WP_078983159.1\|3690460_3690670_+	hypothetical protein	NA	NA	NA	NA
WP_051120736.1\|3690687_3692220_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.2e-82	36.5
WP_017685159.1\|3692229_3693045_-	hypothetical protein	NA	NA	NA	NA
WP_032685473.1\|3693690_3694758_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017685146.1\|3694764_3695163_-	hypothetical protein	NA	NA	NA	NA
WP_074556923.1\|3696694_3697762_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_004666662.1\|3698141_3698519_+	hypothetical protein	NA	NA	NA	NA
WP_004666661.1\|3698679_3699075_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_003108276.1\|3699071_3699323_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_004666660.1\|3699502_3700075_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.6e-46	54.9
WP_017682807.1\|3700103_3703133_+\|transposase	Tn3-like element ISPsy42 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

3987191 : 4044312

uncultured_Caudovirales_phage(50.0%)

integrase,transposase

attL 3988603:3988662|attR 4042468:4044134

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017703617.1\|3987191_3988547_+\|transposase	IS4-like element ISPsy33 family transposase	NA	NA	NA	NA
3988603:3988662	attL	NA	NA	NA	NA
WP_085991147.1\|3988651_3990230_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_003382406.1\|3990271_3990607_-	hypothetical protein	NA	NA	NA	NA
WP_074291368.1\|3990925_3991120_+	hypothetical protein	NA	NA	NA	NA
WP_017684164.1\|3991143_3992169_-	nucleoside hydrolase	NA	NA	NA	NA
WP_017684165.1\|3992208_3992613_-	D-ribose pyranase	NA	NA	NA	NA
WP_017684166.1\|3992609_3993530_-	ribokinase	NA	NA	NA	NA
WP_003382414.1\|3993560_3994577_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	8.4e-37	33.3
WP_003382415.1\|3994578_3995571_-	ABC transporter permease	NA	NA	NA	NA
WP_003382416.1\|3995567_3997121_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-12	28.1
WP_003382417.1\|3997174_3998134_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017684167.1\|3998317_3998542_-	YgdI/YgdR family lipoprotein	NA	NA	NA	NA
WP_005765646.1\|3998678_3998930_+	DUF1654 domain-containing protein	A0A2H4J8G7	uncultured_Caudovirales_phage	6.4e-15	53.2
WP_003382421.1\|3998934_3999636_+	deoxyribonuclease	NA	NA	NA	NA
WP_005738818.1\|3999841_4000081_+	hypothetical protein	NA	NA	NA	NA
WP_003382423.1\|4000157_4000949_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003382424.1\|4000945_4001203_-	ParD-like family protein	NA	NA	NA	NA
WP_077528300.1\|4001288_4001558_-	hypothetical protein	NA	NA	NA	NA
WP_003382426.1\|4001587_4002619_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_003382427.1\|4002850_4003879_+	FecR family protein	NA	NA	NA	NA
WP_005617465.1\|4004081_4004471_+	hypothetical protein	NA	NA	NA	NA
WP_003382429.1\|4004502_4004691_-	hypothetical protein	NA	NA	NA	NA
WP_017684169.1\|4004935_4006744_+	potassium transporter	NA	NA	NA	NA
WP_003382433.1\|4006791_4007718_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003382434.1\|4007807_4009019_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_003382436.1\|4009025_4009565_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
WP_017683931.1\|4009640_4010246_+	molybdenum cofactor guanylyltransferase MobA	NA	NA	NA	NA
WP_003382439.1\|4010319_4010544_+	YgdI/YgdR family lipoprotein	NA	NA	NA	NA
WP_003382440.1\|4010621_4011512_-	pseudouridine synthase	NA	NA	NA	NA
WP_003382441.1\|4011698_4012553_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_003382442.1\|4012556_4013228_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_017683930.1\|4013332_4015240_-	TIM barrel protein	NA	NA	NA	NA
WP_003382444.1\|4015857_4017177_+	MFS transporter	NA	NA	NA	NA
WP_003382445.1\|4017243_4018131_-	DMT family transporter	NA	NA	NA	NA
WP_017683929.1\|4018353_4019610_+	OprD family porin	NA	NA	NA	NA
WP_005737978.1\|4019803_4020202_-	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_017683928.1\|4020198_4021560_-	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
WP_003373352.1\|4021584_4022934_-	MFS transporter	NA	NA	NA	NA
WP_003373350.1\|4023001_4023604_-	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_003373348.1\|4023615_4024335_-	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_003373346.1\|4024462_4025392_-	pca operon transcription factor PcaQ	NA	NA	NA	NA
WP_074291369.1\|4025431_4025722_-	glutaredoxin family protein	NA	NA	NA	NA
WP_017683927.1\|4025752_4026823_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	4.6e-17	28.0
WP_003373339.1\|4027085_4027400_+	DUF883 domain-containing protein	NA	NA	NA	NA
WP_003373338.1\|4027404_4027797_+	membrane protein	NA	NA	NA	NA
WP_003373333.1\|4028317_4029649_+	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_003373331.1\|4029900_4030293_+	response regulator	NA	NA	NA	NA
WP_074291370.1\|4030686_4031373_+	response regulator transcription factor	NA	NA	NA	NA
WP_074556928.1\|4031395_4032463_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017685144.1\|4032618_4032945_+	hypothetical protein	NA	NA	NA	NA
WP_017685145.1\|4033117_4034623_+	hypothetical protein	NA	NA	NA	NA
WP_017685136.1\|4034660_4035119_+	hypothetical protein	NA	NA	NA	NA
WP_017685137.1\|4035118_4035646_+	hypothetical protein	NA	NA	NA	NA
WP_017685138.1\|4035756_4036446_+	hypothetical protein	NA	NA	NA	NA
WP_017685139.1\|4036597_4037149_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_017685134.1\|4038982_4039336_-	hypothetical protein	NA	NA	NA	NA
WP_017685135.1\|4039626_4040292_-	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_085991147.1\|4040898_4042478_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_074556930.1\|4042905_4044312_+\|transposase	IS1182-like element ISPsy36 family transposase	NA	NA	NA	NA
4042468:4044134	attR	NA	NA	NA	NA

DBSCAN-SWA_15

4102430 : 4162786

Acidithiobacillus_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017682616.1\|4102430_4103690_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.7e-43	41.7
WP_074556883.1\|4103779_4104847_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_032685482.1\|4105443_4106958_+\|transposase	IS21-like element ISPsy40 family transposase	K4I413	Acidithiobacillus_phage	4.8e-145	52.8
WP_017683955.1\|4106978_4107734_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.6e-71	53.9
WP_017684081.1\|4109324_4113089_-	RHS repeat protein	B6SD27	Bacteriophage	2.2e-146	30.8
WP_003379801.1\|4113169_4113658_-	hypothetical protein	NA	NA	NA	NA
WP_110455605.1\|4116379_4116472_-	DUF1685 domain-containing protein	NA	NA	NA	NA
WP_020315811.1\|4116587_4118618_-	hypothetical protein	NA	NA	NA	NA
WP_078983229.1\|4118953_4120093_-	hypothetical protein	NA	NA	NA	NA
WP_017684083.1\|4123621_4128310_+	hypothetical protein	A0A1W5K0N1	Bacteriophage	3.0e-129	28.6
WP_078983187.1\|4128366_4129434_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017684409.1\|4130134_4130686_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_003379789.1\|4130793_4131549_+	molecular chaperone	NA	NA	NA	NA
WP_017684407.1\|4131587_4134101_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_017684406.1\|4134147_4135269_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_017684405.1\|4135306_4136812_-	hypothetical protein	NA	NA	NA	NA
WP_020359549.1\|4136989_4139314_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_017684403.1\|4139643_4140174_-	hypothetical protein	NA	NA	NA	NA
WP_017684402.1\|4140180_4141635_-	hypothetical protein	NA	NA	NA	NA
WP_003379782.1\|4141979_4142729_+	response regulator	W8CYM9	Bacillus_phage	1.0e-31	37.6
WP_017684401.1\|4142725_4143760_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.4e-07	20.4
WP_017684400.1\|4143875_4144514_+	hypothetical protein	NA	NA	NA	NA
WP_110455606.1\|4144823_4144973_-	DUF1534 domain-containing protein	NA	NA	NA	NA
WP_110455607.1\|4145163_4145286_-	DUF1534 domain-containing protein	NA	NA	NA	NA
WP_017684608.1\|4145823_4146873_-	AI-2E family transporter	NA	NA	NA	NA
WP_017684607.1\|4146964_4147807_-	DUF4892 domain-containing protein	NA	NA	NA	NA
WP_017684606.1\|4147934_4148789_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_017684605.1\|4148785_4149595_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003379767.1\|4149714_4150158_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_017684604.1\|4150220_4150676_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_017684603.1\|4150672_4151017_-	DUF4389 domain-containing protein	NA	NA	NA	NA
WP_017684602.1\|4151056_4152082_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_017684601.1\|4152402_4154328_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.2e-44	31.2
WP_003379759.1\|4154548_4155064_+	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA	NA	NA	NA	NA
WP_003379758.1\|4155074_4156298_+	beta-ketoacyl-ACP synthase I	NA	NA	NA	NA
WP_003379757.1\|4156559_4157288_-	dienelactone hydrolase family protein	NA	NA	NA	NA
WP_003379756.1\|4157378_4159286_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	6.5e-115	38.4
WP_005738079.1\|4159601_4159862_+	lipoprotein	NA	NA	NA	NA
WP_017703617.1\|4159912_4161268_-\|transposase	IS4-like element ISPsy33 family transposase	NA	NA	NA	NA
WP_051120742.1\|4161718_4162786_-\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

4588599 : 4621722

Pseudomonas_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099818608.1\|4588599_4590178_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685084.1\|4590808_4591729_+	recombination-associated protein RdgC	L7TP07	Pseudomonas_virus	9.4e-120	69.6
WP_017685083.1\|4591817_4592777_+	bile acid:sodium symporter family protein	NA	NA	NA	NA
WP_110455611.1\|4592776_4592902_+	DUF1534 domain-containing protein	NA	NA	NA	NA
WP_032685472.1\|4593282_4594650_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.4e-32	30.9
WP_003383327.1\|4595033_4596908_-	MFS transporter	NA	NA	NA	NA
WP_017684968.1\|4596973_4599139_-	DEAD/DEAH box helicase	A0A1B1IUI1	uncultured_Mediterranean_phage	4.9e-42	25.7
WP_085991147.1\|4599164_4600744_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685176.1\|4600750_4601182_-	hypothetical protein	NA	NA	NA	NA
WP_017685175.1\|4601325_4601799_-	hypothetical protein	NA	NA	NA	NA
WP_099818608.1\|4601924_4603504_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685192.1\|4603500_4604145_-	hypothetical protein	NA	NA	NA	NA
WP_085991147.1\|4604516_4606095_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685021.1\|4606116_4606845_-	hypothetical protein	NA	NA	NA	NA
WP_017685022.1\|4607733_4608291_-	hypothetical protein	NA	NA	NA	NA
WP_017685024.1\|4608699_4609362_-	hypothetical protein	NA	NA	NA	NA
WP_017685025.1\|4609467_4609665_-	hypothetical protein	NA	NA	NA	NA
WP_017699032.1\|4611142_4611898_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.9e-71	53.9
WP_017685052.1\|4614197_4614962_+	WYL domain-containing protein	NA	NA	NA	NA
WP_017685051.1\|4615061_4616165_-	hypothetical protein	NA	NA	NA	NA
WP_017685050.1\|4616164_4617193_-	hypothetical protein	NA	NA	NA	NA
WP_017703861.1\|4617317_4617923_-	hypothetical protein	NA	NA	NA	NA
WP_017685152.1\|4618086_4618392_-	hypothetical protein	NA	NA	NA	NA
WP_017705749.1\|4618492_4618825_-	sel1 repeat family protein	NA	NA	NA	NA
WP_074556923.1\|4619007_4620075_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_085991147.1\|4620142_4621722_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

4624775 : 4680719

uncultured_Caudovirales_phage(22.22%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074556923.1\|4624775_4625843_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_032685473.1\|4625947_4627015_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017684899.1\|4627594_4627900_-	hypothetical protein	NA	NA	NA	NA
WP_017707003.1\|4627896_4629072_-	EndoU domain-containing protein	I3NLA2	Bifidobacterium_phage	4.0e-06	38.2
WP_153275138.1\|4629256_4629520_-	hypothetical protein	NA	NA	NA	NA
WP_017684903.1\|4629593_4632599_-\|protease	autotransporter serine protease	NA	NA	NA	NA
WP_032685463.1\|4632944_4634012_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017684577.1\|4634836_4636402_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	2.3e-41	49.7
WP_017684576.1\|4636665_4637010_+	topoisomerase	NA	NA	NA	NA
WP_078983231.1\|4637054_4639208_-	peptigoglycan-binding protein LysM	NA	NA	NA	NA
WP_003381003.1\|4639346_4639781_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_017684574.1\|4639874_4642004_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	5.6e-83	34.1
WP_003381005.1\|4642180_4642768_+	YecA family protein	NA	NA	NA	NA
WP_003381007.1\|4642778_4643183_+	YbaN family protein	NA	NA	NA	NA
WP_003381009.1\|4643213_4644710_-	polyphosphate:AMP phosphotransferase	NA	NA	NA	NA
WP_017699444.1\|4644857_4646840_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_003381013.1\|4647006_4647675_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-30	36.6
WP_017683710.1\|4647674_4650158_+	ABC transporter permease	NA	NA	NA	NA
WP_074291373.1\|4650165_4651227_+	iron ABC transporter permease	NA	NA	NA	NA
WP_003381016.1\|4651272_4651749_-	hypothetical protein	NA	NA	NA	NA
WP_003381017.1\|4652021_4653794_+	N-acetylglutaminylglutamine amidotransferase	R4TIC1	Phaeocystis_globosa_virus	2.6e-33	29.6
WP_003381018.1\|4653797_4655546_+	N-acetylglutaminylglutamine synthetase	NA	NA	NA	NA
WP_005735209.1\|4655628_4656825_+	osmoprotectant NAGGN system M42 family peptidase	NA	NA	NA	NA
WP_004879420.1\|4656896_4657124_+	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	4.0e-32	89.3
WP_003381023.1\|4657126_4657321_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	3.9e-12	60.4
WP_003381025.1\|4657490_4657823_-	YnfA family protein	A0A2H4JF35	uncultured_Caudovirales_phage	3.4e-48	83.6
WP_003381027.1\|4658551_4659367_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_017683713.1\|4659471_4659849_-	DUF2784 domain-containing protein	NA	NA	NA	NA
WP_002552554.1\|4660173_4660332_+	DUF3309 domain-containing protein	NA	NA	NA	NA
WP_003381031.1\|4660462_4662121_-	cation acetate symporter	NA	NA	NA	NA
WP_002552552.1\|4662117_4662429_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_003381033.1\|4662676_4663531_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017683715.1\|4664807_4666106_+	serine protein kinase PrkA	NA	NA	NA	NA
WP_017683716.1\|4666098_4666911_+	VacJ family lipoprotein	NA	NA	NA	NA
WP_003381036.1\|4667045_4667645_+	hypothetical protein	NA	NA	NA	NA
WP_003381037.1\|4667671_4668580_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003381038.1\|4668689_4669907_+	MFS transporter	NA	NA	NA	NA
WP_017683717.1\|4670204_4671287_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.5e-15	31.2
WP_003381040.1\|4671291_4672164_-	hypothetical protein	NA	NA	NA	NA
WP_003381041.1\|4673112_4673832_-	hypothetical protein	NA	NA	NA	NA
WP_085991147.1\|4673926_4675506_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_074291571.1\|4675664_4675934_-	response regulator transcription factor	NA	NA	NA	NA
WP_003381045.1\|4676416_4677733_-	MFS transporter	NA	NA	NA	NA
WP_019331326.1\|4679288_4680719_-\|transposase	IS1182-like element ISPsy36 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

4817288 : 4882607

Pseudomonas_phage(28.57%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017683453.1\|4817288_4817759_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_004396504.1\|4818110_4818968_+	aquaporin	NA	NA	NA	NA
WP_004396510.1\|4818997_4820503_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_004396514.1\|4820613_4821369_+	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	1.8e-23	30.3
WP_017683452.1\|4821810_4823349_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_004396519.1\|4823704_4824619_+	glutamate/aspartate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017683451.1\|4824777_4825524_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_004396523.1\|4825523_4826189_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_005620053.1\|4826185_4826920_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-31	38.5
WP_017683450.1\|4826978_4828895_+	sensor histidine kinase	NA	NA	NA	NA
WP_017683449.1\|4828905_4830234_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_074291557.1\|4830240_4830426_+	hypothetical protein	NA	NA	NA	NA
WP_003373498.1\|4830742_4832110_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	8.4e-32	30.9
WP_019331326.1\|4832372_4833803_+\|transposase	IS1182-like element ISPsy36 family transposase	NA	NA	NA	NA
WP_153303622.1\|4833887_4834136_+	hypothetical protein	NA	NA	NA	NA
WP_017684572.1\|4834153_4834801_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_032610077.1\|4834854_4835847_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003378416.1\|4836032_4838333_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_003378418.1\|4838439_4839357_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003378420.1\|4839426_4839837_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003378421.1\|4839833_4840925_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_003378422.1\|4841076_4841358_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_003378427.1\|4842876_4843557_+	hypothetical protein	NA	NA	NA	NA
WP_096059770.1\|4843603_4843915_-	hypothetical protein	NA	NA	NA	NA
WP_017684569.1\|4844756_4845491_+	hypothetical protein	NA	NA	NA	NA
WP_085991147.1\|4845487_4847066_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_074556883.1\|4847335_4848403_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017685228.1\|4848870_4849236_+	hypothetical protein	NA	NA	NA	NA
WP_051120742.1\|4849292_4850360_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_019349275.1\|4850511_4851381_-	hypothetical protein	NA	NA	NA	NA
WP_017684796.1\|4851760_4854898_+	penicillin-binding protein	NA	NA	NA	NA
WP_003378435.1\|4854976_4855576_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003378437.1\|4855572_4856340_+	siderophore-interacting protein	NA	NA	NA	NA
WP_003378439.1\|4856361_4857021_-	hypothetical protein	NA	NA	NA	NA
WP_074291528.1\|4857091_4857460_-	DUF2132 domain-containing protein	NA	NA	NA	NA
WP_020365665.1\|4857763_4860157_+	pyrroloquinoline quinone-dependent dehydrogenase	NA	NA	NA	NA
WP_139302199.1\|4860375_4860588_-	hypothetical protein	NA	NA	NA	NA
WP_087674300.1\|4860731_4860977_+	hypothetical protein	NA	NA	NA	NA
WP_019331326.1\|4861201_4862632_+\|transposase	IS1182-like element ISPsy36 family transposase	NA	NA	NA	NA
WP_074291529.1\|4862797_4862941_+	hypothetical protein	NA	NA	NA	NA
WP_017684695.1\|4863030_4864227_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_017684696.1\|4864223_4865231_-	GTP-binding protein	NA	NA	NA	NA
WP_003378449.1\|4865227_4865527_-	hypothetical protein	NA	NA	NA	NA
WP_003378452.1\|4865549_4866299_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	5.5e-09	41.8
WP_017684697.1\|4866330_4867092_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.7e-16	30.3
WP_017684698.1\|4867102_4868443_-	MFS transporter	NA	NA	NA	NA
WP_003378455.1\|4868470_4869352_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_017684699.1\|4869433_4870807_-	amidase	NA	NA	NA	NA
WP_074291531.1\|4871145_4872147_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_032685472.1\|4873334_4874702_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.4e-32	30.9
WP_078983196.1\|4874898_4875042_+	hypothetical protein	NA	NA	NA	NA
WP_003378458.1\|4875080_4875503_-	group 1 truncated hemoglobin	NA	NA	NA	NA
WP_017683179.1\|4875502_4876378_-	DUF3034 family protein	NA	NA	NA	NA
WP_017683180.1\|4876381_4878736_-	EAL domain-containing protein	NA	NA	NA	NA
WP_017683181.1\|4878732_4879407_-	methylamine utilization protein	NA	NA	NA	NA
WP_017683182.1\|4879588_4882006_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.2e-135	38.1
WP_003378464.1\|4882214_4882607_+\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA

DBSCAN-SWA_19

5117575 : 5255263

114

Pseudomonas_phage(17.39%)

tRNA,integrase,protease,transposase

attL 5179817:5179831|attR 5258158:5258172

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017704595.1\|5117575_5118922_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_003377535.1\|5119029_5119551_+	ribosome-associated protein	NA	NA	NA	NA
WP_005739076.1\|5119599_5121039_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_003377533.1\|5121041_5121887_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_017682741.1\|5121935_5125751_-	TIGR02099 family protein	NA	NA	NA	NA
WP_003377531.1\|5125932_5127390_-	ribonuclease G	NA	NA	NA	NA
WP_017682742.1\|5127386_5127989_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003377527.1\|5128056_5128548_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_074291260.1\|5128540_5129668_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_002555108.1\|5129850_5130888_-	rod shape-determining protein	NA	NA	NA	NA
WP_002555109.1\|5131094_5131382_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_017682744.1\|5131396_5132848_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003377520.1\|5132858_5134322_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003382616.1\|5134739_5136071_+\|transposase	IS110-like element ISPsy35 family transposase	Q9JMN8	Wolbachia_phage	1.8e-95	43.6
WP_003377519.1\|5136283_5136652_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.3e-24	51.7
WP_017683574.1\|5136718_5137750_+	calcium/sodium antiporter	NA	NA	NA	NA
WP_017683573.1\|5137781_5138165_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_017683572.1\|5138151_5139102_-	AEC family transporter	NA	NA	NA	NA
WP_017683571.1\|5139206_5140799_-	alkaline phosphatase	NA	NA	NA	NA
WP_017683570.1\|5140947_5141964_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.0e-13	29.2
WP_017683569.1\|5142043_5145052_+	DUF748 domain-containing protein	NA	NA	NA	NA
WP_017683568.1\|5145044_5145386_+	DUF2845 domain-containing protein	NA	NA	NA	NA
WP_004656644.1\|5145540_5145894_-	BON domain-containing protein	NA	NA	NA	NA
WP_003377508.1\|5146183_5148289_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_002555121.1\|5148464_5148734_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_003377507.1\|5148892_5149810_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003377505.1\|5149813_5150230_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003377503.1\|5150389_5152915_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	5.5e-21	23.3
WP_005620402.1\|5152942_5154424_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_020315387.1\|5154483_5154942_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_005739096.1\|5155376_5155757_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_005739097.1\|5155761_5156517_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_003377494.1\|5156583_5157927_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_017683566.1\|5157943_5158795_-	dihydropteroate synthase	NA	NA	NA	NA
WP_017683565.1\|5158803_5160708_-\|protease	ATP-dependent zinc metalloprotease FtsH	I3UL75	Ostreococcus_lucimarinus_virus	2.6e-116	49.0
WP_005888982.1\|5160901_5161552_-	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
WP_003377487.1\|5161655_5161967_+	YhbY family RNA-binding protein	NA	NA	NA	NA
WP_005620412.1\|5162047_5162524_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_017683564.1\|5162520_5165742_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_007243710.1\|5165877_5167014_-	carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
WP_003377483.1\|5167230_5168034_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_003377482.1\|5168056_5169199_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.7e-23	35.5
WP_017683563.1\|5169524_5171444_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	9.0e-149	48.3
WP_003377479.1\|5171554_5172118_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_017683562.1\|5172387_5174061_+	DNA repair protein RecN	NA	NA	NA	NA
WP_002555142.1\|5174139_5174547_-	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_003377475.1\|5174645_5175167_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_085991147.1\|5176562_5178141_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_003377474.1\|5178343_5178658_-	RnfH family protein	NA	NA	NA	NA
WP_003377473.1\|5178650_5179085_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_007243715.1\|5179092_5180496_-	sodium-dependent transporter	NA	NA	NA	NA
5179817:5179831	attL	NA	NA	NA	NA
WP_003377471.1\|5180609_5181092_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.2e-25	42.1
WP_003377470.1\|5181384_5181669_+	hypothetical protein	NA	NA	NA	NA
WP_017699800.1\|5182383_5182860_+	hypothetical protein	NA	NA	NA	NA
WP_085991147.1\|5183396_5184975_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017685082.1\|5184996_5185521_-	LysE family translocator	NA	NA	NA	NA
WP_017685081.1\|5185981_5186485_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_085988124.1\|5186513_5186798_-	hypothetical protein	NA	NA	NA	NA
WP_074291576.1\|5186929_5187355_+	DUF1493 family protein	NA	NA	NA	NA
WP_078983197.1\|5187502_5187826_-	hypothetical protein	NA	NA	NA	NA
WP_051120749.1\|5187842_5189375_-\|transposase	IS66-like element ISPsy34 family transposase	S5VTD3	Leptospira_phage	2.6e-82	36.4
WP_078983159.1\|5189392_5189602_-	hypothetical protein	NA	NA	NA	NA
WP_017683608.1\|5189629_5190898_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.7e-29	30.1
WP_074291269.1\|5191304_5191610_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_017683594.1\|5191685_5192735_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.1e-79	45.3
WP_017683593.1\|5192731_5193637_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	5.9e-26	33.5
WP_005615131.1\|5193645_5194527_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.3e-98	60.1
WP_017683592.1\|5194792_5196700_+	hypothetical protein	NA	NA	NA	NA
WP_017683591.1\|5196775_5198698_-	hypothetical protein	NA	NA	NA	NA
WP_003382207.1\|5198726_5200028_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005615114.1\|5200058_5201093_-	flippase-like domain-containing protein	NA	NA	NA	NA
WP_003382214.1\|5201073_5201841_-	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_003382215.1\|5201850_5202813_-	glycosyltransferase family 2 protein	E7C9N8	Salmonella_phage	5.9e-40	32.8
WP_017683590.1\|5202839_5203655_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_003382217.1\|5203651_5204734_-	CDP-glucose 4,6-dehydratase	A0A0P0YMS6	Yellowstone_lake_phycodnavirus	5.3e-21	26.4
WP_017683589.1\|5204951_5207477_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_017683588.1\|5207476_5209024_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_005736595.1\|5209020_5210238_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.3e-15	27.2
WP_005615100.1\|5210234_5211029_-	ABC transporter permease	NA	NA	NA	NA
WP_003382222.1\|5211561_5212593_+	GDP-mannose 4,6-dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	6.8e-103	54.7
WP_017683587.1\|5212592_5213489_+	NAD-dependent epimerase/dehydratase family protein	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	7.2e-16	26.6
WP_003382224.1\|5213603_5214716_+	glycosyltransferase	NA	NA	NA	NA
WP_020365677.1\|5214781_5216839_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_017683585.1\|5217181_5218303_+	molecular chaperone DnaJ	NA	NA	NA	NA
WP_017683584.1\|5218662_5219904_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAT5	uncultured_Caudovirales_phage	6.1e-74	39.5
WP_017683583.1\|5220175_5221021_+	hypothetical protein	NA	NA	NA	NA
WP_017683582.1\|5221111_5221393_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_017683581.1\|5221389_5221998_+	hypothetical protein	NA	NA	NA	NA
WP_017683579.1\|5222605_5222887_+	hypothetical protein	NA	NA	NA	NA
WP_005771372.1\|5222883_5223165_+	DUF3077 domain-containing protein	NA	NA	NA	NA
WP_017683578.1\|5223161_5226062_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	8.5e-58	31.8
WP_078983198.1\|5227053_5227251_+	hypothetical protein	NA	NA	NA	NA
WP_017683576.1\|5227837_5228410_+	hypothetical protein	NA	NA	NA	NA
WP_017684741.1\|5228789_5229623_+	hypothetical protein	NA	NA	NA	NA
WP_017684740.1\|5229836_5230736_+	hypothetical protein	NA	NA	NA	NA
WP_017684739.1\|5230732_5232418_+	hypothetical protein	NA	NA	NA	NA
WP_019334102.1\|5232521_5233487_+	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_017684737.1\|5233947_5235045_+	DUF1524 domain-containing protein	NA	NA	NA	NA
WP_017684736.1\|5235381_5235612_+	hypothetical protein	NA	NA	NA	NA
WP_017684735.1\|5235627_5236191_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0VMI6	Pseudomonas_phage	6.3e-18	38.8
WP_017684732.1\|5236873_5237317_+	transcriptional regulator	A0A1B0VMC9	Pseudomonas_phage	2.4e-65	82.8
WP_020360176.1\|5237466_5237682_+	hypothetical protein	NA	NA	NA	NA
WP_017684729.1\|5240451_5241390_-	DUF4880 domain-containing protein	NA	NA	NA	NA
WP_003382231.1\|5241393_5241903_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_017684728.1\|5242252_5243872_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-80	46.8
WP_074556939.1\|5244328_5245396_-\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017685061.1\|5246322_5246913_+	flavodoxin	NA	NA	NA	NA
WP_017685060.1\|5246937_5247930_+	aldo/keto reductase	NA	NA	NA	NA
WP_110455613.1\|5248124_5248457_+	cupin domain-containing protein	NA	NA	NA	NA
WP_017684104.1\|5250059_5250890_+	hypothetical protein	NA	NA	NA	NA
WP_074556941.1\|5250915_5252271_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_032685463.1\|5252511_5253579_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017683366.1\|5253500_5253974_-	hypothetical protein	NA	NA	NA	NA
WP_024533178.1\|5254252_5255263_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
5258158:5258172	attR	NA	NA	NA	NA

DBSCAN-SWA_20

5299571 : 5309758

Burkholderia_virus(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017683348.1\|5299571_5300648_-	DUF3396 domain-containing protein	E5E3X8	Burkholderia_phage	2.7e-62	37.8
WP_017683347.1\|5300694_5301771_-	DUF3396 domain-containing protein	E5E3X8	Burkholderia_phage	8.0e-62	37.5
WP_017683346.1\|5301817_5302894_-	DUF3396 domain-containing protein	Q8W6S0	Burkholderia_virus	5.5e-55	33.7
WP_003380323.1\|5302903_5303629_-	VRR-NUC domain-containing protein	A4JX24	Burkholderia_virus	4.7e-50	46.4
WP_003380322.1\|5303625_5304192_-	PAAR domain-containing protein	A4JX23	Burkholderia_virus	5.3e-25	39.2
WP_017698597.1\|5304191_5304593_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_017698598.1\|5304811_5306125_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.6e-19	46.1
WP_074291257.1\|5306354_5307596_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.3e-12	29.4
WP_005736665.1\|5307671_5308109_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017683342.1\|5308117_5309758_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-59	41.6

DBSCAN-SWA_21

6020200 : 6089895

Bacillus_virus(28.57%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085991147.1\|6020200_6021780_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_074291602.1\|6022165_6022366_+	hypothetical protein	NA	NA	NA	NA
WP_017684704.1\|6023430_6027465_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	3.9e-61	30.3
WP_017684705.1\|6027713_6028205_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017684706.1\|6028265_6029564_-	M20 family metallopeptidase	NA	NA	NA	NA
WP_017684707.1\|6029810_6030941_+	Fic family protein	A0A1V0E025	Clostridioides_phage	5.7e-10	29.5
WP_017684708.1\|6031004_6031355_+	NERD domain-containing protein	NA	NA	NA	NA
WP_085991147.1\|6031361_6032940_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_074291514.1\|6033211_6033496_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005763809.1\|6033844_6034921_+	FUSC family protein	NA	NA	NA	NA
WP_003383369.1\|6034932_6035394_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_017684672.1\|6035545_6037225_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017684673.1\|6037242_6038049_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_074291513.1\|6038276_6040616_+	pyrroloquinoline quinone biosynthesis protein PqqF	A0A2H4UVM3	Bodo_saltans_virus	3.7e-19	24.9
WP_003422658.1\|6040751_6040826_+	pyrroloquinoline quinone precursor peptide PqqA	NA	NA	NA	NA
WP_017684675.1\|6040923_6041835_+	pyrroloquinoline quinone biosynthesis protein PqqB	NA	NA	NA	NA
WP_003383364.1\|6041843_6042599_+	pyrroloquinoline-quinone synthase PqqC	NA	NA	NA	NA
WP_003383363.1\|6042595_6042892_+	pyrroloquinoline quinone biosynthesis peptide chaperone PqqD	NA	NA	NA	NA
WP_017684676.1\|6042884_6044054_+	pyrroloquinoline quinone biosynthesis protein PqqE	NA	NA	NA	NA
WP_002555565.1\|6045889_6046051_-	YqaE/Pmp3 family membrane protein	NA	NA	NA	NA
WP_076611254.1\|6046337_6047693_+\|transposase	IS4-like element ISPsy33 family transposase	NA	NA	NA	NA
WP_017685056.1\|6047907_6049686_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_017699234.1\|6049855_6051154_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_003382341.1\|6051474_6053280_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003382340.1\|6053639_6053936_-	hypothetical protein	NA	NA	NA	NA
WP_003382339.1\|6054090_6054771_-	dethiobiotin synthase	NA	NA	NA	NA
WP_003382338.1\|6054801_6055611_-	malonyl-ACP O-methyltransferase BioC	NA	NA	NA	NA
WP_003382337.1\|6055603_6056335_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_003382336.1\|6056327_6057518_-	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
WP_005614022.1\|6057581_6058640_-	biotin synthase BioB	NA	NA	NA	NA
WP_003382333.1\|6058730_6059465_+	ComF family protein	NA	NA	NA	NA
WP_017683218.1\|6059779_6060544_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003379975.1\|6060625_6062542_+	PhoX family phosphatase	NA	NA	NA	NA
WP_017683216.1\|6062685_6063519_-	phosphodiesterase	NA	NA	NA	NA
WP_017683215.1\|6063543_6064575_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.4e-28	35.0
WP_017683214.1\|6064571_6065366_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_020314017.1\|6065362_6066232_-	ABC transporter permease	NA	NA	NA	NA
WP_003379970.1\|6066231_6067233_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_003379969.1\|6067216_6068236_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017683212.1\|6068431_6069406_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_003379965.1\|6069531_6070419_+	EamA family transporter RarD	NA	NA	NA	NA
WP_074291322.1\|6070730_6071081_+	Fis family transcriptional regulator	NA	NA	NA	NA
WP_003379961.1\|6071100_6071619_-	glycine cleavage system protein R	NA	NA	NA	NA
WP_017683209.1\|6071941_6074119_+	malate synthase G	NA	NA	NA	NA
WP_017706431.1\|6074848_6078616_+	hypothetical protein	NA	NA	NA	NA
WP_003379952.1\|6078661_6079108_-	response regulator	A0A220YL79	Alteromonas_virus	1.7e-05	29.6
WP_003379950.1\|6079337_6081272_+	CBS domain-containing protein	NA	NA	NA	NA
WP_017683206.1\|6081268_6081982_+	3'-5' exonuclease	NA	NA	NA	NA
WP_003379947.1\|6082269_6082572_-	cell division protein ZapA	NA	NA	NA	NA
WP_003379946.1\|6082568_6082802_-	hypothetical protein	NA	NA	NA	NA
WP_077142707.1\|6082932_6083127_+	hypothetical protein	NA	NA	NA	NA
WP_017683204.1\|6083223_6084849_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-73	46.2
WP_003379943.1\|6084986_6086090_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_017683203.1\|6086402_6086657_+	hypothetical protein	NA	NA	NA	NA
WP_003379932.1\|6086859_6087807_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003379931.1\|6087874_6088720_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_003379929.1\|6088716_6089895_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.5e-25	36.6

DBSCAN-SWA_22

6392017 : 6521844

Acidithiobacillus_phage(18.75%)

integrase,protease,transposase

attL 6457730:6457745|attR 6520010:6520126

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003378317.1\|6392017_6393088_-\|protease	protease modulator HflK	NA	NA	NA	NA
WP_017682560.1\|6393084_6394122_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_017682559.1\|6394133_6396080_-\|protease	protease modulator HflK	NA	NA	NA	NA
WP_003378312.1\|6396422_6397040_+	CDP-alcohol phosphatidyltransferase family protein	NA	NA	NA	NA
WP_017682558.1\|6397072_6398830_+	bifunctional alpha/beta hydrolase/class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_017682557.1\|6398826_6400182_+	phosphatase PAP2/dual specificity phosphatase family protein	NA	NA	NA	NA
WP_003378309.1\|6400205_6400661_+	hypothetical protein	NA	NA	NA	NA
WP_003378308.1\|6400669_6401290_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_005621962.1\|6401289_6402219_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_005768286.1\|6402617_6404237_+	glucan biosynthesis protein D	NA	NA	NA	NA
WP_003378304.1\|6404540_6405839_+	hypothetical protein	NA	NA	NA	NA
WP_003378302.1\|6405840_6407148_+	hypothetical protein	NA	NA	NA	NA
WP_017682555.1\|6407207_6409094_+	acyltransferase	A0A193GZ69	Enterobacter_phage	2.1e-73	47.3
WP_003378296.1\|6409976_6410615_-	response regulator transcription factor	NA	NA	NA	NA
WP_003378294.1\|6410614_6411682_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_003378292.1\|6411731_6413036_-	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-27	33.6
WP_017682552.1\|6413067_6414822_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_074291195.1\|6415226_6417032_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.0e-20	33.9
WP_085991147.1\|6417077_6418657_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_153303631.1\|6418740_6418959_+	hypothetical protein	NA	NA	NA	NA
WP_017683946.1\|6418998_6421029_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.4e-37	32.7
WP_003378280.1\|6421448_6421673_-	hypothetical protein	NA	NA	NA	NA
WP_074291439.1\|6421983_6422652_-	adenylyl-sulfate kinase	NA	NA	NA	NA
WP_003378274.1\|6422843_6424295_+	iron-containing redox enzyme family protein	NA	NA	NA	NA
WP_017683948.1\|6424291_6425266_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_074291441.1\|6425570_6427523_+	TonB-dependent receptor	NA	NA	NA	NA
WP_003378268.1\|6427522_6428302_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-15	32.1
WP_017683949.1\|6428302_6429253_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003378266.1\|6429249_6430290_+	iron ABC transporter permease	NA	NA	NA	NA
WP_003378263.1\|6430323_6430887_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003378261.1\|6431038_6431740_+	glutathione S-transferase	NA	NA	NA	NA
WP_074291440.1\|6432104_6432557_+	type III secretion system chaperone	NA	NA	NA	NA
WP_003378257.1\|6432553_6433777_+	avirulence protein	NA	NA	NA	NA
WP_153275132.1\|6434048_6434333_+	hypothetical protein	NA	NA	NA	NA
WP_017683952.1\|6434405_6435635_+	MFS transporter	NA	NA	NA	NA
WP_017683953.1\|6437060_6437258_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_020313868.1\|6438026_6439463_-	Hsp70 family protein	NA	NA	NA	NA
WP_017683954.1\|6440012_6440258_-	hypothetical protein	NA	NA	NA	NA
WP_017683955.1\|6441131_6441887_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.6e-71	53.9
WP_017704020.1\|6441907_6443422_-\|transposase	IS21-like element ISPsy40 family transposase	K4I413	Acidithiobacillus_phage	1.4e-144	52.6
WP_017699032.1\|6444088_6444844_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	3.9e-71	53.9
WP_017684504.1\|6445199_6445979_-	NAD-dependent protein deacylase	H6W7Z8	Escherichia_phage	1.2e-14	33.2
WP_020313867.1\|6445975_6446251_-	hypothetical protein	NA	NA	NA	NA
WP_136624465.1\|6446703_6448407_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_017684505.1\|6448431_6457266_+	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_133306363.1\|6457275_6457686_+	hypothetical protein	NA	NA	NA	NA
6457730:6457745	attL	NA	NA	NA	NA
WP_110455622.1\|6457822_6457942_+	hypothetical protein	NA	NA	NA	NA
6457730:6457745	attL	NA	NA	NA	NA
WP_011168788.1\|6458389_6459598_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_017684506.1\|6459622_6461155_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_017684507.1\|6461132_6463433_+	hypothetical protein	NA	NA	NA	NA
WP_085991147.1\|6463596_6465175_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017683874.1\|6465229_6465616_+	hypothetical protein	NA	NA	NA	NA
WP_020313862.1\|6465720_6465996_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017683872.1\|6466126_6466570_+	hypothetical protein	NA	NA	NA	NA
WP_017683871.1\|6466702_6466897_+	hypothetical protein	NA	NA	NA	NA
WP_017683869.1\|6467593_6472915_-	hypothetical protein	NA	NA	NA	NA
WP_017683868.1\|6473166_6475662_-	AAA family ATPase	NA	NA	NA	NA
6473487:6473502	attR	NA	NA	NA	NA
WP_017710627.1\|6475959_6476940_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	2.3e-92	54.9
6473487:6473502	attR	NA	NA	NA	NA
WP_017683865.1\|6477398_6479600_-	hypothetical protein	NA	NA	NA	NA
WP_017683864.1\|6479599_6480763_-	hypothetical protein	NA	NA	NA	NA
WP_017699490.1\|6480759_6481197_-	nucleoside triphosphate pyrophosphohydrolase family protein	B2ZXX5	Ralstonia_phage	8.1e-13	32.7
WP_017683862.1\|6481529_6483332_-	ATP-dependent helicase	NA	NA	NA	NA
WP_017683861.1\|6483375_6485280_-	AAA family ATPase	NA	NA	NA	NA
WP_017699491.1\|6485625_6486567_+	HNH endonuclease	NA	NA	NA	NA
WP_017683859.1\|6486586_6486919_+\|transposase	transposase	NA	NA	NA	NA
WP_017683858.1\|6486915_6487251_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_017683857.1\|6487312_6488839_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.2e-125	48.3
WP_017683856.1\|6488880_6489444_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_099818608.1\|6489464_6491044_-\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017684656.1\|6491457_6492225_-	TatD family hydrolase	NA	NA	NA	NA
WP_017684655.1\|6492221_6493598_-	hypothetical protein	NA	NA	NA	NA
WP_017684654.1\|6493594_6494140_-	hypothetical protein	NA	NA	NA	NA
WP_017684653.1\|6494466_6496416_-	NTPase KAP	NA	NA	NA	NA
WP_017684652.1\|6497403_6498678_+	hypothetical protein	NA	NA	NA	NA
WP_017684651.1\|6499332_6500442_-	hypothetical protein	NA	NA	NA	NA
WP_074291269.1\|6501695_6502001_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_085991147.1\|6502729_6504308_+\|transposase	IS3-like element ISPsy31 family transposase	NA	NA	NA	NA
WP_017684967.1\|6504768_6505434_-	hypothetical protein	NA	NA	NA	NA
WP_017684966.1\|6506784_6507180_-	hypothetical protein	NA	NA	NA	NA
WP_017684965.1\|6507692_6509642_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.1e-11	30.1
WP_010207371.1\|6510137_6510323_+	Com family DNA-binding transcriptional regulator	B5TK59	Pseudomonas_phage	4.4e-13	87.2
WP_017684964.1\|6510334_6511630_+	glycoside hydrolase family 68 protein	NA	NA	NA	NA
WP_003381762.1\|6511714_6512896_+	glycoside hydrolase family 10 protein	NA	NA	NA	NA
WP_032685473.1\|6513412_6514480_+\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA
WP_017685103.1\|6514978_6515212_+	hypothetical protein	NA	NA	NA	NA
WP_017685104.1\|6515255_6516392_+	hypothetical protein	NA	NA	NA	NA
WP_017685105.1\|6516388_6516799_+	hypothetical protein	NA	NA	NA	NA
WP_032685468.1\|6516818_6518351_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.4e-82	36.5
WP_074556891.1\|6518368_6518515_-\|transposase	transposase	NA	NA	NA	NA
WP_017683608.1\|6518596_6519865_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.7e-29	30.1
WP_074291269.1\|6520271_6520577_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_032685473.1\|6520776_6521844_-\|transposase	IS630-like element ISPsy32 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019730

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection