CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019722	Lactiplantibacillus plantarum strain CLP0611 chromosome, complete genome	3 crisprs	csa3,cas9,cas1,cas2,csn2,DinG,cas3,DEDDh,RT	0	3	6	0
NZ_CP019723	Lactiplantibacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence	1 crisprs	csa3	0	1	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019722_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019722_1

114992-115687

TypeII

Consensus_repeat	Method
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRT

10 spacers

csn2,cas2,cas1,cas9,csa3

The CRISPR arrays of NZ_CP019722_1

>merge|NZ_CP019722|1|114992-115687|PILER-CR,CRISPRCasFinder,CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACCAACAGACTCCTGCTGGGGTTGCCTCAGTTGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTCGAATTAATGCTGACGCCCAGTTATTGATGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAAACGTCTTTAGCGTAGTCATTCATTGGCTGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAAACACCGTTAACGGTCTTACCGTGTCGATGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACACGTCGGCGAAATCTTCACCACGCCGATTAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTTGATGACTCTTCTGGGGCACCAACAAGTTGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTATTGAGTGCAGCGTTGTTTGCGAGCGTCCGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGTACAGTGTCGCTCAACGTCTATCACTCCCGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGGTATGGAGTACAACAAGGAACAAGACACGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGATGCTGAGGAAACGAAGCATAGAACGTTTGTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

>NZ_CP019722|1|1|114992-115621|PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CAACAGACTCCTGCTGGGGTTGCCTCAGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCGAATTAATGCTGACGCCCAGTTATTGAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACGTCTTTAGCGTAGTCATTCATTGGCT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACACCGTTAACGGTCTTACCGTGTCGAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ACGTCGGCGAAATCTTCACCACGCCGATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGATGACTCTTCTGGGGCACCAACAAGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TATTGAGTGCAGCGTTGTTTGCGAGCGTCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GTACAGTGTCGCTCAACGTCTATCACTCCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>NZ_CP019722|1|1|114992-115621|CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CAACAGACTCCTGCTGGGGTTGCCTCAGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCGAATTAATGCTGACGCCCAGTTATTGAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACGTCTTTAGCGTAGTCATTCATTGGCT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACACCGTTAACGGTCTTACCGTGTCGAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ACGTCGGCGAAATCTTCACCACGCCGATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGATGACTCTTCTGGGGCACCAACAAGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TATTGAGTGCAGCGTTGTTTGCGAGCGTCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GTACAGTGTCGCTCAACGTCTATCACTCCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>NZ_CP019722|1|1|114992-115687|CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CAACAGACTCCTGCTGGGGTTGCCTCAGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TCGAATTAATGCTGACGCCCAGTTATTGAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACGTCTTTAGCGTAGTCATTCATTGGCT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACACCGTTAACGGTCTTACCGTGTCGAT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ACGTCGGCGAAATCTTCACCACGCCGATTA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGATGACTCTTCTGGGGCACCAACAAGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TATTGAGTGCAGCGTTGTTTGCGAGCGTCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GTACAGTGTCGCTCAACGTCTATCACTCCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATGCTGAGGAAACGAAGCATAGAACGTTT
GTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019722.1\|WP_003643663.1\|122804_124037_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP019722.1\|WP_003641725.1\|105548_106913_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP019722.1\|WP_027821584.1\|119835_120438_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP019722.1\|WP_027821588.1\|108833_112910_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP019722.1\|WP_003641722.1\|102153_102894_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP019722.1\|WP_015379640.1\|113987_114293_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP019722.1\|WP_011100898.1\|121169_121592_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP019722.1\|WP_027821591.1\|103137_104730_+\|HIRAN-domain-containing-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP019722.1\|WP_071542797.1\|122131_122416_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP019722.1\|WP_003641730.1\|119575_119770_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP019722.1\|WP_079111761.1\|107030_107738_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_027821589.1\|107762_108545_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP019722.1\|WP_027821585.1\|115751_118490_-\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP019722.1\|WP_011100895.1\|118774_119533_+\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP019722.1\|WP_011100897.1\|120550_121024_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP019722.1\|WP_027821583.1\|121679_122135_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP019722.1\|WP_003641724.1\|104845_105316_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP019722.1\|WP_015379645.1\|124127_124427_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP019722.1\|WP_027821586.1\|114289_114967_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP019722.1\|WP_027821587.1\|113104_114010_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851

Protein	Function_ID	Function_description	E-value
NZ_CP019722.1\|WP_003643663.1\|122804_124037_+\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
NZ_CP019722.1\|WP_003641725.1\|105548_106913_+\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP019722.1\|WP_027821584.1\|119835_120438_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	3.68426e-30
NZ_CP019722.1\|WP_027821588.1\|108833_112910_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.66373e-128
NZ_CP019722.1\|WP_003641722.1\|102153_102894_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
NZ_CP019722.1\|WP_015379640.1\|113987_114293_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
NZ_CP019722.1\|WP_011100898.1\|121169_121592_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.67238e-43
NZ_CP019722.1\|WP_027821591.1\|103137_104730_+\|HIRAN-domain-containing-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.86772e-17
NZ_CP019722.1\|WP_071542797.1\|122131_122416_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	6.75435e-19
NZ_CP019722.1\|WP_003641730.1\|119575_119770_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP019722.1\|WP_027821589.1\|107762_108545_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.18043e-25
NZ_CP019722.1\|WP_027821585.1\|115751_118490_-\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP019722.1\|WP_011100895.1\|118774_119533_+\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.05874e-91
NZ_CP019722.1\|WP_011100897.1\|120550_121024_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000255443
NZ_CP019722.1\|WP_027821583.1\|121679_122135_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	1.50722e-25
NZ_CP019722.1\|WP_003641724.1\|104845_105316_-\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
NZ_CP019722.1\|WP_015379645.1\|124127_124427_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.33489e-13
NZ_CP019722.1\|WP_027821586.1\|114289_114967_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.34637e-80
NZ_CP019722.1\|WP_027821587.1\|113104_114010_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.41428e-89

>NZ_CP019722.1|WP_027821586.1|114289_114967_+|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGVHFPTELMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP019722.1|WP_015379640.1|113987_114293_+|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP019722.1|WP_027821587.1|113104_114010_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGAQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NZ_CP019722.1|WP_027821588.1|108833_112910_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRIKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVSDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>NZ_CP019722.1|WP_027821589.1|107762_108545_+|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLKQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSVAFNKALLEFLATC
>NZ_CP019722.1|WP_079111761.1|107030_107738_+|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDLTVIAQNTLSKAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NZ_CP019722.1|WP_003641725.1|105548_106913_+|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP019722.1|WP_003641724.1|104845_105316_-|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP019722.1|WP_027821591.1|103137_104730_+|HIRAN-domain-containing-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVVISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NZ_CP019722.1|WP_003641722.1|102153_102894_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA
>NZ_CP019722.1|WP_027821585.1|115751_118490_-|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYTTDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTLALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>NZ_CP019722.1|WP_011100895.1|118774_119533_+|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLAAIELAVESLAAY
>NZ_CP019722.1|WP_003641730.1|119575_119770_-|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP019722.1|WP_027821584.1|119835_120438_-|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALLNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPESPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>NZ_CP019722.1|WP_011100897.1|120550_121024_+|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDATIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NZ_CP019722.1|WP_011100898.1|121169_121592_+|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAANKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP019722.1|WP_027821583.1|121679_122135_-|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSFLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>NZ_CP019722.1|WP_071542797.1|122131_122416_-|LytTR-family-transcriptional-regulator
MPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>NZ_CP019722.1|WP_003643663.1|122804_124037_+|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>NZ_CP019722.1|WP_015379645.1|124127_124427_+|winged-helix-turn-helix-transcriptional-regulator
MNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019722_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019722_2

1263919-1264050

Orphan

Consensus_repeat	Method
GCCGCCATAAATGCGCCTAGCGCGGTAAGTTCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019722_2

>merge|NZ_CP019722|2|1263919-1264050|CRISPRCasFinder
GCCGCCATAAATGCGCCTAGCGCGGTAAGTTCGGCAATATCGGTAGGCCCCACGGAAGTATTTGAGCCCACTGACCCAAGCTTAGCAGCGTCGGCGGCCGCCATAAATGCGCCTAGCGCGGTAAGTTTGGCA

>NZ_CP019722|2|2|1263919-1264050|CRISPRCasFinder
GCCGCCATAAATGCGCCTAGCGCGGTAAGTTCGGCA	ATATCGGTAGGCCCCACGGAAGTATTTGAGCCCACTGACCCAAGCTTAGCAGCGTCGGCG
GCCGCCATAAATGCGCCTAGCGCGGTAAGTTTGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019722.1\|WP_003644277.1\|1258244_1258982_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP019722.1\|WP_003640256.1\|1261957_1262281_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|227871
NZ_CP019722.1\|WP_003640266.1\|1273653_1274121_+\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NZ_CP019722.1\|WP_003640248.1\|1254933_1255638_-\|WxL-domain-containing-protein	unknown	unknown	gnl\|CDD\|372694
NZ_CP019722.1\|WP_003640251.1\|1257592_1258045_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP019722.1\|WP_003644279.1\|1261169_1261814_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP019722.1\|WP_027822064.1\|1271143_1272445_+\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NZ_CP019722.1\|WP_027822063.1\|1274117_1275524_+\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NZ_CP019722.1\|WP_003640254.1\|1260298_1261084_+\|phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|223584
NZ_CP019722.1\|WP_003640249.1\|1256111_1257008_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|235295
NZ_CP019722.1\|WP_003640260.1\|1267682_1267847_-\|FeoB-associated-Cys-rich-membrane-protein	unknown	unknown	gnl\|CDD\|378908
NZ_CP019722.1\|WP_003640261.1\|1267863_1269852_-\|ferrous-iron-transport-protein-B	unknown	unknown	gnl\|CDD\|223447
NZ_CP019722.1\|WP_013355484.1\|1262449_1263091_+\|DUF4479-and-tRNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|239196
NZ_CP019722.1\|WP_003640262.1\|1269853_1270078_-\|ferrous-iron-transport-protein-A	unknown	unknown	gnl\|CDD\|377199
NZ_CP019722.1\|WP_003640250.1\|1257240_1257582_-\|membrane-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_003645198.1\|1272428_1273667_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034
NZ_CP019722.1\|WP_003644278.1\|1258974_1260180_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|377581
NZ_CP019722.1\|WP_003640268.1\|1275817_1276156_+\|metal-sulfur-cluster-assembly-factor	unknown	unknown	gnl\|CDD\|225062
NZ_CP019722.1\|WP_003640263.1\|1270333_1271131_+\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP019722.1\|WP_003640259.1\|1266083_1267394_+\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757

Protein	Function_ID	Function_description	E-value
NZ_CP019722.1\|WP_003644277.1\|1258244_1258982_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.49866e-77
NZ_CP019722.1\|WP_003640256.1\|1261957_1262281_-\|PepSY-domain-containing-protein	gnl\|CDD\|227871	COG5584, COG5584, Predicted small secreted protein [Function unknown].	6.1475e-25
NZ_CP019722.1\|WP_003640266.1\|1273653_1274121_+\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	5.74127e-58
NZ_CP019722.1\|WP_003640248.1\|1254933_1255638_-\|WxL-domain-containing-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	8.86722e-29
NZ_CP019722.1\|WP_003640251.1\|1257592_1258045_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	1.9441e-49
NZ_CP019722.1\|WP_003644279.1\|1261169_1261814_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	2.55339e-80
NZ_CP019722.1\|WP_027822063.1\|1274117_1275524_+\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NZ_CP019722.1\|WP_003640254.1\|1260298_1261084_+\|phosphotransferase-family-protein	gnl\|CDD\|223584	COG0510, ycfN, Thiamine kinase and related kinases [Coenzyme transport and metabolism].	4.6935e-58
NZ_CP019722.1\|WP_003640249.1\|1256111_1257008_-\|peptidylprolyl-isomerase	gnl\|CDD\|235295	PRK04405, prsA, peptidylprolyl isomerase; Provisional.	1.81738e-136
NZ_CP019722.1\|WP_003640259.1\|1266083_1267394_+\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NZ_CP019722.1\|WP_003640261.1\|1267863_1269852_-\|ferrous-iron-transport-protein-B	gnl\|CDD\|223447	COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism].	0
NZ_CP019722.1\|WP_013355484.1\|1262449_1263091_+\|DUF4479-and-tRNA-binding-domain-containing-protein	gnl\|CDD\|239196	cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain. PheRS aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs belong structurally to class II aminoacyl tRNA synthetases (aaRSs) but, as they aminoacylate the 2'OH of the terminal ribose of tRNA they belong functionally to class 1 aaRSs. This domain has general tRNA binding properties and is believed to direct tRNAphe to the active site of the enzyme.	2.14071e-41
NZ_CP019722.1\|WP_003640262.1\|1269853_1270078_-\|ferrous-iron-transport-protein-A	gnl\|CDD\|377199	pfam04023, FeoA, FeoA domain. This family includes FeoA a small protein, probably involved in Fe2+ transport. This presumed short domain is also found at the C-terminus of a variety of metal dependent transcriptional regulators. This suggests that this domain may be metal-binding. In most cases this is likely to be either iron or manganese.	1.19062e-09
NZ_CP019722.1\|WP_027822064.1\|1271143_1272445_+\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	1.31314e-104
NZ_CP019722.1\|WP_003645198.1\|1272428_1273667_+\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NZ_CP019722.1\|WP_003644278.1\|1258974_1260180_+\|ABC-transporter-permease	gnl\|CDD\|377581	pfam05975, EcsB, Bacterial ABC transporter protein EcsB. This family consists of several bacterial ABC transporter proteins which are homologous to the EcsB protein of Bacillus subtilis. EcsB is thought to encode a hydrophobic protein with six membrane-spanning helices in a pattern found in other hydrophobic components of ABC transporters.	6.72459e-118
NZ_CP019722.1\|WP_003640268.1\|1275817_1276156_+\|metal-sulfur-cluster-assembly-factor	gnl\|CDD\|225062	COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only].	1.65967e-37
NZ_CP019722.1\|WP_003640263.1\|1270333_1271131_+\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.55343e-140
NZ_CP019722.1\|WP_003640260.1\|1267682_1267847_-\|FeoB-associated-Cys-rich-membrane-protein	gnl\|CDD\|378908	pfam12669, P12, Virus attachment protein p12 family. This family of proteins are related to Virus attachment protein p12 from the African swine fever virus. The family appears to contain an N-terminal signal peptide followed by a short cysteine rich region. The cysteine rich region is extremely variable and it is possible that only the N-terminal region is homologous.	0.000463781

>NZ_CP019722.1|WP_013355484.1|1262449_1263091_+|DUF4479-and-tRNA-binding-domain-containing-protein
MLITSYNPSELGDTLITILRPDAATQTIETHANVTRISDADSGETLGYNFFDVSKTLGDLDANGQVHLTAEQVEQLNNLLKTNDFEPELVLDTDPKFVVGYVESAEAHPKSDHLQITKTNVGLDQPLQIVSGSPNMQADILVVVAKVGAMMPSGLIIWPGELRGVESDGMIVSGRELQLPNAPQRPGALILPADYQPVGAPFDFKRAQTLFTA
>NZ_CP019722.1|WP_003640256.1|1261957_1262281_-|PepSY-domain-containing-protein
MNKQLQYGGLLAVGMAGIAGGFSVGGLFKRLRRPTPNQILSQVKRAFLKEAPIEGSWIEMKKSPLQKFALRTDVYYGGITRYEDGQLVQYEFLADANTGSILDIYRL
>NZ_CP019722.1|WP_003644279.1|1261169_1261814_+|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MRVRNKPWAPKLIAAHPELITEDPTQLKGRWQSRFAKPQPLQIEVGSGKGQFIIEMAKRHPEINYVAIEIQTSVIAIILKKLVEAPLPNLQLAHADGQAVTAFFEPHEVDRLYLNFSDPWPKSRHEKRRLTYKSFLSSYREVLKPNGQIEFKTDNRGLFEFSLTSMNNFGMQFEQVWLDLHAVATPEDNVETEYEQKFSAAGPIYKIIATFPAK
>NZ_CP019722.1|WP_003640254.1|1260298_1261084_+|phosphotransferase-family-protein
MDFELDDGWDVYPIYGNTNKAFMGKKNHQRLFLKRNASPFLAALSMEEITPRLIWTKRISSGDTLTAQEWLNGQTLTKQQMRLPEVAHLLARVHNSELLHRMLRKVGGQSVRPQDFIQQYLQDLPDDLRHHPLMARVLDELRGTAPTLPATDYRVCHGDLNHKNWLLSDRQQLYLVDWDSARFADPASDISMLLCEYVPLSDWQQWLSEYGETMTTALRTRVVWYAKINLLLNIKDNYYRNQYHQMNHEIIFLEELSQYEV
>NZ_CP019722.1|WP_003644278.1|1258974_1260180_+|ABC-transporter-permease
MNELFQTRLQRHLRRMLRYLRLVFNDHFVIALMFFVGGLGLAYSNWLKTLGPQQTWIVWVLGLLLWAGLSVSHIATLLEPADTVFLLPRERDVHAYFVKAWRYSWWLAQAVQVIFVGLTVPLLMIVDQMTGWSLLALLITQLALKDAQLTLSVTHLYQVKPSMKRWLRPLNWAGAFVTLAVGLLVTPWLSAAMAIAIAVGQRYLHQRIWSTTVIAWRDDIKAEANRMLGIYRFFNLFTDVPMVQGSVKRRRYLDWLLRWLPKDQQHAFGYLYTRGMLRGTEFSGLVVRLTVIGAVLLYFSGHGWLAMALDALFIYLIGFQLLPFYKQYDNIVFTHIYPLATKQRLKNFQRLLRNVLSLTGLIFLVAFWLSNAPLAQVGILLIINVIEIYLLVTWYLKLRLA
>NZ_CP019722.1|WP_003644277.1|1258244_1258982_+|ABC-transporter-ATP-binding-protein
MTLAVQHLVGGYSQIPVLKDISFQVEPGELVGLIGLNGAGKSTTINHIIGLLTPMKGSIALNGVTLAQDPQSYKSQIAYIPETPILYEELTLKEHLEMTMLAYGLDQEQAWQRAHDLLKTFRLANKLDWFPANFSKGMKQKVMIVCAFITNAKLFIIDEPFLGLDPLAVHDLLALIATVKAQGAAVLMSTHVLDTAEKACDKFVLLHAGEVQTQGTFAEIKANYPDAGESLNDIYLSLTGVTRDE
>NZ_CP019722.1|WP_003640251.1|1257592_1258045_-|HIT-family-protein
MTAFEPKLDDDCIFCKIIKGDIPSYTVYEDDMVKAFLDISQGTPGHTLVVPKTHVADIFGYDRDLASIVFARIPEIARAIKATDENIIGMNIVNNNGAVAYQSVFHSHFHLIPRYSDKDDFRMIFKDNAKKYDETDYTRLQNAIKTELAN
>NZ_CP019722.1|WP_003640250.1|1257240_1257582_-|membrane-protein
MAKFIRNSLIGLGLSAATYMLINQKTPKALYTDIKSYVQDVLDAADNLQDAREEFSDAQSNLSVQMAHAAEVFDDIQTELDKFQFKIEPHVTIMKKRADHLQDTLDHLTKTTD
>NZ_CP019722.1|WP_003640249.1|1256111_1257008_-|peptidylprolyl-isomerase
MKKWLIALAGVLLTFTLAGCGSKTVASTSGGKITESQYYSSMKGTSSGKQVLQQMILNKVLEKDYGSKVSTKQVTKQYNTYKSQYGSSFSTVLSQNGLTTKTFKEQLRSNLLLKEAVKDKVKITDKALKKQWKSYEPKVTVQHILVAKSATADKVLDALKKDSSQANFTKLAKKYSTDTTTKNDGGKLSAFDNTNTSYSSKFLTAAFKLKNGEYTTSAVKTSNGYEIIRMIKNPGKGKMSDHTADLKKQIWDNDMSDSTVLQNVVSKVLKGGNVSIKDNDLKDILSSYLSTSSSSSSN
>NZ_CP019722.1|WP_003640248.1|1254933_1255638_-|WxL-domain-containing-protein
MKKTVLTATMLLSLLGMPAVMATADSTANTTTNLELTENTGPTIPVDPTNPANPQVPEDPDNPATGNTGALTLDVAPRTFDFGSVQTYAAEHTYKATTTTNGQQYLQVTDNRGTDEQGWTVTVEQDQDLTETSGSSPHVLTGTTIHVPAGIARNSLATDPTAVDTNLTTTAADVTNTSGAVTVFNTTATTGAGKGTSVKVWDPSDVTLTIPKNTAKPGAYSNTLTWTLTAATPS
>NZ_CP019722.1|WP_003640259.1|1266083_1267394_+|UDP-N-acetylmuramate--L-alanine-ligase
MDKATVYYFVGIKGSGMSSLALILHDKGYQVEGSDIEQYTFTQKGLAAAGIKMLPFSEDNIREGLTVIAGNSFTDDHPEIKKAREMGLPVYRYHEFLGKLMEGFTSIGVAGTHGKTSTTGLLSHVLSHIAPTSYLIGDGTGKGTPDARFFVFEADEYRRHFVAYHPDYAIMTNVDFDHPDYYKDLADVQSAFQQFGNQVKKGIFAWGDDESLRHLDVDTPIYYYGTNDRDDFQAVNIKRTTKGSSFEVKYHDESLGEFEIPLFGEHNVLNSTAVIAVSYFEKVNLDEIRRELLDFSGVKRRFSEHQVGDMVMIDDYAHHPSEIKATLDAARQKYPDKEILAVFQPHTFSRTKALMDGFAASLSKADHVFLTNIFSSAREKSGDVSSKDLAAKLPNGGEIITTDDMSALTAYHNAVAVFMGAGDIQKYEKIYEDQMK
>NZ_CP019722.1|WP_003640260.1|1267682_1267847_-|FeoB-associated-Cys-rich-membrane-protein
MALFVNFLIIALIIGAAGYQIYRVVKRAKKGKCAACDYDCEAKKMLNKAQKQQN
>NZ_CP019722.1|WP_003640261.1|1267863_1269852_-|ferrous-iron-transport-protein-B
MTTVALLGNPNTGKTTLFNELTDKYAYVGNWTGVTVEKKMGRIRHSEVEMVDLPGVYSLNPITKDEAVVTNYLLHNHPDLILNVTNASQLKRNLLLSIEVLEFGAPVIIALNMIDDLKRTGHYYDFDTLAEQLGCQIKATNARNKEGLHQLREDLLAGPHPAATPLKLNYPFMIEQAIRQASQQLIKKFDLTADFARWLTIQFINQNKPIRAYAKHMGLTPLTSQAAYYDAQKFDEQIFQTRLDFIEQTLASASQNLASTSHVEMTAKIDKWVTNPFLGLPVFVGIFYLMFKLSFDWVGTPLSDLLDSFVSGPLSTTVSHWLTMAGAIPVLRSLIVNGLIAGVGGVLVFIPQIFVLFACISILEDSGYMARAALVTDRLMQMIGLNGKAFIPLIIGFGCNVTGIMAARTIEQPKERLITTLISPFMSCSARLPIYSLFVAAFFPKNQALIVLSIYFLGIAVALGMAKFYQLIFNVDDSSVFIVELPQYHIPRADIIWRGTWDKGKGFIKKAGTIIFAGTVLIWLLSSFGTSGLVSDIDNSFAATLGKTLLPLFAPLGVTAWQVISALFTGILAKEVISSSMMVMFHSANQAGLIAMMGRFFTPLSAYAMLVFILLYVPCFATIGTIKSETGSTKWAVYAVCSSLVIAYTLAFVIYQVGQLFI
>NZ_CP019722.1|WP_003640262.1|1269853_1270078_-|ferrous-iron-transport-protein-A
MLSQSVTNTSQLHIQQFTGLDNQTVQRLHSLGLHVGSPLAVVRYYPFHGPVIVQIDQQRIGIRYTVFQTLIGGH
>NZ_CP019722.1|WP_003640263.1|1270333_1271131_+|Fe-S-cluster-assembly-ATPase-SufC
MATLEVKDLHVEVTDDEQKKSREILKGVNLSMKTGEIHAIMGPNGTGKSTLSQTIMGQPAYHVTQGDILLNGESIVNMPVDERARKGLFLGMQYPAEIQGVTNAEFLRAAMNARRPADDQISVMAFLKELDKNLALLNMSESMTERYLNEGFSGGEKKRNEILQLLMIKPSFALLDEIDSGLDIDALQVVSKGVNSMRGDNFGSLIITHYQRLLNYIVPDVVHVMMGGRIVKTGNADLAKTLEKEGYAGLRDDLNIDVKLVDDED
>NZ_CP019722.1|WP_027822064.1|1271143_1272445_+|Fe-S-cluster-assembly-protein-SufD
MEATADYETIKTTLAAAANEHGEPHWLVERRLAALDAMQGLAVPKADRFSIRDWPLTPTDQPLKFSRSDRTLATDVTAEAGHIQIVQVGQTTVTVNLPDELDDQGVILTDMFTAFREHPQLTEKHFMGKVVKTDEDRLTSYHTAFLNAGVFLYVPKGVIVKEPIEITTIQDSTRVQPLISHVLIVAEQDSHFAVTQHLTTKGDVDNIANCVVEILARADSEVHFSAFDELGANTTAYLNRRAAISRGAKVDWAIGMMNNGNTFGDFDSELIGEGAKSDAKVITVTTKAQDVCVNTRVTNRGKKTDGNIVQRGVIMEKSNLIFNGIGHIIHGASGAHAEQENRVLMMSDDAHGDANPILLIDENDVLAGHAASVGQIDQNQMYYLMSRGIDKPQAQRLVIRGFLSTVIGAIPSKTVRTRLTNTIERKLEDGIQF
>NZ_CP019722.1|WP_003645198.1|1272428_1273667_+|cysteine-desulfurase
MASNFETLRSDFPILNQQVNDERLVYLDNAATAQRPNQVVDALVHFYQHDNANVHRGVHTLAERATSQYEAARAKVQRFINAAKTDEIVFTKGTTDSLNLIASTYGEANIQAGDEIVISIMEHHSNLIPWQQLALRKHATLKYIELTATGELDMADAANKITDRTKIVSVTHASNVLGTVNPIKALARLAHQHGAVMIADGAQAAPHMPVDVQALDVDFYAFSGHKMLGPTGIGVLYGRENLLATMPPYQFGGEMIGFVHRDDSTWAELPWKFEAGTQNIAGAIGLGAAVDYLTQLGMDQVQQHEQQLVNYLLPKLIAMPGVTVYGPQDPQHHTGVIAFNIDGLHPHDAATALDMEGVAVRAGHHCAQPLMAALGLVATARASFYIYNTQADADQLLTSLQATKEFFEHGTV
>NZ_CP019722.1|WP_003640266.1|1273653_1274121_+|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MGLSKLSGLYREVILDHGDHPHHKNALPNATHAITLKNPTCGDVINLAIQLDAHDQIEDIGFTGEGCTISQASASMMTDAVMGKSKEQALAMAKTFSDMAIGKQHPQADMDALEDAAILSNIMQFPARIKCATLAWWALQRALLAENGNEEESEV
>NZ_CP019722.1|WP_027822063.1|1274117_1275524_+|Fe-S-cluster-assembly-protein-SufB
MSEVPDVVKNDRDYEYGFHDDVKPAYSTGRGLTEATVREISAAKHEPQWMLNYRLNAYHEYLKMPMPKFGPDLTKLDLKDMLYYQKMTDKKFRDWKEVPADLKRTFDRLGVPEAERKYLAGSSAQYESEVVYHNMRKDFEKLGIIFTDTDTALHDYPELFKKWFGKLVKPTDNKFAALNAAVWSGGSFIYVPKGVQTKTPIQSYFRLNAENSGQFERTLIIVEDGASVDYVEGCTAPNYSSDSLHAAVVEVNVEPNAYCRYTTIQNWSDNVYSLETKRAAAAENATMEWVDGNLGSKVTMKYPSVYLNGEGARGTMLSIAVASNGIHQDSGARMIHNAKNTSSSIVSKSIAKTGGATDYRGTVRFAKHSDGSKAHVECDTIIMDDQSSSNTIPYNEIDSANVAMEHEAKVSKISEEQLYYLMSRGISEAKATEMIIMGFVEPFTKQLPMEYAVELNRLISFEMEGSIG
>NZ_CP019722.1|WP_003640268.1|1275817_1276156_+|metal-sulfur-cluster-assembly-factor
MADELGEDKALSPVEDAVMKSLEQVIDPELGVDMVNLGLIYGVDVDDNGSCTVTMTLTTMGCPLGNLLASQINQAIMSVDGVKNCELDLVWEPAWGIDKMSRFAKVALGIHG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019722_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019722_3

1776113-1776414

Orphan

Consensus_repeat	Method
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP019722_3

>merge|NZ_CP019722|3|1776113-1776414|CRISPRCasFinder
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGCTGTAGAGTTGTTGCTTATCCCAGCACTAGCTTGGCTACCAACTGCCTGAGCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGCATTAGACTGGACGGCTATTTCTGAATTGGCGTAGTTGTAATTGCTATCTGCGGCTGATTTAGCGGCATTCGCTGTAGACTGTGCAATTAAAGCAGCGCTATCAGCATTTCCTGCTTGGCTAGCCGCATTATCAGCCGTATTTTGAGCATTGATAATCTT

>NZ_CP019722|3|3|1776113-1776414|CRISPRCasFinder
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	TGTAGAGTTGTTGCTTATCCCAGCACTAGCTTGGCTACCAACTGCCTGA
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	ATTAGACTGGACGGCTATTTCTGAATTGGCGTAGTTGTAATTGCTATCTGCGGCTGATTTAGCGGCATTCGCTGTAGACTGTGCAATTAAAGCAGCGCTATCAGCATTTCCT
GCTTGGCTAGCCGCATTATCAGCCGTATTTTGAGCATTGATAATCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019722.1\|WP_016058335.1\|1785936_1786128_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_063487082.1\|1772416_1773301_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_063722570.1\|1786124_1786508_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_003644508.1\|1767970_1769182_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP019722.1\|WP_063722568.1\|1787348_1787732_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_063722569.1\|1786709_1787348_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|309671
NZ_CP019722.1\|WP_079111803.1\|1778911_1780684_-\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NZ_CP019722.1\|WP_016058343.1\|1771228_1772401_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119377
NZ_CP019722.1\|WP_003645638.1\|1764939_1765731_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP019722.1\|WP_016058329.1\|1788504_1788843_-\|phage-gp6-like-head-tail-connector-protein	unknown	unknown	gnl\|CDD\|153446
NZ_CP019722.1\|WP_016058340.1\|1773449_1773704_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_016058344.1\|1770422_1770953_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227833
NZ_CP019722.1\|WP_063722567.1\|1787728_1788169_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_079111800.1\|1765749_1767492_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|227319
NZ_CP019722.1\|WP_079111804.1\|1780755_1785924_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|381605
NZ_CP019722.1\|WP_016058330.1\|1788158_1788521_-\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|273692
NZ_CP019722.1\|WP_016058341.1\|1773284_1773446_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019722.1\|WP_003644510.1\|1770965_1771229_-\|hemolysin-XhlA-family-protein	unknown	unknown	gnl\|CDD\|371241
NZ_CP019722.1\|WP_079111802.1\|1776478_1778848_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273743
NZ_CP019722.1\|WP_003644505.1\|1763774_1764959_-\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235

Protein	Function_ID	Function_description	E-value
NZ_CP019722.1\|WP_016058330.1\|1788158_1788521_-\|phage-head-closure-protein	gnl\|CDD\|273692	TIGR01563, hypothetical_protein_AGR_C_1752, phage head-tail adaptor, putative, SPP1 family. This family describes a small protein of about 100 amino acids found in bacteriophage and in bacterial prophage regions. Examples include gp9 of phage HK022 and gp16 of phage SPP1. This minor structural protein is suggested to be a head-tail adaptor protein (although the source of this annotation was not traced during construction of this model). [Mobile and extrachromosomal element functions, Prophage functions].	8.05503e-09
NZ_CP019722.1\|WP_003644508.1\|1767970_1769182_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	2.11917e-75
NZ_CP019722.1\|WP_063722569.1\|1786709_1787348_-\|phage-tail-protein	gnl\|CDD\|309671	pfam04630, Phage_TTP_1, Phage tail tube protein. This is a family of phage tail tube proteins from Myoviridae.	2.75406e-69
NZ_CP019722.1\|WP_079111803.1\|1778911_1780684_-\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	7.59108e-08
NZ_CP019722.1\|WP_016058343.1\|1771228_1772401_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119377	cd06415, GH25_Cpl1-like, Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.	1.45709e-63
NZ_CP019722.1\|WP_003645638.1\|1764939_1765731_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.25723e-96
NZ_CP019722.1\|WP_016058329.1\|1788504_1788843_-\|phage-gp6-like-head-tail-connector-protein	gnl\|CDD\|153446	cd08054, gp6, Head-Tail Connector Protein gp6 of Bacteriophage HK97 and similar proteins. The bacteriophage HK97 gp6 protein is critical in the assembly of the connector, a specialized structure that serves as an interface for head and tail attachment, as well as a point at which DNA exits the head during infection by the bacteriophage. It forms a dodecameric ring structure that comprises the middle ring of the connector, located between the portal protein (attached to the head) and the gp7 ring (attached to the tail). It is a component of the mature phage and the absence of HK97 gp6 results in defective head-tail joining and the absence of mature phage particles. Although the crystal structure of HK97 gp6 shows an unexpected 13-mer ring, the biological form present in the mature phage is believed to be a dodecamer.	1.24587e-20
NZ_CP019722.1\|WP_016058344.1\|1770422_1770953_-\|hypothetical-protein	gnl\|CDD\|227833	COG5546, COG5546, Small integral membrane protein [Function unknown].	0.000173645
NZ_CP019722.1\|WP_079111800.1\|1765749_1767492_-\|ABC-transporter-permease-subunit	gnl\|CDD\|227319	COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism].	2.82832e-89
NZ_CP019722.1\|WP_079111804.1\|1780755_1785924_-\|phage-tail-protein	gnl\|CDD\|381605	cd13402, LT_TF-like, lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	2.8995e-46
NZ_CP019722.1\|WP_003644510.1\|1770965_1771229_-\|hemolysin-XhlA-family-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	4.53032e-09
NZ_CP019722.1\|WP_079111802.1\|1776478_1778848_-\|phage-tail-protein	gnl\|CDD\|273743	TIGR01665, structural_protein, phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions].	3.99903e-13
NZ_CP019722.1\|WP_003644505.1\|1763774_1764959_-\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	8.65168e-43

>NZ_CP019722.1|WP_016058340.1|1773449_1773704_-|hypothetical-protein
MDSILITNYKPDYTNNIMTISVQINTLGISSQVSITMDEFNTAIAGGAGGIDSVKLKVLNTLIDSLTALKPVTTTTTTTTTQEA
>NZ_CP019722.1|WP_016058341.1|1773284_1773446_-|hypothetical-protein
MNIDAQALINKMTSNYAQAIAVKDQQLAMAQVQIDQLNAKLAEKEAPKDGEDA
>NZ_CP019722.1|WP_063487082.1|1772416_1773301_-|hypothetical-protein
MAKTLSFTDTSPQTVKIGDTTTSFTLICGNDNVATNLTNATSITVKLGNTSGYLKSAKVDPASLTDPTTGQVTVNFNADLMTSLTAGSYAIEVWVVDSTGTSIYPSDGTTGFTITNNIQSTNGTTITTITFDDFVAAMNKAASTIAKGDKGDKGDTGPQGVMTNDQVNTLIDNKIKYTSGNLDVTPAFYKAGTTSSTGALNYVRTGNKLHVSGVVSPSADLAIGSATTLFNLPSSIGIIAENVAVVQQSSGWNLYCLSWNPNGAVSVLKHNIAGTATAITTTTQLQVCADILIK
>NZ_CP019722.1|WP_016058343.1|1771228_1772401_-|LysM-peptidoglycan-binding-domain-containing-protein
MNKHKLKALILTVGAIFMAFLMVNVTSQASTSRDQGPDWSKYNGNSGTFGYSSDKFVFSQAGGFYGGTNIPQTTYNSQVKSAQQAGKRVHTYLWDGVGGNMTNAKAMMAYYLPRVRTPKGSIVALDYEDGASNSVTANTNVILAQMKLIKDAGYTPMLYSGKAYLNYHVNVSLILKAYGSCLWVPEYPDYLVRTSPDYNYFPSMDGVAIFQFTSMYKAGGLDGNVDLTGITKLGYTTASKKQAQTNVKQAQAAKKANFKVVKYNQRGVFYPNRTLAVRYTDSDKVSQVATYYKGESVTYNAVIIEHDYVWARYTRSNGLYAFIKLGVTNGHDYGKRVTGQLVSHTYYTVKSGDSWWTIAQRNGLSMTTLASQNGKSIYTTIYPGQRLVVR
>NZ_CP019722.1|WP_003644510.1|1770965_1771229_-|hemolysin-XhlA-family-protein
MAQYDDTTKLLMDIQKDVAATKTKVENIEEKLNQVDDIGDKADKALAKSIEASHQIDRVTTIQNWLIGVLVSGVLVTLVIYIAEKFL
>NZ_CP019722.1|WP_016058344.1|1770422_1770953_-|hypothetical-protein
MTKFLNVIQATLKANYKKPAYWAQIIGSVLIIGLAVATVFFGVKIDANAVVLVITAVGAILAFVGVITDNSILEDTGNTIKTKSSTLAYTEQTVVEALAEAQAKIEAANSAAASQAEAQASQAVVAAYSQAASAAAVGDTATASSAATLASSLAANLDTNAQPNAETTSESASQAS
>NZ_CP019722.1|WP_003644508.1|1767970_1769182_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MNNRELGRWQEHKHIGDYGWGIILCVIILCCIGMWAVYYACLHDLKVIDPVRTTMMQCLWYLVGALIATTMLHLSEKQLMQWAPIGYSIGMLLLILLLVFYSREYYVQTGAKSWFAIGTLTFQPVEVMKPLYILMMGRLIVQDQQWGPHNNFNADWRLTRRLVIYTFPIIVALKIINDFGTTLVFLTIFIGMLIVSPCRFSFLWRVLLVAGSIGVVLILLATSSTGQSLLSHIGFKLYQFDRINTWLNPSNGVSDQSYQLWQSMRAVGVGGLTGNGVTHNAVYVPVRESDMIFSVVGETTGFIGCSVLLIVYMYLFYLIFRSAFASRRRFYVYVSTGVAVMLAFHMFENIGMTIGLLPLTGIPLPFVSQGGSAIIGDFMGVGLVLATQYPNVRSIFSVPRIFH
>NZ_CP019722.1|WP_079111800.1|1765749_1767492_-|ABC-transporter-permease-subunit
MTSLKRGIKVRSVVGTMMWLGLSIGILLMIGWCIAKMNLPLSRLPTQGYLDTTGGKDYLTMSHLVAAALRTTTRLFIGMGYSILFSLIFGILAARYRSARYVILPIVNLLESVPLLGFLTFTTAWFMGLFPNNVLGVEAVAIFGVFTAQAWNIMLALYQSLRVTPEDLMTVAKQFGCNSWQRFWRLEFLYATPSILWNIVISQSAAWFALVACEQATIVVPKNETLVLPGIGSYIQIALDTANFGAVINAVIALVICVLLVNVFIFQPLIKGTAHYKYGTSTDSQLPQQSQVYDLMVMAKVPLLVKRLHRHIRYWWLYGAPMQWQKLGFSRIIRILKKYTVYWRIAWWLVIAVGLYRLGVLLIKYLDWINLSVLFKWTFLTTSRVLIAVLLSALIFIPLAVWVASNARRLKLIQPVGQVLGSIPADIYIPIVALMITLTGTTQHWWVIPLIMTGTQWYFFFNIIAGYLAIPSDIKDVVNIFHLSGWRWWTHFLIPSLFPSFITAIINAAGAAWNADIAAELISWGTHQYAVTGLGAYIAQNINNKPAEATGVLIICVIVGLCVVLIWQPLYRFAERRFHY
>NZ_CP019722.1|WP_003645638.1|1764939_1765731_-|ABC-transporter-ATP-binding-protein
MKKAVLLDVDHVSKSFILSKQRQSELILEAVSLQVQTHQFISIIGSSGVGKSTLLRMIAGIIRPSYGAITFDGNLVTAPNRRMSMVFQNFALFPWLTVRQNIMFGLESQLNSDCQYVDNQIDNLINLIGLKGLKNAYPYELSGGMKQRVGFARALAVEPELLLLDEPFSALDVLTGQRLGQDLITLWERRKFKMQAIVLITHNISEAVRLSDVIYVLGGKPAQIMNTYQIKTPRNQRTEQQIWAKTMAITDQFKRDMNEMRGD
>NZ_CP019722.1|WP_003644505.1|1763774_1764959_-|LCP-family-protein
MKCGGTEFMRRRQLPKWQRKRLIVLVTSCITFMLVAFTIQGIRLFDMLHSFHESRVIKSHHNLTQQPVSTFLLMGLDNSGKRKLSTTRTDGMMVVIVNHKTKTMTLCSLLRDTFVKIHSQQYHGYQRIESAYTYGGDAAAIATVEHYLNLPIDYYLTVNWDGFIRAIDDIGPVEVNVDRDFIGQDYWGKPEKFKAGLQSMSGARALAYARERHIDNDQHRGFRQQAVFYAMVKRLNQEGLSSKGAKVVGDLKDQMRTNLTNHDMLTLFKSRKTFKRYRVKRLTFQWRTFDVAGRSMVEVYPDSRVQVSRQLQAAAGLRPDLPSQTFTTNGHYRYASDESVESKADEAKADTHYGQSHVYVGHAGNTTIGKLPAAVPLKNGFRVSDRTETMYTVH
>NZ_CP019722.1|WP_079111802.1|1776478_1778848_-|phage-tail-protein
MALNNQYLILDSNLKRIGTLTVDGATKFSNDSVKIQLADADTTSTSYDDDVNIGTQDNFNGTINLNAQSKKFDHQGSLDVLQGQPDSDKVVAGNNLAYYDALSGHWYVMRIYSVEESNTAATKHVTTANFTNLCLYTLAHHYPVAITASDSSIQTAFNQCFNATGWTLDYQTTNVMTPTITIDGKTKASTLVQTLIQAYNVEIDPYVEIDSQGNITKKVCVITDKLNTDVVYNEAVFGKNMTSIKRTTVSTPVTKLIAYGDNGNTMSEVNDGKPYIVDDAANQKYNPDWQSGLYYEAVITANSIEDPSGIKAWAEEMLQLYNHPRTYYEVSVTSKFNPPLGATIRFKDELIKPALDASGRVIQRTISFSNPYGNTVGFGEYVTVPVATPAWMQGYQSAINSAIEKAREDASSVKPVALTPDGNNFTDTAQTKRLILQAWEGNTNISAYIDNKGFIWHRYNTDGTLDTSFNQTGYLVQAAYNSVGTLHGTIETRYIQDEPEIKLKTSAIRSLGSFSPDDSTLGITEAAQYMCPLSNGQYITSRAINQSTTGDTMFVLHDTNFKPISKMIVSHGGHGSSFSIEEVSGAIYIWSATKPNLNVNEYAVSRIPYLANAALDNDDNRITRFCTVDRYIRVSVDFKHGYVLCGYVNGKHDVLRLDEVKQGNYDVLYSFDVANYGFDENQQTYQSQGIDFPYVYFNSGDYNMKDPRMVSAINVVHGGQEFASNYLLDMNLGLTDDVIEPETCNIIYSQTNQPELLVTFNCQYQGASLERVFVIPIKERLPMATISND
>NZ_CP019722.1|WP_079111803.1|1778911_1780684_-|phage-tail-family-protein
MSVLNKNDFEYAGLNSRDDLQAIMGAVTLPSAPAMAEQATDIPGMYGNQFNGMDYTSRTISIPITIIARGSQDKYKQIMHNLSGLLLSDDPSDNGKEYPLVFGFEPKVTYWGHITAISDPQFINQGAWDATLTITFVQSDPRATLPQVETPLKNGLNTITVDGTARTEPVIQVIPKRDLKYIGFSLNGGQFGLGPESPGDQATAVQPYTKVVDDPLGTMAMWTNDANAISNMKTGETYTYQGHSEIKTATNVMRPAVTSAGYDFGTIPTTGEDRWYGPAYRYTGMTNSLTDWRVRTGIHQFKYSGTHNGRAMGRVEVLLLDPNGNTIGRFGMRDMAYGAKPMARLQICEPGSTLEYGDHYTDLYYGSGPAGSFTNKPDQKIQIKTGTTTKTVTKYGRSKSGKVTKKTVNETVDTYTTVVNKEEDSALAGAWLMLDITKRGQVFTWSITQYSTKTGQPFLDPNIHMLVHGTYVDTQNKYQTALGGIGSVFLKHPITEDNYKIAYRNPFMSMTDLQIWQVNKVDTTKPTYIAGAGEEIVMDCESDTVTVNGKLVSPVWSTDFPKLKPGVNGLSMIGDLDDAQMALKYLPRIL
>NZ_CP019722.1|WP_079111804.1|1780755_1785924_-|phage-tail-protein
MATEKIQGYEFAINMDDGGMTRTLREIKNEAKLLKSGMQANFAEIRSGEGIMAAYAGKVKDAGRAIEAQRLVIERLKSEQNGLDQTTQKGREAYVKYENQINAAKRSIASLEGQQERAQKSLDLQKSGVLQLKDAMEAQNKISANYIAKLKAEGKEDEALASQKDSLKDKIKSLKALYESESHQLIKMSEDSKVTAESYQQQKIRVSELTAELAKSKSELNSLNSPEQAHLKNMENLRGQSKLIEGSMAALVSRFKAEGNELEANKAKSNGLREAYDNLNKQLKAENEELNRIKSVSGESSNAYKQQSIRVNELGTKIAQTRTKMKKLDEQLSKKPQSGLTSVISQLNRVNEHADKANHLFGKILGAHLVANGITSAFQSITSHIHEAISAGMEYEKEQQKMTATWLTLTGTVGKSNAMVKTINDLSVKTGQAVDVVNELEQGFYHLHSNKKESDELTKSMLNMSDAVGLDSQQIQAVTQDMVNGLSRGKANAGMLNQISQYFPMFREQLAKYETQVNHGKKVTVADLAAMAKAGKISATDIEKTFNSLGSGKYDKAADNMLHTMVGMERTIKARVPALIGDIEKPILTAQNPIYGAVSKWVSDKRTDKEFNKVGVAAEKGISTITKAFAKAFDVKSAPKAMNDAMDNLAKGVTKASDSIAKNAPEIVNFFKTVKNLGGLGFETLIESLKITNAILKPLLSMVGGHTETIAKFGAAWWLTSKAVKETSSVLSTFKKISDTVSWAEKVLGIKQETKALEEQNAVLKTNAELSTASEENIGTGYRRVKGRKAGNTGADLSSISVEAENTEKIAKSSKWSLLGGTIGTRIINGAGLAMTAWDAGSSIAKAVSSGKASDKYKATGKTAGTLIGGGIGAALGSVIPGAGTAAGAMLGASIGDGVGGTKTANTIVKRISDALKGKSIEAPKIKTESTKRSLSDLGKAYSSYYSKKQKQDLNDVNVLHKAGMLTDAEYKKQLASIKKNDSETNRFEKMSASDRNAIAKYYAQQKASIISKWNARERKTSSSWDAKIASDERQFGANSIIVQKDMSKKKAAIQAEENKKSAALDKLRIKSATETTAQEARLHTTLTGKIKSAANKQNDILRNLAKSKGKITREQANDAISQSNKEYKKTVSLANQEYKDRVSAAEKQHNKVIKAAERQASEAISQAKSQYSKTVDAAKNQYSGNSKYAEKQRAAIISKAKDQKQKSIDNALEQENKTEQHADRQYKHTTDDADKQRSQVVKHAKDQNSSVVDQAKSQSKGVLGHAVKQANGSMKAADKQGSGIHSIWKNITSFFSNLVKGFGIKPINVGAYPSGYTPVTMGAYASGGIVDTARALVGEGGVEAKIDRDNGKVSFLGMNGAEVVNVKPGDQILNAGDTAKLFNGGLGHTLPGYAKGTVDIASFLKKIKSGATSIFDSVSDKAMDALSKITHPLKTLKSMALKTFDPTKTPGVGSIGHDLGKGLVDRALKEFAKAISDLADNFGGAGGSVGNPAGSSVSRWKPYVVRALKANGFGATASQVSAWMRVIARESNGNPRAINLWDSNAKKGIPSMGLVQTIRPTFEAYKFSGHGQIYNGYDDLLAGINYMKHIYGKGDSAFARVSGPEGYANGGFGNKAGVYKLFEGNLPEAIVPMDLSKRSRAYQIMQQIMAKFGAQDGANVINTGNDQIDSDEAFKQRVIASLDALVTGQGDVKAVVANSDVVNAVKSNTKKTSQYSQMMGY
>NZ_CP019722.1|WP_016058335.1|1785936_1786128_-|hypothetical-protein
MIWQLDNFIQDIDYIANQLISQGILPSDFYQSSFSEMQTALNAKSRKDRVQDPLELARQIGAL
>NZ_CP019722.1|WP_063722570.1|1786124_1786508_-|hypothetical-protein
MAKSVKFDGKKIGTGTQYTLIDSGQNVEKMAEAYKKFIKTTEETEDSITGVVELTPKLAKVVAETTCDLLELNASQKKRVMSMEFSVSDEYDFFNDCLKQFLGVELPSVGNSSDQEDDEDPKLTKPE
>NZ_CP019722.1|WP_063722569.1|1786709_1787348_-|phage-tail-protein
MATLGLNMLYTGIKADDGSTIIDADKGLSAAGVYPIDTSKANGNLGTKTANITGLSGTVSKITGNNEVVDVSNPPSAPSVAIDSNEINFIVKQKLLGRVSDGKGGYSDTDKPVEAGLIIESRSPIFRTAIYYCFGRGIFNEAGQNIQTNTDTAETRDDDNLTFTALNYDGFGGQPYKVYAESDPKFDKQAMFDAVFPGQTFYKNASNGTSGQ
>NZ_CP019722.1|WP_063722568.1|1787348_1787732_-|hypothetical-protein
MTPVAFIKSIIVTNINEIPELAVEHIHSFFIPINDTSTDEPIAVISGLPERSQDYGNGIPFQSTKQVQIQLYYPKDYLGDMDAIESGLKQVLLTNDIRCYSDAGQTLTPDSESITNTLKFNYIKEAI
>NZ_CP019722.1|WP_063722567.1|1787728_1788169_-|hypothetical-protein
MANEIKHADSFEHILDTMAEGFGREEKLKANAAGADQFIKIMKPKIPVGKLRKVHGHAEKAHLRDSLIAVDHPNGSVNVGFTAKGEKGYIARFQNDGWDVVDRNGSKHSHVSGKHFWETTQREAKGQVGKAVVEQLKTAMDKKVGK
>NZ_CP019722.1|WP_016058330.1|1788158_1788521_-|phage-head-closure-protein
MTKAINPTRMNFRLEFGTQAATGKVNPNTGNPITDFVPQFSLYAGEWSLSFQQRLALNGDTSQQNAVYFVRHNLKITTGMQLRRNHQDVYQIDDVAYDDGLPPDGFDLITCHKVVIGRGE
>NZ_CP019722.1|WP_016058329.1|1788504_1788843_-|phage-gp6-like-head-tail-connector-protein
MAADLKTLKSSLRIDGNDDDELLTGYLSAATSYIKQAIGDENGVTGFYEMEGVNDLFETAVYALAGSYWTYRTSITAIAVNPVDLVVDSIIGQLRGLYSQKQYEAGTNDESN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019722_1	1.7\|115424\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115424-115453	30	NZ_CP025993	Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	51476-51505	0	1.0
NZ_CP019722_1	1.5\|115292\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115292-115321	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	284024-284053	4	0.867
NZ_CP019722_1	1.5\|115292\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115292-115321	30	AB981169	Ralstonia phage RSY1 DNA, complete genome	19536-19565	6	0.8
NZ_CP019722_1	1.5\|115292\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115292-115321	30	NC_049432	Ralstonia phage RsoM1USA, complete genome	13669-13698	6	0.8
NZ_CP019722_1	1.5\|115292\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115292-115321	30	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1133280-1133309	6	0.8
NZ_CP019722_1	1.1\|115028\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115028-115057	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	477512-477541	7	0.767
NZ_CP019722_1	1.7\|115424\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115424-115453	30	NC_017507	Marinobacter adhaerens HP15 plasmid pHP-187, complete sequence	134270-134299	7	0.767
NZ_CP019722_1	1.7\|115424\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115424-115453	30	KY296500	Xenohaliotis phage pCXc-HC2016, complete genome	22086-22115	8	0.733
NZ_CP019722_1	1.7\|115424\|30\|NZ_CP019722\|PILER-CR,CRISPRCasFinder,CRT	115424-115453	30	KY296501	Xenohaliotis phage pCXc-HR2015, complete genome	22084-22113	8	0.733

1. spacer 1.7|115424|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025993 (Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence) position: , mismatch: 0, identity: 1.0

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
tattgagtgcagcgttgtttgcgagcgtcc	Protospacer
******************************

2. spacer 1.5|115292|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 4, identity: 0.867

acgtcggcgaaatcttcacca----cgccgatta	CRISPR spacer
acgtcggcgaaatcttcaccaacaccgccg----	Protospacer
*********************    *****

3. spacer 1.5|115292|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to AB981169 (Ralstonia phage RSY1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

acgtcggcgaaatcttcaccacgccgatta	CRISPR spacer
ccatcggcgacatcctcaccacgccgatcg	Protospacer
 *.******* ***.*************..

4. spacer 1.5|115292|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to NC_049432 (Ralstonia phage RsoM1USA, complete genome) position: , mismatch: 6, identity: 0.8

acgtcggcgaaatcttcaccacgccgatta	CRISPR spacer
ccatgggcgacatcctcaccacgccgattg	Protospacer
 *.* ***** ***.**************.

5. spacer 1.5|115292|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

acgtcgg-cgaaatcttcaccacgccgatta	CRISPR spacer
-ggtcagtcgaaatattcaccacgccgatag	Protospacer
  ***.* ****** ************** .

6. spacer 1.1|115028|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

caacagactcctgctggggttgcctcagtt	CRISPR spacer
aaacacactcctgccggggttgccccggcc	Protospacer
 **** ********.*********.*.*..

7. spacer 1.7|115424|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to NC_017507 (Marinobacter adhaerens HP15 plasmid pHP-187, complete sequence) position: , mismatch: 7, identity: 0.767

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
acctgagtgcaacgttgtttgcgagactct	Protospacer
  .********.*************  **.

8. spacer 1.7|115424|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to KY296500 (Xenohaliotis phage pCXc-HC2016, complete genome) position: , mismatch: 8, identity: 0.733

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
cattgattgcagcgttgtttgagatcacag	Protospacer
.***** ************** ** *..

9. spacer 1.7|115424|30|NZ_CP019722|PILER-CR,CRISPRCasFinder,CRT matches to KY296501 (Xenohaliotis phage pCXc-HR2015, complete genome) position: , mismatch: 8, identity: 0.733

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
cattgattgcagcgttgtttgagatcacag	Protospacer
.***** ************** ** *..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

334337 : 382377

Bacillus_virus(33.33%)

bacteriocin,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027821521.1\|334337_334901_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_016511451.1\|335094_335763_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_027821520.1\|335920_337426_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|337690_338059_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|338171_338681_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_027821519.1\|338711_339908_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|340017_340488_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100976.1\|340506_340962_+	hypothetical protein	NA	NA	NA	NA
WP_027821518.1\|341065_341638_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100977.1\|341803_342724_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_027821517.1\|342860_343772_+	oxidoreductase	NA	NA	NA	NA
WP_003641939.1\|344659_345106_-	hypothetical protein	NA	NA	NA	NA
WP_003641940.1\|345343_346870_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_027821516.1\|346870_347842_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|347919_349251_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_027821515.1\|349716_351234_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_027821514.1\|351248_353078_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|353092_353815_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_079111766.1\|354401_358085_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_079111767.1\|359937_360318_+	barstar family protein	NA	NA	NA	NA
WP_027821511.1\|360460_360724_+	hypothetical protein	NA	NA	NA	NA
WP_027821510.1\|361115_361361_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|361935_362355_+	hypothetical protein	NA	NA	NA	NA
WP_027821509.1\|362646_363111_+	hypothetical protein	NA	NA	NA	NA
WP_027821508.1\|363446_364064_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|364067_365222_-	MFS transporter	NA	NA	NA	NA
WP_003643796.1\|365225_366017_-	HAD family hydrolase	NA	NA	NA	NA
WP_003643797.1\|366087_366960_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|367119_367935_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_027821507.1\|368460_369837_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|369881_371066_+	cation:proton antiporter	NA	NA	NA	NA
WP_027821506.1\|371629_371809_+\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_027821505.1\|372739_373408_-	hypothetical protein	NA	NA	NA	NA
WP_153302738.1\|374000_374168_+	hypothetical protein	NA	NA	NA	NA
WP_027821504.1\|374185_375526_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_015825122.1\|375526_376270_+	response regulator transcription factor	NA	NA	NA	NA
WP_027821503.1\|376563_377337_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|377435_377594_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|377618_377789_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_027821502.1\|378054_380205_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.6e-45	27.9
WP_027821501.1\|380221_381598_+	HlyD family secretion protein	NA	NA	NA	NA
WP_027821500.1\|381687_382377_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

564701 : 573325

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644909.1\|564701_566399_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640956.1\|566420_566729_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003637790.1\|566744_567344_+	recombination protein RecR	NA	NA	NA	NA
WP_003640957.1\|567358_567610_+	YaaL family protein	NA	NA	NA	NA
WP_003643941.1\|568007_568673_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640965.1\|568669_568999_+	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_003640966.1\|569015_570035_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640967.1\|570059_570407_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_013355239.1\|570505_571402_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640969.1\|571405_572191_+	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355240.1\|572329_573325_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5

DBSCAN-SWA_3

1220008 : 1232786

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355467.1\|1220008_1221247_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7
WP_013355468.1\|1221337_1222309_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
WP_003643099.1\|1222494_1223442_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1223784_1224399_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_022638021.1\|1224401_1226840_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_013355469.1\|1226927_1227488_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
WP_013355470.1\|1227558_1227999_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
WP_022638019.1\|1228389_1229757_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
WP_021356352.1\|1229749_1230442_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_079111784.1\|1231151_1231817_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_013355474.1\|1231841_1232786_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	2.0e-72	45.5

DBSCAN-SWA_4

1725324 : 1810548

Lactobacillus_phage(80.0%)

head,portal,tail,protease,integrase,tRNA,capsid,terminase

attL 1750907:1750924|attR 1817482:1817499

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027821256.1\|1725324_1726248_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_027821257.1\|1726732_1727254_-	shikimate kinase	NA	NA	NA	NA
WP_015825650.1\|1727256_1728354_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_015825651.1\|1728356_1729655_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_027821258.1\|1729668_1730196_-	hypothetical protein	NA	NA	NA	NA
WP_013355607.1\|1730204_1731374_-	chorismate synthase	NA	NA	NA	NA
WP_003645963.1\|1731366_1732821_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1733469_1733823_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_003645962.1\|1733845_1736422_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1736436_1736742_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1736731_1737031_-	YlxR family protein	NA	NA	NA	NA
WP_079111797.1\|1737075_1738293_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1738313_1738790_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1739085_1743399_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1743892_1745602_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1745641_1746919_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1746956_1747742_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1747757_1748537_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1748656_1749220_-	ribosome recycling factor	NA	NA	NA	NA
WP_079111798.1\|1749221_1749944_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1750144_1751023_-	elongation factor Ts	NA	NA	NA	NA
1750907:1750924	attL	NA	NA	NA	NA
WP_003640739.1\|1751125_1751929_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1752153_1752876_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1753164_1754163_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1754247_1754553_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003644499.1\|1754536_1755295_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1755406_1756042_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1756098_1756335_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1756432_1756672_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_079111799.1\|1757544_1757685_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003645631.1\|1758079_1758709_+	hypothetical protein	NA	NA	NA	NA
WP_013355614.1\|1758758_1759928_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1759963_1760356_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|1760519_1760912_+	hypothetical protein	NA	NA	NA	NA
WP_003640752.1\|1761357_1762299_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_003645636.1\|1763050_1763623_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644505.1\|1763774_1764959_-	LCP family protein	NA	NA	NA	NA
WP_003645638.1\|1764939_1765731_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_079111800.1\|1765749_1767492_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003644508.1\|1767970_1769182_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_016058344.1\|1770422_1770953_-	hypothetical protein	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
WP_003644510.1\|1770965_1771229_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_016058343.1\|1771228_1772401_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.1e-216	100.0
WP_063487082.1\|1772416_1773301_-	hypothetical protein	E9LUR7	Lactobacillus_phage	1.7e-139	99.7
WP_016058341.1\|1773284_1773446_-	hypothetical protein	E9LUR6	Lactobacillus_phage	1.2e-19	100.0
WP_016058340.1\|1773449_1773704_-	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
WP_079111801.1\|1773696_1776462_-	hypothetical protein	A0A2P0ZL34	Lactobacillus_phage	1.8e-195	50.4
WP_079111802.1\|1776478_1778848_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	96.1
WP_079111803.1\|1778911_1780684_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	97.3
WP_079111804.1\|1780755_1785924_-\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	98.0
WP_016058335.1\|1785936_1786128_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_063722570.1\|1786124_1786508_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	7.4e-63	97.6
WP_063722569.1\|1786709_1787348_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.1e-116	99.5
WP_063722568.1\|1787348_1787732_-	hypothetical protein	E9LUQ7	Lactobacillus_phage	9.4e-66	98.4
WP_063722567.1\|1787728_1788169_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	5.0e-79	99.3
WP_016058330.1\|1788158_1788521_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.2e-66	100.0
WP_016058329.1\|1788504_1788843_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_072534789.1\|1788915_1790148_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.0e-209	91.9
WP_063487073.1\|1790147_1790906_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	5.5e-126	94.0
WP_063487072.1\|1790883_1792080_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.2e-206	90.2
WP_063487071.1\|1792082_1792277_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	3.8e-23	89.1
WP_063487149.1\|1792266_1794174_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	2.6e-180	49.8
WP_063487070.1\|1794160_1794622_-\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	3.2e-44	57.5
WP_172598422.1\|1794841_1795312_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.2e-80	91.7
WP_063485443.1\|1795322_1795502_-	hypothetical protein	E9LUP6	Lactobacillus_phage	3.6e-12	66.1
WP_063485444.1\|1795584_1796508_-	hypothetical protein	NA	NA	NA	NA
WP_079111805.1\|1797559_1797985_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	7.2e-67	87.2
WP_079111806.1\|1798426_1799497_-	DNA cytosine methyltransferase	A0A1I9KKE7	Lactobacillus_phage	5.6e-124	61.3
WP_022638754.1\|1799501_1799660_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.9e-18	92.3
WP_024971545.1\|1799652_1799847_-	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	4.5e-16	71.4
WP_079111807.1\|1799850_1800162_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	1.1e-45	87.4
WP_079111808.1\|1800164_1800467_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.0e-46	93.0
WP_072534795.1\|1800602_1801388_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	4.1e-132	91.2
WP_069137016.1\|1801387_1802131_-	replisome organizer	E9LUM6	Lactobacillus_phage	2.7e-40	57.3
WP_033098960.1\|1802233_1802491_-	hypothetical protein	NA	NA	NA	NA
WP_162920430.1\|1802490_1802661_-	hypothetical protein	NA	NA	NA	NA
WP_003641371.1\|1802944_1803145_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_063722546.1\|1803147_1803402_-	hypothetical protein	NA	NA	NA	NA
WP_079111809.1\|1803544_1803805_-	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|1803862_1804189_+	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_079111810.1\|1804304_1804514_-	hypothetical protein	NA	NA	NA	NA
WP_063722542.1\|1804525_1805233_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	5.1e-65	59.9
WP_057138664.1\|1805248_1805497_-	transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	4.0e-17	61.4
WP_057138663.1\|1805665_1806340_+	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	8.0e-52	44.6
WP_079111812.1\|1806469_1807345_+	hypothetical protein	NA	NA	NA	NA
WP_064972032.1\|1808529_1809168_-	hypothetical protein	NA	NA	NA	NA
WP_053338955.1\|1809384_1810548_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
1817482:1817499	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2108662 : 2164922

Lactobacillus_phage(41.67%)

head,portal,holin,tail,integrase,capsid,terminase

attL 2158396:2158410|attR 2165080:2165094

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027821935.1\|2108662_2109040_-\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	1.0e-11	57.0
WP_027821934.1\|2109026_2109323_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	2.4e-37	73.5
WP_050482360.1\|2109323_2110436_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	9.8e-47	35.0
WP_079111869.1\|2110494_2110650_-	XkdX family protein	NA	NA	NA	NA
WP_079111820.1\|2110825_2113069_-	hypothetical protein	A0A1L2JXK8	Streptococcus_phage	3.8e-13	37.1
WP_027821932.1\|2113069_2113345_-	hypothetical protein	NA	NA	NA	NA
WP_027821931.1\|2113334_2113703_-	hypothetical protein	NA	NA	NA	NA
WP_027821930.1\|2113677_2114865_-\|tail	phage tail protein	NA	NA	NA	NA
WP_027821929.1\|2114857_2115769_-\|tail	phage tail family protein	Q9T1A6	Listeria_phage	1.6e-18	30.3
WP_027821928.1\|2115841_2116120_+	hypothetical protein	NA	NA	NA	NA
WP_079111870.1\|2116144_2119933_-	tape measure protein	A0A0A7DMV4	Lactobacillus_phage	3.3e-38	57.2
WP_027821927.1\|2120157_2120415_-	hypothetical protein	NA	NA	NA	NA
WP_027821926.1\|2120489_2121008_-	hypothetical protein	NA	NA	NA	NA
WP_027821925.1\|2121036_2121690_-	hypothetical protein	NA	NA	NA	NA
WP_027821924.1\|2121738_2122134_-	hypothetical protein	NA	NA	NA	NA
WP_027821923.1\|2122136_2122628_-	hypothetical protein	NA	NA	NA	NA
WP_033608065.1\|2122628_2122961_-	hypothetical protein	NA	NA	NA	NA
WP_027821922.1\|2122957_2123326_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_050482355.1\|2123343_2124453_-\|capsid	major capsid protein	A0A2H4J022	uncultured_Caudovirales_phage	1.8e-61	40.1
WP_027821921.1\|2124468_2124840_-	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.5e-07	33.6
WP_027821920.1\|2124853_2125513_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_027821919.1\|2125623_2126535_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_050482354.1\|2126534_2128271_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	7.0e-76	34.4
WP_033608063.1\|2128285_2129599_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	8.6e-127	54.3
WP_033608061.1\|2129591_2130107_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.8e-65	88.8
WP_027821917.1\|2130164_2130485_-	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	1.8e-17	45.6
WP_027821916.1\|2130708_2130981_-	hypothetical protein	A0A2D2W301	Escherichia_phage	4.0e-18	50.6
WP_027821915.1\|2130949_2131129_-	hypothetical protein	NA	NA	NA	NA
WP_027821914.1\|2131207_2131711_-	hypothetical protein	NA	NA	NA	NA
WP_033608060.1\|2131728_2132748_-	hypothetical protein	NA	NA	NA	NA
WP_027821913.1\|2133157_2133619_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	3.1e-39	56.3
WP_027821912.1\|2133830_2134211_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_027821911.1\|2134207_2134726_-	hypothetical protein	O03915	Lactobacillus_phage	2.9e-54	68.4
WP_027821910.1\|2134730_2135453_-	phage antirepressor KilAC domain-containing protein	Q8SDM9	Staphylococcus_phage	4.2e-51	45.6
WP_016511192.1\|2135609_2136452_-	ATP-binding protein	O03914	Lactobacillus_phage	2.9e-152	96.1
WP_016511193.1\|2136432_2137221_-	replication protein DnaD	NA	NA	NA	NA
WP_016511194.1\|2137301_2138054_-	PD-(D/E)XK nuclease-like domain-containing protein	A0A0P0IZH9	Lactobacillus_phage	1.1e-70	50.6
WP_027821909.1\|2138085_2138985_-	recombinase RecT	E9LUM3	Lactobacillus_phage	1.0e-62	47.7
WP_027821908.1\|2138981_2139368_-	hypothetical protein	NA	NA	NA	NA
WP_027821907.1\|2139696_2139984_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	1.3e-22	48.9
WP_027821906.1\|2140233_2140746_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	1.8e-27	43.5
WP_011101775.1\|2140813_2141119_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_033608057.1\|2141130_2141301_-	hypothetical protein	NA	NA	NA	NA
WP_027821905.1\|2141325_2141622_-	hypothetical protein	NA	NA	NA	NA
WP_003642789.1\|2141968_2142199_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
WP_153302739.1\|2142198_2142375_+	hypothetical protein	NA	NA	NA	NA
WP_079111823.1\|2142371_2142596_+	DUF2513 domain-containing protein	A0A2H4J4K9	uncultured_Caudovirales_phage	5.2e-08	50.8
WP_027821903.1\|2142592_2142775_-	hypothetical protein	NA	NA	NA	NA
WP_050482353.1\|2142833_2143115_+	hypothetical protein	NA	NA	NA	NA
WP_079111824.1\|2143267_2143525_-	helix-turn-helix transcriptional regulator	A0A2H4JFN1	uncultured_Caudovirales_phage	8.6e-07	42.2
WP_027821901.1\|2144198_2144621_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	7.8e-13	35.1
WP_162551031.1\|2144902_2145529_+	Ltp family lipoprotein	A0A173G9H4	Propionibacterium_phage	7.3e-07	60.0
WP_016511204.1\|2146139_2146316_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.9e-11	53.4
WP_027821900.1\|2146473_2148093_+	SIR2 family protein	A0A1S5SA14	Streptococcus_phage	3.1e-94	47.9
WP_027821349.1\|2148358_2149480_+\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	2.0e-47	33.0
WP_003642774.1\|2149830_2150037_-	hypothetical protein	NA	NA	NA	NA
WP_027821899.1\|2150450_2151032_-	hypothetical protein	NA	NA	NA	NA
WP_027821898.1\|2151037_2151511_-	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_027821897.1\|2151589_2151958_-	hypothetical protein	NA	NA	NA	NA
WP_027821896.1\|2152117_2152387_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_027821895.1\|2152475_2154020_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	8.2e-44	25.6
WP_027821894.1\|2154016_2155117_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.4e-48	34.0
WP_079111826.1\|2155117_2155318_-	hypothetical protein	NA	NA	NA	NA
WP_027821893.1\|2155271_2156975_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.2e-122	41.1
WP_027821892.1\|2156971_2157445_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
2158396:2158410	attL	NA	NA	NA	NA
WP_027821891.1\|2158455_2158845_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	44.7
WP_027821890.1\|2158837_2159176_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.3e-07	34.7
WP_027821889.1\|2159162_2159354_-	hypothetical protein	NA	NA	NA	NA
WP_027821888.1\|2159369_2159849_-	hypothetical protein	NA	NA	NA	NA
WP_027821886.1\|2161388_2162189_-	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_021357488.1\|2162202_2162433_-	hypothetical protein	NA	NA	NA	NA
WP_027821885.1\|2162703_2162886_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_050482352.1\|2163063_2163714_+	helix-turn-helix transcriptional regulator	A0A1W6JQE6	Staphylococcus_phage	3.6e-09	46.5
WP_027821884.1\|2163764_2164922_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	5.0e-54	34.8
2165080:2165094	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2358852 : 2367363

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2358852_2359431_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_027821845.1\|2359423_2360449_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.3e-60	41.3
WP_027821844.1\|2360445_2361900_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-50	34.0
WP_021356102.1\|2361884_2364104_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_011101895.1\|2364096_2364777_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2364776_2365031_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_021356104.1\|2365032_2365764_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
WP_024521791.1\|2365766_2366897_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2366880_2367363_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP019723

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019723_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019723_1

30168-30324

Orphan

Consensus_repeat	Method
TGAACCCCTTGGTACAAGCGGACTTCTCAAAAAGAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019723_1

>merge|NZ_CP019723|1|30168-30324|CRISPRCasFinder
TGAACCCCTTGGTACAAGCGGACTTCTCAAAAAGAGAAACCCGCATGATACCGTTGAACCCCTTGGTACAAGCGGACTTCTCAAAAAGAGAAACCCGCATGATACCGTTTCTGATACGTCTGAATCCCTTGGTACAAGCGGACTTCTCAAAAAGAGA

>NZ_CP019723|1|1|30168-30324|CRISPRCasFinder
TGAACCCCTTGGTACAAGCGGACTTCTCAAAAAGAGA	AACCCGCATGATACCGTTGAACCCCTTGGTACAAGCGGACTTCTCAAAAAGAGAAACCCGCATGATACCGTTTCTGATACGTC
TGAATCCCTTGGTACAAGCGGACTTCTCAAAAAGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019723.1\|WP_002825834.1\|28900_29149_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019723.1\|WP_063488847.1\|31567_32248_+\|zeta-toxin-family-protein	unknown	unknown	gnl\|CDD\|226648
NZ_CP019723.1\|WP_003555660.1\|32538_32766_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019723.1\|WP_010014831.1\|31057_31339_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP019723.1\|WP_099046409.1\|25822_26622_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP019723.1\|WP_010010267.1\|28080_28887_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP019723.1\|WP_016378676.1\|25178_25283_-\|putative-holin-like-toxin	unknown	unknown	gnl\|CDD\|319017
NZ_CP019723.1\|WP_045353640.1\|21391_23239_-\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319844
NZ_CP019723.1\|WP_010620892.1\|31385_31571_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019723.1\|WP_003713050.1\|19198_19414_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019723.1\|WP_041095822.1\|32237_32516_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019723.1\|WP_034528490.1\|27390_27984_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP019723.1\|WP_045353638.1\|23557_23818_+\|transposase	unknown	unknown	gnl\|CDD\|225511
NZ_CP019723.1\|WP_157950508.1\|23874_24633_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP019723.1\|WP_128384022.1\|26824_27283_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP019723.1\|WP_045353640.1\|21391_23239_-\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319844	cd07544, P-type_ATPase_HM, P-type heavy metal-transporting ATPase; uncharacterized subfamily. Uncharacterized subfamily of the heavy metal-transporting ATPases (Type IB ATPases) which transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP019723.1\|WP_010014831.1\|31057_31339_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	6.2967e-11
NZ_CP019723.1\|WP_063488847.1\|31567_32248_+\|zeta-toxin-family-protein	gnl\|CDD\|226648	COG4185, COG4185, Uncharacterized protein conserved in bacteria [Function unknown].	9.96113e-39
NZ_CP019723.1\|WP_034528490.1\|27390_27984_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	5.99479e-45
NZ_CP019723.1\|WP_010010267.1\|28080_28887_+\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	4.59778e-39
NZ_CP019723.1\|WP_016378676.1\|25178_25283_-\|putative-holin-like-toxin	gnl\|CDD\|319017	pfam16935, Hol_Tox, Putative Holin-like Toxin (Hol-Tox). Hol_Tox is a family of small proteins (34-48aas) with a single TM region. Members can exhibit antibacterial activity against Gram-positive bacteria but not against Gram-negative bacteria.	1.32966e-06
NZ_CP019723.1\|WP_099046409.1\|25822_26622_+\|IS5-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	6.80817e-19
NZ_CP019723.1\|WP_045353638.1\|23557_23818_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	0.00535294
NZ_CP019723.1\|WP_157950508.1\|23874_24633_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.13393e-47

>NZ_CP019723.1|WP_002825834.1|28900_29149_+|hypothetical-protein
MSLDSFNHKKDEEMRESYETTLKDNKKDAVAFLKNISRKEVERKRSVTFSITESQLKKMDTAARKNGFKNRSEFLASIIDAI
>NZ_CP019723.1|WP_010010267.1|28080_28887_+|ParA-family-protein
MKIITFTAIKGGVGKTTLTLNYGDWLAKHGKKVLLIDLDHQCNLTTVFEKTRRNNTIAEAFKENDNAQKVKIDSVGPNLDLIAGFIDLDVLGSYLENNSNKEMMLFMWFKNNSDSLSLTDYDYILIDTHPDFSTITKNAIAISNYLLSPITPSEHGYNAKFDLETRLEKFRKSLFDYRTGETYVDAKLFFIGNMIRHNTSMSRDLLKHIEGDETVATIIPERELFNKATARHASIFELANHDESILKQNQKFIEHADHLFQELANKTK
>NZ_CP019723.1|WP_034528490.1|27390_27984_+|recombinase-family-protein
MAKIGYARVSSKEQHLDRQLAALKDVDKLFTDKLSGANTNRPELQKMLAYIREGDIVLVTELDRLGRNNQDLTQIMNSIQNKGATLDVLNLPSMTGIADPNLRQLMTNLIIELYKYQAESERKRIIERQQQGISLAKQQGKYHGRKPQYTQDDPRLQHAFKLYQAGMSDVDVARNTGIKRTTFIRYRKKYRIFKNEL
>NZ_CP019723.1|WP_128384022.1|26824_27283_+|hypothetical-protein
MCKDINSKTTHTTRSWTYRLFLLFIDKIKSKNYKKQYEDKDLYPYLQMVNIQNGDEIAATGFIPIKSHEMRTIVIPKGRFLDAVKNRLTSNYKALKRFVNKKPVYIYFIYQTMSGTVKEFVVETDYQDSLGKDLDMEYLTKILAVQDKYKTK
>NZ_CP019723.1|WP_099046409.1|25822_26622_+|IS5-family-transposase
MQHFSHHYQSDISRQQFDLIRQDLEASRKRTHPKHIDPYDIFCAMLYVLKNGCTWRDLPADFPKWSTVYYYWMNWSKAPTPDKPALLTQVLKKLSLNRRLRQGRSARTSFVILDAQSIKNTATAENKGYDGGKKISGIKRHLAVDINGFPQAIHITRANITDRDGAIALVTLNLEQFKLVRTMMVDSGYTGQNFANEISSLTSAKVIVVKRNELHQFSVIPQRWLIERSFSWLGNYHRLWRNCERKLNTSLMMVSLAFIRLLLKRY
>NZ_CP019723.1|WP_016378676.1|25178_25283_-|putative-holin-like-toxin
MSVADALQLMLAFGTFIVALIALIVELIKSQQKK
>NZ_CP019723.1|WP_157950508.1|23874_24633_+|IS3-family-transposase
MRILSALKIKSSTYYNWRHWQPSQQEKRRESLKPYILDVWKTFKFYGYRRIAAYSQLNNDCPKISEYMTLKLMRELGIRSRMQKRYRKPKTVVTVDQKPNLIRHLHDLSGVWQTDITYIQLTNHRWVYLATVLDPEKRKVLGYKIGDTMTAELATSALQMALDKHRKPLIIHSDMGSQYTSAEFNIKCQNYGLKHSYSLKGHPYDNGRMEAFHSILKREEVYLKAYETLTQVQAAIGWYINFYNRNRNSNVA
>NZ_CP019723.1|WP_045353638.1|23557_23818_+|transposase
MSIRYSQDFKDSLVKLHQEGRSLESLAEEFGPSKDSIAIWVKQATPIMIKGQSKTLKDVKQLEKRLAILEEENEILKRAAILLAKK
>NZ_CP019723.1|WP_045353640.1|21391_23239_-|cadmium-translocating-P-type-ATPase
MKKNWQLMMVLAVSAIALVFAFGLKQPLIAQGLITVMGSIIALIMFWGMVKTIRSGNFGVDLLAITAVVATLAVGQYWAAMIVLLMLTGGDALESYAATKASSELKQLLENAPTTAHRMVDGHVEDVEVEAVQVGETILVKPQEVVPVDGTVLAGESLVDEASLTGESKPVAKNAGSDIMSGTVNGDAALTVKVTQRAEDSQYQGIIKLVKESEARPAHFVRMADRYAVPFTLIAYVSAGLGWFFSGDPVRFAQVLVVASPCPLILAAPIAMVSGMSRNSRNGIIVKSGTTLEKLSDAKTFAFDKTGTVTRGILKVATILPQAGFSQDQLLKLAASAEGQSTHILARSLTDAVPTADRLPATDVSETTSFGVNATVDGRKVKVGKAEFAGTKATVDTTAVYVNVDGQYAGAITFSDQIRPEAKETMTKLHELNDAKLIMISGDQQSIADKVAAQVGIDQVYAEQLPQQKIEVLDNVPKDGRPVVMVGDGVNDAPSLAIADVGIAMGAHGATAASESADAVVLRDDLAKVAAATLIAKETMVIAKQAVLIGIAICTGLMLIASFGVIPTIIGAMLQEVVDTVTILYALRARNGLHRQALVDPVRATAEREQIQQIN
>NZ_CP019723.1|WP_003713050.1|19198_19414_+|hypothetical-protein
MKNELEALASELPILTDKSSYKYLSEVAGNGKYIQVAWQKKNAEYLALYGTQSIKLPQIDNSVEFVDAEEG
>NZ_CP019723.1|WP_010014831.1|31057_31339_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVQIDKELADNTEAVLSQLGLNPTTAINMFYKRIVADAALPFKPALSEAERANLSLLKATKETPVTEFKDAKEVADWLNDPDED
>NZ_CP019723.1|WP_010620892.1|31385_31571_+|hypothetical-protein
MKDTITINDFFEIAKETDLKDLLDKSLHEPDPEKRKVYDALYTYFLDKRQDEVIKRKDFVR
>NZ_CP019723.1|WP_063488847.1|31567_32248_+|zeta-toxin-family-protein
MIDKPQYIIVAGINGAGKSTLYDTFPILFDKTKRINADELLRQMGGDWHKDSDNLKAMKEEIKQLHYALDHQQSIHVETTLAGRGKAQLNLIDKAHKNGFEVTLLYVALRDENLAIQRVNERVQKGGHGVPVATIKKRYQQSKHNLPLVAFKSDKVMIYDNSEKFTSVYAIEKGQVFKNDLRHFPWINQNITYPEKVQKQLQNFADQNPEVKPKNDPENKNDRPSY
>NZ_CP019723.1|WP_041095822.1|32237_32516_-|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQADNLSVEQTEELLKIFADYVNAHKPDKLKNDQPNN
>NZ_CP019723.1|WP_003555660.1|32538_32766_-|hypothetical-protein
MIGGIVMSQSNLEKQEAKLKALNQKIKDEKNKIEQRLGKQIISQANLDYANLSNDQIKLLAKQFSEFLKVKSVDH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP031319	Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence	27217-27299	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP029350	Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence	2645-2727	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP023492	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed2, complete sequence	1319-1401	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP014919	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-4, complete sequence	2234-2316	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP035016	Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence	8775-8857	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP020096	Lactobacillus plantarum strain K25 plasmid unnamed3, complete sequence	31875-31957	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NC_015429	Lactobacillus buchneri NRRL B-30929 plasmid pLBUC02, complete sequence	17641-17723	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	10898-10980	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	43774-43856	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP026507	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed2, complete sequence	35987-36069	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	8939-9021	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	41815-41897	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	5943-6025	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	54801-54883	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP019723	Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence	30205-30287	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP028231	Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence	18509-18591	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP053913	Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence	4550-4632	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	20405-20487	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	32434-32516	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP035575	Lactobacillus plantarum strain SRCM103303 plasmid unnamed4	27497-27579	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP013756	Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence	12389-12471	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP013756	Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence	60459-60541	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP013752	Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence	33084-33166	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP023177	Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence	2282-2364	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP028280	Lactobacillus plantarum strain SRCM100995 plasmid unnamed5, complete sequence	15336-15418	23	0.723
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP040738	Lactobacillus futsaii strain Y97 plasmid p2, complete sequence	9385-9467	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP035561	Lactobacillus plantarum strain SRCM103297 plasmid unnamed5	2455-2537	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP035561	Lactobacillus plantarum strain SRCM103297 plasmid unnamed5	44108-44190	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP014884	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-3, complete sequence	21803-21885	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP014875	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-2, complete sequence	21765-21847	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP014627	Lactobacillus backii strain TMW 1.1988 plasmid L11988-3, complete sequence	5895-5977	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP014901	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-2, complete sequence	12372-12454	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP028336	Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence	2281-2363	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP014892	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-2, complete sequence	29785-29867	24	0.711
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NZ_CP032745	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence	39955-40037	34	0.59
NZ_CP019723_1	1.1\|30205\|83\|NZ_CP019723\|CRISPRCasFinder	30205-30287	83	NC_016607	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-4, complete sequence	3707-3789	35	0.578

1. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP031319 (Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

2. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP029350 (Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

3. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP023492 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed2, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

4. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP014919 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-4, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

5. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP035016 (Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

6. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP020096 (Lactobacillus plantarum strain K25 plasmid unnamed3, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

7. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NC_015429 (Lactobacillus buchneri NRRL B-30929 plasmid pLBUC02, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

8. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

9. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

10. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP026507 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed2, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

11. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

12. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

13. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

14. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

15. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP019723 (Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

16. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP028231 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

17. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP053913 (Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

18. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

19. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

20. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP035575 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed4) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

21. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP013756 (Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

22. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP013756 (Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

23. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP013752 (Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

24. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP023177 (Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

25. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP028280 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed5, complete sequence) position: , mismatch: 23, identity: 0.723

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************************************************

26. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP040738 (Lactobacillus futsaii strain Y97 plasmid p2, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccctttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
************************.***********************************

27. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP035561 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed5) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgtatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
******.*****************************************************

28. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP035561 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed5) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgtatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
******.*****************************************************

29. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP014884 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-3, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaaacggacttctcaaaaagagaaacccg	Protospacer
**********************************.*************************

30. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP014875 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-2, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaaacggacttctcaaaaagagaaacccg	Protospacer
**********************************.*************************

31. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP014627 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-3, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaaacggacttctcaaaaagagaaacccg	Protospacer
**********************************.*************************

32. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP014901 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-2, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaaacggacttctcaaaaagagaaacccg	Protospacer
**********************************.*************************

33. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP028336 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgtatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
******.*****************************************************

34. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP014892 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-2, complete sequence) position: , mismatch: 24, identity: 0.711

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
aacccgcatgataccgttgaaccccttggtacaaacggacttctcaaaaagagaaacccg	Protospacer
**********************************.*************************

35. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NZ_CP032745 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence) position: , mismatch: 34, identity: 0.59

aacccgcatgataccg-ttgaaccccttggtacaagcggacttctcaaaaagagaaaccc	CRISPR spacer
-gagccaatgaaatcgcctaaaccccttggtacaagcggacttctcaaaaagagaaaccc	Protospacer
 .  *  **** *.** .*.****************************************

36. spacer 1.1|30205|83|NZ_CP019723|CRISPRCasFinder matches to NC_016607 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-4, complete sequence) position: , mismatch: 35, identity: 0.578

aacccgcatgataccgttgaaccccttggtacaagcggacttctcaaaaagagaaacccg	CRISPR spacer
gagccattaaaatcgcctgaaccccttggtacaagcggacttctcaaaaagagaaacccg	Protospacer
.* **..  .*  *  .*******************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019722

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP019723

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection