CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018846	Pseudomonas putida strain AA7 chromosome, complete genome	2 crisprs	DEDDh,WYL,csa3,cas3,DinG	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018846_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018846_1

1621372-1621445

Orphan

Consensus_repeat	Method
TCATCACCTTTACGTTAACGTAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018846_1

>merge|NZ_CP018846|1|1621372-1621445|CRISPRCasFinder
TCATCACCTTTACGTTAACGTAAACCTGCCATCGGTCACTGTCAATCGGCTCATCACCTTTACGTAAACGTAAA

>NZ_CP018846|1|1|1621372-1621445|CRISPRCasFinder
TCATCACCTTTACGTTAACGTAAA	CCTGCCATCGGTCACTGTCAATCGGC
TCATCACCTTTACGTAAACGTAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018846.1\|WP_079227254.1\|1614804_1615512_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885
NZ_CP018846.1\|WP_079227261.1\|1623637_1625656_+\|alpha-1,4-glucan--maltose-1-phosphate-maltosyltransferase	unknown	unknown	gnl\|CDD\|200482
NZ_CP018846.1\|WP_079227250.1\|1610370_1611519_-\|carboxypeptidase-family-protein	unknown	unknown	gnl\|CDD\|349453
NZ_CP018846.1\|WP_079227267.1\|1636098_1636368_-\|DUF2934-domain-containing-protein	unknown	unknown	gnl\|CDD\|378572
NZ_CP018846.1\|WP_192858691.1\|1623332_1623494_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237940
NZ_CP018846.1\|WP_079227262.1\|1625833_1629151_+\|maltose-alpha-D-glucosyltransferase	unknown	unknown	gnl\|CDD\|274140
NZ_CP018846.1\|WP_079227253.1\|1614404_1614716_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018846.1\|WP_079227266.1\|1633852_1636006_-\|glycogen-debranching-protein-GlgX	unknown	unknown	gnl\|CDD\|131155
NZ_CP018846.1\|WP_079227252.1\|1613454_1613970_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|379797
NZ_CP018846.1\|WP_079227259.1\|1621509_1623189_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP018846.1\|WP_079227264.1\|1631488_1632568_-\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
NZ_CP018846.1\|WP_079227265.1\|1632887_1633682_-\|endonuclease/exonuclease/phosphatase-family-protein	unknown	unknown	gnl\|CDD\|226098
NZ_CP018846.1\|WP_079227256.1\|1617578_1618394_-\|gamma-carboxygeranoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|168168
NZ_CP018846.1\|WP_079227257.1\|1618397_1620005_-\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
NZ_CP018846.1\|WP_079227258.1\|1620024_1621188_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173845
NZ_CP018846.1\|WP_079227251.1\|1612241_1613453_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP018846.1\|WP_079227268.1\|1636382_1639157_-\|malto-oligosyltrehalose-synthase	unknown	unknown	gnl\|CDD\|237740
NZ_CP018846.1\|WP_079227249.1\|1609347_1610313_+\|spore-coat-protein-U-domain-containing-protein	unknown	unknown	gnl\|CDD\|368347
NZ_CP018846.1\|WP_079227255.1\|1615629_1617582_-\|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha	unknown	unknown	gnl\|CDD\|227111
NZ_CP018846.1\|WP_079227263.1\|1629151_1631362_+\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445

Protein	Function_ID	Function_description	E-value
NZ_CP018846.1\|WP_079227254.1\|1614804_1615512_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	3.8196e-15
NZ_CP018846.1\|WP_079227261.1\|1623637_1625656_+\|alpha-1,4-glucan--maltose-1-phosphate-maltosyltransferase	gnl\|CDD\|200482	cd11344, AmyAc_GlgE_like, Alpha amylase catalytic domain found in GlgE-like proteins. GlgE is a (1,4)-a-D-glucan:phosphate a-D-maltosyltransferase, involved in a-glucan biosynthesis in bacteria. It is also an anti-tuberculosis drug target. GlgE isoform I from Streptomyces coelicolor has the same catalytic and very similar kinetic properties to GlgE from Mycobacterium tuberculosis. GlgE from Streptomyces coelicolor forms a homodimer with each subunit comprising five domains (A, B, C, N, and S) and 2 inserts. Domain A is a catalytic alpha-amylase-type domain that along with domain N, which has a beta-sandwich fold and forms the core of the dimer interface, binds cyclodextrins. Domain A, B, and the 2 inserts define a well conserved donor pocket that binds maltose. Cyclodextrins competitively inhibit the binding of maltooligosaccharides to the S. coelicolor enzyme, indicating that the hydrophobic patch overlaps with the acceptor binding site. This is not the case in M. tuberculosis GlgE because cyclodextrins do not inhibit this enzyme, despite acceptor length specificity being conserved. Domain C is hypothesized to help stabilize domain A and could be involved in substrate binding. Domain S is a helix bundle that is inserted within the N domain and it plays a role in the dimer interface and interacts directly with domain B. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP018846.1\|WP_079227250.1\|1610370_1611519_-\|carboxypeptidase-family-protein	gnl\|CDD\|349453	cd06234, M14_PaCCP-like, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases similar to Pseudomonas aerugnosa CCP (PaCCP). A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins. This subgroup includes PaCCP from Pseudomonas aeruginosa, a carboxypeptidase homologous to M14D subfamily of human CCPs. Structural complexes with well-known inhibitors of metallocarboxypeptidases indicate that PaCCP might only possess C-terminal hydrolase activity against cellular substrates of particular specificity. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins (such as alpha-tubulin in eukaryotes) to remove a C-terminal tyrosine. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain.	1.52757e-137
NZ_CP018846.1\|WP_079227267.1\|1636098_1636368_-\|DUF2934-domain-containing-protein	gnl\|CDD\|378572	pfam11154, DUF2934, Protein of unknown function (DUF2934). This bacterial family of proteins has no known function.	2.69893e-09
NZ_CP018846.1\|WP_192858691.1\|1623332_1623494_-\|hypothetical-protein	gnl\|CDD\|237940	PRK15313, PRK15313, intestinal colonization autotransporter adhesin MisL.	8.26158e-05
NZ_CP018846.1\|WP_079227262.1\|1625833_1629151_+\|maltose-alpha-D-glucosyltransferase	gnl\|CDD\|274140	TIGR02456, Trehalose_synthase, trehalose synthase. Trehalose synthase interconverts maltose and alpha, alpha-trehalose by transglucosylation. This is one of at least three mechanisms for biosynthesis of trehalose, an important and widespread compatible solute. However, it is not driven by phosphate activation of sugars and its physiological role may tend toward trehalose degradation. This view is accentuated by numerous examples of fusion to a probable maltokinase domain. The sequence region described by this model is found both as the whole of a trehalose synthase and as the N-terminal region of a larger fusion protein that includes trehalose synthase activity. Several of these fused trehalose synthases have a domain homologous to proteins with maltokinase activity from Actinoplanes missouriensis and Streptomyces coelicolor (). [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP018846.1\|WP_079227266.1\|1633852_1636006_-\|glycogen-debranching-protein-GlgX	gnl\|CDD\|131155	TIGR02100, Glycogen_operon_protein_GlgX_homolog, glycogen debranching enzyme GlgX. This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP018846.1\|WP_079227252.1\|1613454_1613970_-\|DUF4880-domain-containing-protein	gnl\|CDD\|379797	pfam16220, DUF4880, Domain of unknown function (DUF4880). This domain can be found on the N-terminal of uncharacterized proteins from various Rhodopseudomonas and Pseudomonas species, often, but not always followed by the ron siderophore sensor protein family (FecR, PF04773). The function of this domain is unknown.	3.1336e-07
NZ_CP018846.1\|WP_079227259.1\|1621509_1623189_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP018846.1\|WP_079227264.1\|1631488_1632568_-\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	2.29576e-29
NZ_CP018846.1\|WP_079227265.1\|1632887_1633682_-\|endonuclease/exonuclease/phosphatase-family-protein	gnl\|CDD\|226098	COG3568, ElsH, Metal-dependent hydrolase [General function prediction only].	1.07005e-69
NZ_CP018846.1\|WP_079227256.1\|1617578_1618394_-\|gamma-carboxygeranoyl-CoA-hydratase	gnl\|CDD\|168168	PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated.	0
NZ_CP018846.1\|WP_079227257.1\|1618397_1620005_-\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NZ_CP018846.1\|WP_079227258.1\|1620024_1621188_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|173845	cd01156, IVD, Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA. IVD is a homotetramer and has the greatest affinity for small branched chain substrates.	0
NZ_CP018846.1\|WP_079227251.1\|1612241_1613453_+\|MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.88486e-64
NZ_CP018846.1\|WP_079227268.1\|1636382_1639157_-\|malto-oligosyltrehalose-synthase	gnl\|CDD\|237740	PRK14511, PRK14511, malto-oligosyltrehalose synthase.	0
NZ_CP018846.1\|WP_079227249.1\|1609347_1610313_+\|spore-coat-protein-U-domain-containing-protein	gnl\|CDD\|368347	pfam05229, SCPU, Spore Coat Protein U domain. This domain is found in a bacterial family of spore coat proteins, as well as a family of secreted pili proteins involved in motility and biofilm formation. This family is distantly related to fimbrial proteins.	1.42766e-19
NZ_CP018846.1\|WP_079227255.1\|1615629_1617582_-\|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha	gnl\|CDD\|227111	COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism].	0
NZ_CP018846.1\|WP_079227263.1\|1629151_1631362_+\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0

>NZ_CP018846.1|WP_079227258.1|1620024_1621188_-|isovaleryl-CoA-dehydrogenase
MHYPSLNFALGETIDMLRDQVRTFVAAELAPRAAQIDHDNLFPADMWRKFGDMGLLGITVPEEYGGAGLGYLAHVVSMEEISRGSASVALSYGAHSNLCVNQINRNGTHEQKLKYLPKLISGEHIGALAMSEPNAGSDVVSMKLRAEKRGDHYVLNGSKTWITNGPDANTYVIYAKTDLDKGAHGITAFIVERDWKGFSRSNKFDKLGMRGSNTCELFFDDVEVPAENILGQLNGGVRVLMSGLDYERVVLSGGPTGIMQSCMDLVVPYIHDRKQFGQSIGEFQLIQGKIADMYTQLNASRAYLYAVAQACDRGETTRKDAAGVILYTAERATQMALEAIQILGGNGYINEFPAGRLLRDAKLYEIGAGTSEIRRMLIGRELFNETR
>NZ_CP018846.1|WP_079227257.1|1618397_1620005_-|methylcrotonoyl-CoA-carboxylase
MATLHTQINPRSAEFAGNSAAMLEQVQALRGLLAQVAQGGGPKAQERHTSRGKLLPRERIDRLLDPGSPFLEIGQLAAHDVYGEDVPAAGVIAGIGRVEGVECMIVANDATVKGGSYYPLTVKKHLRAQTIALQNRLPCIYLVDSGGANLPRQDEVFPDREHFGRIFFNQANMSALGIPQIAVVMGSCTAGGAYVPAMADEAIMVRQQATIFLAGPPLVKAATGEVVSAEDLGGADVHCRTSGVADHYADNDEHALAIARRSVANLNWHKLGKLQRQAPVAPLYSADELYGVVPADAKQPFDVREVIARLVDGSAFDEFKALFGTTLVCGFAHLHGYPVAILANNGILFAEAAQKGAHFIELACQRGIPLLFLQNITGFMVGKKYEEGGIAKHGAKLVTAVACAQVPKFTVIIGGSFGAGNYGMCGRAYDPRFLWMWPNARIGVMGAEQAAGVLAQVKREQSERSGQAFSAEDEARLKQPILDQYEHQGHPYYSSARLWDDGVIDPAQTRDVLGLALSAALNAPIEQSRFGIFRM
>NZ_CP018846.1|WP_079227256.1|1617578_1618394_-|gamma-carboxygeranoyl-CoA-hydratase
MSDFSTLEVTRDPRGFATLWLSREDKNNAFNALMIRELIVALDQLAEDTSLRFLLLRGRGRHFSAGADLAWMQQSAQLDFNTNLDDARELGELMYALHRLKAPTLAVVQGAAFGGALGLISCCDMAIGAEDAQLCLSEVRIGLAPAVISPFVVKAIGERAARRYALTAERFSGVRARELGLLAEVYPAAELDAQVEAWVSNMLQNSPQALRATKDLLREVDDGELSPALRRYCENTIARIRVSAEGQEGLRAFLEKRRPAWQIDDKKEPRP
>NZ_CP018846.1|WP_079227255.1|1615629_1617582_-|acetyl/propionyl/methylcrotonyl-CoA-carboxylase-subunit-alpha
MSRPALTTLLVANRGEIACRVMRTAKAMGLATVAVHSATDRDARHSREADIRIDLGGSKAADSYLVVDKILAAAKASGAQAIHPGYGFLSENAGFARAIEAAGLIFLGPPASAIDAMGSKSAAKALMEDAGVPLVPGYHGEAQDLDTFRAAAERIGYPVLLKASAGGGGKGMKVVEEESQLADALASAQREAQSSFGDARMLVEKYVLKPRHVEIQVFADQHGNCLYLNERDCSIQRRHQKVVEEAPAPGLSAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVEHPVTEAITGLDLVAWQIRVACGEPLPITQEQVPLIGHAIEVRLYAEDPANEFLPATGKLVLYRESAPGEGRRVDSGVSEGDEVSSFYDPMLGKLIAWGQDREQARLRLLAMLDEFAIGGLKTNIAFLRRILAHPAFAAAELDTGFIPRHQATLLPPPQALPAGFWEAAAEAWLQGEAPHQRADDSRSPWAERNGLRLGLPARSSLHLVSGGESQAVALERSAASNWQLHGEQLGHDQGGIRRRYLAVRRGGTLFLRWDGEMHAVETFDPIAEAEASHSHQGGLGAPMNGSIVRVMVEPGQVVEAGTALVVLEAMKMEHSIRAPHAGTVKALFCQEGDMVSEGTVLVELAE
>NZ_CP018846.1|WP_079227254.1|1614804_1615512_+|helix-turn-helix-domain-containing-protein
MFIERQKAVRIVPAMNMDKWIALVRDRMEELGLTQEQLAERVGVSQGSVGHWVNKRRQPKIESMNRTFVEIGMPHYSVSLQLRIHGEVGEERGLYEVGDSDDDLDLMQYIVCFRYPVLAWDELSAAEIAAPGVFEQTDYLAQGKAFWLTVENDAMSSASGRSVPQGMRVLVDPGLEVEPGRLVIARQPGKTAILRELAEEGGQQYLKALNGSYPTLVCEAGCEFLGVVVRVHGTF
>NZ_CP018846.1|WP_079227253.1|1614404_1614716_-|hypothetical-protein
MKPPKDDVTDLDSEAARRALDYYLNPNPTRPTAHTQIWTLHAGVTAEQAQDHAIELLRCAAATAHETATHQEGSTRELTFALMHMIDMARALLEHRRALQNGL
>NZ_CP018846.1|WP_079227252.1|1613454_1613970_-|DUF4880-domain-containing-protein
MSRLLLPLEHPTPASEHAAENELLYALKRLPRRVQQVFLLNRLDQLDFASIAKRLDLPLLSIERNMNQALQVAQPRGDALASVAGQWYVRLQSPDVTSCERIDFRRWLDAAPAHLQAFHATELRWRSLLAPARELGHDGWYRQGRAAISVGGCSVAVGLGVAALLLFGYWA
>NZ_CP018846.1|WP_079227251.1|1612241_1613453_+|MFS-transporter
MNRRDVSQSTRCYVLLLLLISLLGVFPLDVILPSVPLLAQDFGVDAQYIAYSISLFAVGVAISQTIIGPLSDRMGRKRLLIAGLVVSAVGALGCILATSYEGFMTFRLLQAVGCGCFVLSQALVQDKFNGRQRNAMRILMTSASGLFISLSPLAGSVLQQYFGWAGSFQAFVVLAVVVLVLSMKLLQERPTANSSAGVLSSYQALLKDRAFLVSSLFSCLAFACHFSFVVVSPLLLIEQLGLTEFAFSMVFLGYGLAYMVGGFIASWLNGRMGMQAQVAWGFALIGLAGVALCLVVTVHELEVFSLLLPLVLCTIGTTIVRPAATTHALGLHPGRAGAAASLNNTILFAFGGGASVLVASISGSLPMSLALGFIASSITGWYLLVYLKGLERKARVAEAPVGL
>NZ_CP018846.1|WP_079227250.1|1610370_1611519_-|carboxypeptidase-family-protein
MTVTLSPLQIDCDFDSGNIQVLDASNPAQVRLAIRPDTNSGHFQWFHFKVSGLTPGQVHRFSLDNASESSYKNAWSGYNAVASYDQQTWFRVPSQFDGKALSFEIKAEQAQVWFAYFEPYPRARHNQLIERAQQIPGVELLAHGRSVQGRDIPLLRAGDGAEGKRKLWLIAQQHPGEHMAEWFMEGVIDRLQANDPTVRELLEKADLYLIPNMNPDGAFLGHLRTNFKGKDLNRAWQDASVELSPEVFFAQAQMKQYGVDAFIDVHGDEEIPHVFTAACEGNPGYTPRLAKLEEQFRTTLCSVTKDFQTVHGYTRDEPGQANTTLACNAVGMAYDCLSLTLEMPFKDHDDAPEPVAEWSGARSKALAGAVLETLLKMVGDLR
>NZ_CP018846.1|WP_079227249.1|1609347_1610313_+|spore-coat-protein-U-domain-containing-protein
MKRLWCALLMLPAGSAWALCSSVPTLPAAFGTINSTLVRTTVQTASSTNSGLQCTGSLLSLLTSTDHFNATITSATGTSGLVGPTGDVIGYTLYADNSTNYPISRGVQFDFARNGILDLLGLLGGTTPKSVPLYLRTQVGSNVAAGLYQENLTVAWSWNYCSGIGVGAICLGRDIGSGTQNLTVTLTVSNDCQITTPNISFGSAPVVAGFGTVSQSVSLSCTKGSAYTVGLNDGENVSGGRRRMKSSAGNYLAYDIFKSAGTVPWGSLTTARRSSSDADVNPGNGTGTGSQIFNYNAKVYTDQTTPPAASYLDNVILDVQF
>NZ_CP018846.1|WP_079227259.1|1621509_1623189_+|AMP-binding-protein
MSQPSYTRGRQDQPLLTQTIGQAFDATVARCADGEALVVRHQGLRYSWRQLAEQVDLHARALMALGVNTGDRVGIWSPNCAQWCILQLASAKVGAILVNINPAYRMGELEYVLRQSSCRWLVCADAFKTSDYHAMVRELAPELAHAAPGELACERLPGLRGVISLAAQPPAGFLPWHTLAERAGQASAEAYTARQQTLQFDQPVNIQYTSGTTGAPKGATLSHYNILNNGFMVGESLGLNERDRMVIPVPLYHCFGMVMANLGCITHGSTMVYPNDAFDAELTLRAVAEERASILYGVPTMFIAMLDHPSRQQLDLSTLRSGIMAGATCPIEVMRRVIDQMHMAEVQIAYGMTETSPVSLQTGPDDELELRVTTVGRTQPQLETKLVDADGCIVPRGEIGELCTRGYSVMLGYWDNLQATADAIDPAGWMHSGDLAVMDEHGHVRIVGRNKDMIIRGGENIYPRELEEFFYTHPAVADAQVVGIPCSRYGEEIVAWIKLHPGHSATVEELQGWCKARIAHFKVPRHFRFVDEFPMTVTGKVQKFRMREISVAEIAVVTA
>NZ_CP018846.1|WP_192858691.1|1623332_1623494_-|hypothetical-protein
MNIPIPPETPDPNIDDPSLPPPVPEQEPDELPIKPTMPPTVGDPPSEEPPVKA
>NZ_CP018846.1|WP_079227261.1|1623637_1625656_+|alpha-1,4-glucan--maltose-1-phosphate-maltosyltransferase
MTRNEPFESVPTANDHPDQAISLSQALLAPRIVIEDTQPVLEAGTFAAKAVSGQQVAVSSKVYSDGHDRLAVMLNWRQANSRRWHCVPMHSPGNDLWLAEFTPTELGLHLFSIEAWIDPFATYCHDLERKYHAGVEVKLELEEGRLLLGQGAERSEGALREQIEGLQARLPGLSQDDQVALLLGPEATRLMTEAEHRSYLTRSIEFPLDVDRPAALFASWYELFPRSITDSPERHGTFNDVHGRLPMIRDMGFDVLYFPPIHPIGKKHRKGRNNALQAEPNDPGSPYAIGSPEGGHDAIHPELGTREDFRRLVAAAAEHGLEIALDFAIQCSQDHPWLQEHPGWFSWRPDGTIRYAENPPKKYQDIVNVDFYAAEAVPSLWLALRDVVVGWVEEGVKTFRVDNPHTKPLPFWQWLIANVRSQHPEVIFLAEAFTKPAMMARLGKVGYAQSYTYFTWRNSKQELREYFEELNQPPWSQCYRPNFFVNTPDINPYFLQTSGRAGFLIRAALATMGSGLWGMYSGFELCEGTPLPGKEEYLDSEKYEIRPRDFTQPGNIIAEIAQLNRIRRQNRALQTHLGVAFFNCWNDNILYFAKRTPERDNYILVAISLDPHNAQEASFELPLWELGLEDNADTQGEDLMTGHRWTWHGKTQWMRIEPWHQPFGIWRIEKAH
>NZ_CP018846.1|WP_079227262.1|1625833_1629151_+|maltose-alpha-D-glucosyltransferase
MAKRSRPAAFIDDPLWYKDAVIYQLHIKSFFDANNDGIGDFAGLISKLDYIAELGVNTLWLLPFYPSPRRDDGYDIADYKAVHPDYGSMADARRFIAEARKRGLRVITELVINHTSDQHPWFQRARHAKRGSKARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDAVAGQYFWHRFYAHQPDLNFDNPQVMKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLPETHRVLKAIRAEIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPLLQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRADPQRLVLPPIMDPLYGYQTVNVEAQAHDPHSLLNWNRRLLAVRKQQKAFGRGSLRTLTPSNRRILAYIREYTDADGNTEVILCVANVSRAAQAAELELSQYAGKVPVEMLGGSAFPPIGQLPFLLTLPPYAFYWFLLAAHDRMPSWHIQATEGLPELTTLVLRKRMEELLESPSSGTLHGTILPQYLPKRRWFAGKESPIDQVRLRYGVRFGTATTPVLLSEIEVLSDGVANQYQLPFGLLPEDQINTALPQQLALSRVRRGRQVGLITDAFVLEPFIRAVLRACQEGMHLPCGNGQGELHFACTAQLAGLELNEESEVRYLSAEQSNSSVVIGDRVVLKLIRRVNPGIHPELEMSAYLTAAGFANISPLLAWVSRVDEQGAPHLLMIAQGYLSNQGDAWAWTQNTLERAIRDEMEPTRVDPEAHTDALAELNGFAALLGQRLGEMHLLLAAPSNDEAFQPRPSDGNDSQRWSAQISAELNHALDLLAQHREHLDPDSQALVDDLQQQRDGLAQHVARLAEQAQGGLLMRVHGDLHLGQVLVVQGDAYLIDFEGEPSRPLDERRAKHSPYKDVSGVLRSFDYAAAMILRSASAVDLSGPARQARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQQAEGERAALELFCLEKAAYEITYEAENRPSWLAVPLHGLHGLISTWGES
>NZ_CP018846.1|WP_079227263.1|1629151_1631362_+|1,4-alpha-glucan-branching-protein-GlgB
MNATTRENGGLRQRDLDALARAEHADPFAVLGPHADGQGGLLVRAYLPNALNVRVLARHDGRILAEMVQGSLPGLFSAHLDEAQPYLLQVGWAGGEQVTEDPYSFGPQLGDMDLYLFAEGNHRDLSGRFGAQPTQVDGVDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHSAGVWELFVPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGELSHGWQDHDWMEHRAQRHAYSAPLSIYELHPGSWQCELDELGEVSRYYNWRELAERLVPYVQQLGFTHIELLPIMEHPFGGSWGYQPLSLFAPTSRYGSAEDFAFFVDACHQGGIGVILDWVPAHFPTDEHGLARFDGTALYEYDNPLEGFHQDWNTLIYNLGRNEVRGFMLASALHWLKHFHVDGLRVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFIRHLNGIAAHEAPGALIIAEESTAWPGVSQPTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRTYHHNEMSFGLIYAYSEHFILPISHDEVVHGKHSLIDKMPGDRWQKFANLRAYLTFMWTHPGKKLLFMGCEFGQWREWNHDHQLDWYLLQYPEHQGVQRLVGDLNRLYRELPALHEQDCQPQGFQWLIGDDAHNSVYAWLRWSSQGEPLLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVESDEVASHGQPLSLALNLPPLGVLVMKPA
>NZ_CP018846.1|WP_079227264.1|1631488_1632568_-|autotransporter-outer-membrane-beta-barrel-domain-containing-protein
MKRTSNPLRFDHIFYAVSTSMLLATPVETFAFELQEDPISPRYLQQATVPTLSLDPVSASGLNLGTLNAFSEKMGERHNAMAPDLAGNQWAQFFPGITPQPGARAPDQLEAPSQQLMIGPDLFVRETAGGNVHRAGIFVGHNNLQSSFNGVRPLLGDKQRNAVNLSGESLGVYWSMTHEQGWHLDAVAMGSRIEVMGRGDSGQRLDDSGHAMTFSLEGGYPIGLGGGWVIEPQAQLINQQFFPGSQVQEETLQAFDSQPSWSGRVGAKLSGRYEVKGMPIEPYVRTNVWYDFNDTSEVKLDQVDKISSSRYSTTVELGLGLVARVTPSVALFVSADYSSDVDGNDINGLIGSLGVRMRW
>NZ_CP018846.1|WP_079227265.1|1632887_1633682_-|endonuclease/exonuclease/phosphatase-family-protein
MNLEAGSPGFTSTRQAPPVKRLRVLTVNTHKGFTAFNRRFILPELREAVRSTQADIVFLQEVLGSHDRHAARYPGWPQTSQYEFLADSMWSDFAYGRNAVYPDGHHGNALLSKYPIIEHRNLDVSITGPERRGLLHCILDVPGQHKVHAICVHLSLLESHRQKQLHLLRQLLDALPADAPVIIAGDFNDWQQHGNRTLHLQRDLHEAFERHHGLLARTYPARLPLLRLDRIYLRNADSHAPQILGHKPWTHLSDHLPLAVEVRL
>NZ_CP018846.1|WP_079227266.1|1633852_1636006_-|glycogen-debranching-protein-GlgX
MSPRTPKKTRSVAPSRIREGMPFPLGATWDGLGVNFALFSANATKVELCLFDSTGEQEIERIELPEYTDEIYHGYLPDAHPGLVYGYRVYGPYEPENGHRFNPNKLLIDPYAKQLVGSLKWSEALFGYTIGHPDGDLSFDERDSAPFVPKCKVIDPAFTWGRDQRVLIPWERTIIYEAHTRGISMRHPAVPEELRGTFAGLANDELLKHIKDLGVSSIELLPIHAFVNDQHLLDKGLNNYWGYNSIAFFAPHPRYLASGKIAEFKEMVAHLHDAGLEVILDVVYNHTAEGNERGPTLSMRGIDNASYYRLMPDDKRYYINDSGTGNTLDLSHPCVLQLVTDSLRYWAGEMHVDGFRFDLATILGRYHDGYSERHGFLVACRQDPMLSQVKLIAEPWDCGPGGYQVGNFAPGWAEWNDRFRDTARAFWKGDEGQLADFAARMTASGDMFNNRGRRPYSSVNFITAHDGFTLRDLVSYNSKHNEDNDENNQDGTDNNLSWNCGVEGPTDDPQINALRMRQMRNYFATLLLAQGTPMIVAGDEFSRTQHGNNNAYCQDSEIGWVNWDLDQDGKELLAFVKRLTRLRLAYPVLRRSRFLVGDYNEAIGVKDVTWLAPDGSEMSVEQWEDPHGRCLGMLIDGRAQVSGIARPGAEATVLLIVNAHHDIVPFKLPTVPEGEYWSCLVDTDRPELRKGQHLQFDTTFEVKGRSMLLMVLQREEE
>NZ_CP018846.1|WP_079227267.1|1636098_1636368_-|DUF2934-domain-containing-protein
MMSVDEKRIREFAYQIWESEGKPAGQEDRHWEMARKLAEAEALAPKAAPRKRAPAKPKVAAEQKAAALPGASKPVAAKKPRAVKKPTAG
>NZ_CP018846.1|WP_079227268.1|1636382_1639157_-|malto-oligosyltrehalose-synthase
MKPLTATLRLQFHREFSLDDAVPLVPYFAQLGISHLYASPILKARAGSRHGYDVVDPTCVNPELGGEAALQRLVAALRQHGMGLILDTVSNHMAVGGADNPWWQSLLAWGRRSPYAEFFDIQWHSSDPLLAGQLLLPFLGSDYGAALKNGEVPLQFDQQSGLLQVAHYEHRFPICPLDYGWILAQSPEPALKALAEHFTALRDAAEPLADALPLHAELARLVREGADLQSALVAFDSRSENGFKRLHLLLERQTYRLASWRTAADDINWRRFFDINELGGLRVERAVVFEATHAKLFELVERGLVDGLRIDHIDGLADPRGYCRKLRRRVDSLLAKRPLHAALEHFPIYVEKILGADEHLHRDWLTDGTTGYEFMNQVSLLQHDPAGEGPLTELWATVSERPDFPEEVRLARHLVLNASLAGDCESVAQALLQVARDDLMTRDLTLGAIRRALQALVAHYPVYRTYFNACGRPAEDERFFQQALAHARQDLGEADWPLLDQLEQWLGGQPWRQMPPGRPRKHLRHACVRFQQLTAPSAAKAVEDTAFYRSARLLSRNDVGFEAERFSADTEHFHNEAQRRLRDFPDNLLATATHDHKRGEDSRARLAVLSERGPWFASRVEHWRELTAPLREQLDDGVAPSPGDELLLLQTLLGSWPLTLDLHDDNALRQYAERIRQWQQKALREAKLRSSWSAPNEAYEAACAAYVDGLLLERENQQLRQSLADAAQLIACPGALNGLVQSLLRMTVPGVPDLYQGNEYWDFSLVDPDNRRAVDYACRRRTLDDASAPGELLAHWRDGRIKQALIARVLDCRQAHAELFRRGAYLPLNVQGRHADQVIAFARLGEEQRAIVVAPRLASGLLGGATTPLIPAQNWDDTRVILPFALSPANSTGLFSSAAVSPSRELLLSALLAEFPVNLLIQQS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018846_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018846_2

2015924-2015994

Orphan

Consensus_repeat	Method
TGTTCTTGAGGAGGCCCACAGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018846_2

>merge|NZ_CP018846|2|2015924-2015994|CRISPRCasFinder
TGTTCTTGAGGAGGCCCACAGGTGCACCACAAGTTTCGAATTCAGTGGTGTTCTTGAAGAGGCCCACAGGT

>NZ_CP018846|2|2|2015924-2015994|CRISPRCasFinder
TGTTCTTGAGGAGGCCCACAGGT	GCACCACAAGTTTCGAATTCAGTGG
TGTTCTTGAAGAGGCCCACAGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018846.1\|WP_027919924.1\|2011329_2012139_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098
NZ_CP018846.1\|WP_079227551.1\|2021293_2021890_-\|sarcosine-oxidase	unknown	unknown	gnl\|CDD\|282168
NZ_CP018846.1\|WP_079227548.1\|2018377_2018767_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018846.1\|WP_079227542.1\|2010161_2011310_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP018846.1\|WP_060484815.1\|2015559_2015853_+\|DUF1330-domain-containing-protein	unknown	unknown	gnl\|CDD\|377765
NZ_CP018846.1\|WP_079227540.1\|2007927_2009028_-\|tartrate-dehydrogenase	unknown	unknown	gnl\|CDD\|273963
NZ_CP018846.1\|WP_079227554.1\|2025111_2026353_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|273585
NZ_CP018846.1\|WP_079227555.1\|2026334_2027246_-\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase-FolD	unknown	unknown	gnl\|CDD\|172682
NZ_CP018846.1\|WP_079227546.1\|2016063_2016786_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|380375
NZ_CP018846.1\|WP_079227543.1\|2012145_2013063_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NZ_CP018846.1\|WP_079227545.1\|2014359_2015481_-\|bifunctional-3,4-dihydroxy-2-butanone-4-phosphate-synthase/GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|171535
NZ_CP018846.1\|WP_079227547.1\|2017035_2018385_+\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NZ_CP018846.1\|WP_079227538.1\|2005349_2006393_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|274743
NZ_CP018846.1\|WP_079227541.1\|2009124_2010036_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176168
NZ_CP018846.1\|WP_079227550.1\|2020282_2021167_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP018846.1\|WP_079227549.1\|2019116_2020136_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369561
NZ_CP018846.1\|WP_079227553.1\|2024793_2025099_-\|sarcosine-oxidase-subunit-delta	unknown	unknown	gnl\|CDD\|377276
NZ_CP018846.1\|WP_079227539.1\|2006552_2007860_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270371
NZ_CP018846.1\|WP_079227544.1\|2013059_2014085_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270307
NZ_CP018846.1\|WP_079227552.1\|2021893_2024797_-\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|273584

Protein	Function_ID	Function_description	E-value
NZ_CP018846.1\|WP_027919924.1\|2011329_2012139_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	2.3814e-74
NZ_CP018846.1\|WP_079227551.1\|2021293_2021890_-\|sarcosine-oxidase	gnl\|CDD\|282168	pfam04268, SoxG, Sarcosine oxidase, gamma subunit family. Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD(+). This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H2O2, and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O2.	0.000743281
NZ_CP018846.1\|WP_079227554.1\|2025111_2026353_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|273585	TIGR01373, Sarcosine_oxidase_subunit_beta, sarcosine oxidase, beta subunit family, heterotetrameric form. This model describes the beta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms. [Energy metabolism, Amino acids and amines].	8.40938e-150
NZ_CP018846.1\|WP_079227542.1\|2010161_2011310_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	2.38312e-150
NZ_CP018846.1\|WP_060484815.1\|2015559_2015853_+\|DUF1330-domain-containing-protein	gnl\|CDD\|377765	pfam07045, DUF1330, Domain of unknown function (DUF1330). This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.	1.75402e-44
NZ_CP018846.1\|WP_079227540.1\|2007927_2009028_-\|tartrate-dehydrogenase	gnl\|CDD\|273963	TIGR02089, Probable_tartrate_dehydrogenase/decarboxylase, tartrate dehydrogenase. Tartrate dehydrogenase catalyzes the oxidation of both meso- and (+)-tartrate as well as a D-malate. These enzymes are closely related to the 3-isopropylmalate and isohomocitrate dehydrogenases found in TIGR00169 and TIGR02088, respectively. [Energy metabolism, Other].	0
NZ_CP018846.1\|WP_079227555.1\|2026334_2027246_-\|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase-FolD	gnl\|CDD\|172682	PRK14194, PRK14194, bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD.	0
NZ_CP018846.1\|WP_079227546.1\|2016063_2016786_-\|pirin-family-protein	gnl\|CDD\|380375	cd02910, cupin_Yhhw_N, Escherichia coli YhhW and YhaK and related proteins, pirin-like bicupin, N-terminal cupin domain. This family includes the N-terminal cupin domains of YhhW and YhaK, Escherichia coli pirin-like proteins with unknown function. YhhW is structurally similar not only to human pirin but also to quercitin 2,3-dioxygenase (quercitinase). Although the function of YhhW is not completely understood, YhhW and its human ortholog have quercitinase activity and are likely to play an important role in transcription and apoptosis. This N-terminal cupin domain of YhhW has a metal coordination site and is thought to have catalytic activity while the C-terminal cupin-like domain has diverged considerably and has closer alignment with C-terminal pirin. YhaK is found in low abundance in the cytosol of E. coli and is strongly up-regulated by nitroso-glutathione (GSNO). There are major structural differences at the N-terminus of YhaK compared with YhhW; YhaK lacks the canonical cupin metal-binding residues of pirins and may be involved in chloride binding and/or sensing of oxidative stress in enterobacteria. YhaK showed no quercetinase and peroxidase activity; however, reduced YhaK was very sensitive to reactive oxygen species (ROS). Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.26072e-72
NZ_CP018846.1\|WP_079227543.1\|2012145_2013063_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	2.6444e-81
NZ_CP018846.1\|WP_079227545.1\|2014359_2015481_-\|bifunctional-3,4-dihydroxy-2-butanone-4-phosphate-synthase/GTP-cyclohydrolase-II	gnl\|CDD\|171535	PRK12485, PRK12485, bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II.	0
NZ_CP018846.1\|WP_079227547.1\|2017035_2018385_+\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	8.49986e-22
NZ_CP018846.1\|WP_079227538.1\|2005349_2006393_-\|TerC-family-protein	gnl\|CDD\|274743	TIGR03718, R_switched_Alx, integral membrane protein, TerC family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains TerC itself from Alcaligenes sp. plasmid IncHI2 pMER610 and from Proteus mirabilis. It also contains the alkaline-inducible E. coli protein Alx, which unlike the two TerC examples is preceded by a yybP-ykoY leader.	8.01142e-148
NZ_CP018846.1\|WP_079227541.1\|2009124_2010036_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176168	cd08479, PBP2_CrgA_like_9, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.62521e-100
NZ_CP018846.1\|WP_079227550.1\|2020282_2021167_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.48537e-92
NZ_CP018846.1\|WP_079227549.1\|2019116_2020136_-\|alpha/beta-hydrolase	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	5.4896e-93
NZ_CP018846.1\|WP_079227553.1\|2024793_2025099_-\|sarcosine-oxidase-subunit-delta	gnl\|CDD\|377276	pfam04267, SoxD, Sarcosine oxidase, delta subunit family. Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD(+). This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H2O2, and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O2.	7.11689e-36
NZ_CP018846.1\|WP_079227539.1\|2006552_2007860_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.98514e-74
NZ_CP018846.1\|WP_079227544.1\|2013059_2014085_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270307	cd13589, PBP2_polyamine_RpCGA009, The periplasmic-binding component of an uncharacterized ABC transport system from Rhodopseudomonas palustris CGA009 and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic binding domain that serves as the primary high-affinity receptor of an uncharacterized ABC-type polyamine transporter from Rhodopseudomonas palustris Cga009 and related proteins from other bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.30943e-93
NZ_CP018846.1\|WP_079227552.1\|2021893_2024797_-\|(2Fe-2S)-binding-protein	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	0

>NZ_CP018846.1|WP_060484815.1|2015559_2015853_+|DUF1330-domain-containing-protein
MKAYWIAHVDVTDPEQYQQYTQRAPAAFKAFGGRFLARGGRSEALEGRPTPQRSVVIEFDSYEQALACYRSELYQEACSHRQGVAKAEVIIVEGFEP
>NZ_CP018846.1|WP_079227545.1|2014359_2015481_-|bifunctional-3,4-dihydroxy-2-butanone-4-phosphate-synthase/GTP-cyclohydrolase-II
MAFNTIEELLEDYQQGKMVLLVDDEDRENEGDLLIAAERCDAQAINFMAREARGLICLTLTDEHCQRLGLEQMVPANGSVFSTAFTVSIEAASGVTTGISAADRARTVAAAMAPDARPEDLVQPGHIFPLRAREGGVLTRAGHTEAGCDLARLAGFTPASVIVEVLNDDGTMARRPDLEVFAAQHGIKIGTIADLIHYRLSTEQTIKRIGERELPTVHGTFRLVTYEDRIEGGVHMAMVMGDIRREQPTLVRVHVIDPLRDLVGAEYAGPANWTLWAALQKVAEEGAGVVVILANHESSQALLERVPQLTQPVRPYQRGQSKVYSEVGTGAQILQDLGVGKLRHLGPPLKYAGLAGYELEVVQSIPFEPGMVG
>NZ_CP018846.1|WP_079227544.1|2013059_2014085_-|polyamine-ABC-transporter-substrate-binding-protein
MLLSKRVTAVLSASLLTLACQAAQAADSLNFVSWGGTTQDAQKEAWAVPFSKSTDIKVVQDGPTDYGKLKAMVESGNVQWDVVDVEADFALRAASEGLLEPLDFNQIKRDKIDPRFVSDHGVGSFFFSFVLGYNEGKLGANKPVDWTALFDTKTYPGKRALYKWPSPGVLELALLADGVAPKDLYPLDLDRAFKKLDTIKKDIVWWGGGAQSQQLLASGEASLGQFWNGRVYALQQDGAPVGVSWKQNLVMADFLVIPKGSKNKDAAMKFLANASSAEGQAAFANKTAYAPVNLDSVAKLDKDLAPNLPTAYAQDQVTLDFAYWAKNGQAIAARWNEWLVK
>NZ_CP018846.1|WP_079227543.1|2012145_2013063_-|ABC-transporter-permease
MKVAINALHNAQGAPTGTGAPGTATRRVSLSQRWKGSRNLLPALLFLGLFFFAPLVGLLLRGVLEPTPGLGNYEQLFANSAYARVLFNTFSVAGVVTLISVLLGFPLAWAITLVPNGWGRWLLNIVLLSMWTSLLARTYSWLVLLQSSGVINKALMAMGIIDTPLEMVHNLTGVVIGMSYIMIPFIVLPLQATMHAIDPMVLQAGSICGASPWTNFWKVFLPLCRSGLFSGALMVFVMSLGYYVTPALLGGAQNMMLPEFIIQQVQSFLNWGLASAAAALLVVITLMLFYLYLKLQPESPVGNAR
>NZ_CP018846.1|WP_027919924.1|2011329_2012139_-|ABC-transporter-permease
MLLSPNAMGRPLRTGLYLTTGVIAAFLLLPVVFIVLLSFGSSQWLVFPPPGWTFKWYGQFFSNPEWMDAALASLKVAVLTTIAAVLLGLPTAFALVRGRFPGREMLYGLFTMPMIVPLVIIAVAVYALFLKLGYTGTLFAFVVSHVIVALPFTIISIINSLKLFDQSIEDAAVICGASRLQAIFKVTFPAIRPGMIAGGLFAFLVSWDEVVLSVMMASPDLQTLPVKMWTTLRQDLSPVIAVASTLLIGLSLLVMFIAAALRRRTEVNA
>NZ_CP018846.1|WP_079227542.1|2010161_2011310_-|ABC-transporter-ATP-binding-protein
MSAVIKDNAHGKTLVSLRGLNKHYGDFTAVDNLDLEIQDGEFLTFLGSSGSGKSTTLSMLAGFETPSSGEILVEGQSLVNVPPHKRDIGMVFQRYSLFPHLNVRDNIGFPLAIRKLSATETTKRVDAMLKLVQLEQFAHRKPSQMSGGQQQRVAIARALVYEPRILLMDEPLGALDKKLREDLQDELRQLHRRLGITIVYVTHDQEEAMRLSQRIAIFSHGKIVGLGTGYDLYQNPPNAFVASFLGNSNFLRIKANSNGAGSFEGQPVAIRLTPGLTAQQDALIMVRPEKALALTAEQAAREPLPAGWNEVSAKVGEVLFLGESQTCHVVTAGGTELTVKALSAAGMPMQPGDSVKVRWAVADACIYTEWAESDLSKSAGAH
>NZ_CP018846.1|WP_079227541.1|2009124_2010036_+|LysR-family-transcriptional-regulator
MNNLPSLDDLDIFLQVARRASFAAVAEARGMSAAFVSKRIRLLEADLGVRLLHRTTRRVTVSEEGERVYQWAQQIFEALQRMGDDLDAGQREPAGQLRIASSLGLGRRMVAPALSELAARYPRLDIRLDVHDRLVDLAAEGVDLDIRVGDQIAPNLIAKRLARNWRVLCAAPDYLARRGTPKTLADLASHDCLVIKERDHPFGLWHLEGPAGEESVRVTGALSSNHGEVVHQWCLDGRGIVLRSWWDVHDSLADGRLVQVLEGYRQSADIWAVYTAPLAGSAKVRVAVEFFRQYFTERFQIPG
>NZ_CP018846.1|WP_079227540.1|2007927_2009028_-|tartrate-dehydrogenase
MTKTKTFKIAAIPGDGIGNEVLPEGIRVLEATARKHGLDLQFEFFEWASCDYYLAHGKMMPDDWFDQLKGFDALYFGAVGWPDKVPDHISLWGSLLKFRRDFDQYVNIRPVRLFPGVPCPLAGKQPGDIDFVVVRENTEGEYSSLGGRMFEGTANEFVLQESVFTRRGVDRILEYAFELAHNRPRQHVTSATKSNGMAVSMPYWDERTAAVAAHYPEISWDKQHIDILCARFVLQPERFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERKFPSLFEPVHGSAPDIFGKNIANPIGMIWSGALMLEFLGKETADSRYQAAHDDILQAIEAVIASGATTPDMGGSRSTQAVGQAIVEALNAA
>NZ_CP018846.1|WP_079227539.1|2006552_2007860_-|substrate-binding-domain-containing-protein
MLRLLLLLLPLLPLTAMAEAGHLRVQGSNTIGAALLPALVQGQLWAQQATDIQQSLGAVPNETVITARDAHGQALRIDVAAHGSSTGFAALGQGNADLAAASRPISDAEVHQLKALGDLRSANAEQVIGLDGVAVIVHPDNPLPQLTTQQLAQIFSGQIRRWEQLGVTGGAIHLYARDDRSGTYETFKALVLEPQHGELASQAQRFESSEELAERVGADRQAIGFSSLAAVHGAKVLAVAEGDAPAMLPDRQLVASEDYPLSRRLYFYLPANAKPQARALADFAQSPAGQAIVAAQGFVSQQVNAQPVPAQADMPPRYRSLAQQAQRLSVNFRFQEGSASLDNKALRDVQRVTEYLRQAGKLQSKAVLVGFGDPKETPGRAALLSRLRAQAVRRELARGGVEVLEVTGMGDELPIAGNDMEQGRLRNRRVEVWVY
>NZ_CP018846.1|WP_079227538.1|2005349_2006393_-|TerC-family-protein
MTALQTFLTTPFLGTSTWLWLVFMAIVIGLLVLDLGVLHRQDREIEMRESLLLYSGYFSVGVLFGLWVWHELGAQSALEFYTGFLVEQSLSMDNVFVMAMIFGFFAIPRRYQHRVLFWGILGVVFLRAIMIGVGAALVQNFAWVLYIFGAFLLFTGVKMALSKEDSHPDLANNPILKFVRRHMRVTDQIHGSHFFVRLTPPGESKALRYATPLFLALVLIELADLVFAVDSVPAIFAITQDPFIVYTSNIFAILGLRSLYFALSALMHRFVYLKYALALVLIFIGCKIFYHGMVGKVPALLSLGVTFGLLLGGVVVSLIKTRGEKQVPSVSEPVATRKKEKDPQLKM
>NZ_CP018846.1|WP_079227546.1|2016063_2016786_-|pirin-family-protein
MLTVRNAQDRGLAFHGWLKSFHTFSFGHYRNPDEQGFSDLLVINDDRVIPGKGFGEHPHRDMEIFSYVLEGALEHKDTLGTGSVIRPGDVQLMSAGHGVAHSEFNHSQAQPVHFLQIWIVPNVKGATPRYQQQHFSAEKKRGKLRLIISPDGAEGSLQVRQNARVYAGLFDGAERATLVLPENRHAYVHVARGSIELNGQVLNEGDGVRVRQEQLLELGNGLDAEVLVFDLRPNELPGMP
>NZ_CP018846.1|WP_079227547.1|2017035_2018385_+|PAAR-domain-containing-protein
MRSVTIDGKGQAVDGDRTTTGAICQATGAGYTSEGRMVLRCGDPTTACPMCGEEGTVVEGNAGFISDGKPVAVDGSLVACGCPSGSNRVVASMTDAFPSGRTVILAGSTPAVLNQSSQVPALESGFHIVQRSMSFEEVLASLEMTRAPLPISLLQRLNPSHAEGFKAGEIFVLGSPDSEFACSPGETELIMVAEKARESLAVLSREEANFMMQHIGEIAGVLNGASQSMGVGKDMLERGLSQVKDTLKGIEALHQQQFTLHGHLKSPEFFTSRQALYKQLDSQLRTAFLNKPLGLGSYDRLRRDLGISTKSVVHHWKKAGVPGQLPGYATHLDDVAKVSNYLKYGGWVGVGLGAGSSYLKVYEACRAGETEECQKIRFTETGSFAGGLTGGAAGAAAGKSVAGAVCKFGVWGKAACGIVTVGGAAFGSSKGIEAFGEFIGEKLYEVVYD
>NZ_CP018846.1|WP_079227548.1|2018377_2018767_+|hypothetical-protein
MIDLSDWHVVIRLTVLLMPAVAMLSGLAINGYIAMSRHYTVMCNSFSRSSALQEELRCAGDFGIKSRFLVIAGMTTPLLLPRLFIRRGKLHPGDYRNFPSYLKRSMRSALGLMVSGLLMAAVVMNFFKL
>NZ_CP018846.1|WP_079227549.1|2019116_2020136_-|alpha/beta-hydrolase
MNIVHKTLTASLLALFVSSAFAAGSPGVEQHTQAFLEALEQGGGKPLEQLSPKDARAVLTGAQASVKVDLSGIEVKERTIQASGQSIKLQVVRPANVKGDLPVFMFFHGGGWVLGDFPTHQRLIRDLVVGSGAVAVYVDYTPSPEAHYPAAINQAYAATQWVAEHGKEIGVDGKRLAVAGNSVGGNMAAVVALKAKEAGTPALRFQLLLWPVTDASFETASYRQFAEGHFLTTGMMKWFWDNYTTDAKAREQIYASPLRASSEQLKGLPPALVQTAEFDVLRDEGEAYARKLNAAGVTVTSVRYNGMIHDYGLLNPLSQVPAVKAAMRQAAGELKVHLQ
>NZ_CP018846.1|WP_079227550.1|2020282_2021167_+|LysR-family-transcriptional-regulator
MNPYEDMRIFAQVMEAGSFTAAADRLGMSKQSVSRRLMQLEERLGVRLLNRSTRRLDATPLGQHYYQSALRLLGEVQQVEHDISGQAQALRGTLRVSAPLSFAMAHLGCLLTEFLQLHPQVDVEVDLSDRPVDLIGEGYDLALRIGALEDSSLIARRIADVARVYCASPAYLEARGVPARPEALAEHDCLPYGHSRQVQWQFRQGGKVQTIQVSGRMRANNGELLRDAAIAGMGVTYLPTFIVGQALADGRLVTVLDEWATPALQLSAVYPQHRQVARPVQGFVNFLRERLVQL
>NZ_CP018846.1|WP_079227551.1|2021293_2021890_-|sarcosine-oxidase
MTSLKAEAFIPRSPRAELLHTCALSDLTDLARVGFRGGDSAAYLQELGYRLPALPNQALRQDDGSWVARLSASEYLLLGSFADQGARVAAEEQAWVQDARRNYLLPRQDSHAWLQLSGEHCSAVMAKLCGVDLRLQAFAVGAVAQTSAARINVIVVNVGSDELPALQLLFDRASLAYFQEALLDAMGEFDGGWVGVDE
>NZ_CP018846.1|WP_079227552.1|2021893_2024797_-|(2Fe-2S)-binding-protein
MNSHTRLPAPMGLLIDRERPIRFEFDGQACPGFAGDTIASALLGNGRWLLSRSFKYHRPRGPLSMAGQDANTLVQLPEEPNVLADMEAARDGQVVTGQNFSGSLEHDRDAYLGKFSRFMPVGFYYRSFYKPKGMWKVWEPLIRKKAGLGVLDQGFKPQYYDKAYLFVDVAVIGAGPAGLRAALDAANAGAKVLLVEQQPVLGGSLTYARFDIAGSRASSLRQELLAAVDGHPNIQVLCEATCNGWFTDNYLPVIQHKRLYKVRATRCLVAAGSFDQPVVFRNNDLPGVMLTSAAQRLMKLYAVKPGQRAVILTGHDDGYLAALDLQEQGVAIAALVDMRAAPADAALASELKRRDIPLHLGCTVYEALHEAGMRHVTGADIRPVTGQGKVAEQGLRVACDLLCMSAGYMPVYQLLCQAGGKLAYDVDRDEFAISNLPAGLDIAGSVNGRHRLDNVLTDASRGAAEALAALGLQAPTPSAYVAEAKVNFPWPIFPHPKGKDFVDFDEDLQVRDIVNATRSGYRDVQLVKRFSTVGMGPSQGRHSALPTARLVAQATGRSISETGVTTARPPFQAEKLAHVAGRAFDPYRQTPMHRRHLQAGAKMMPAGIWQRPAFYGKPEERERCMQEEARHVREKVGLIDVSTLGGLDVRGPDAAELLERLYTFGFAKLAIGRTRYALMTNEHGVVIDDGVCARLAEQHFYVTATTSGVDRIYQQMLKWNAQWRLDVDITNVTAALAAVNLAGPLSRQVLAKVCDDVDLSAAAFPYLGVRLGTVAGIPARILRVGFVGELGYEVHVPARHAERLWDALMQAGAGLGIRPFGVETQRLLRLEKGHVIISQDTDGMTHPAEIDMQWAIGRKKPFFVGKRSIEILEAQPLKRKLVGFTLPKGSPQPLEGHLVLDGPDISGNVTSCEYSQTLGQIIGLAYAGAHQATPGMHIPIRVEGGLMVNAKVVQLPFHDPNNLRQEL
>NZ_CP018846.1|WP_079227553.1|2024793_2025099_-|sarcosine-oxidase-subunit-delta
MKILTCPLNGPRNISEFTYGGEFKHMPDPASCSDAEWADYVFNSDNLAGVVIEWWLHNASSYWFLAERHTLSDQVLRTFDPKELFDRRVDFSPAATPEIAG
>NZ_CP018846.1|WP_079227554.1|2025111_2026353_-|FAD-dependent-oxidoreductase
MPFALLKYGLSADYPVEVDLPPPCELKPRYDVVIIGGGGHGLAIAYYLARYHGVTNVAVLEKAYLGGGNTARNTAVIRSNYLTSEGVRFYAESVRMFQNLSNEFDFNIMYSERGQLTLAHTDATVRAFRQRAEVNKHFGGRTEMIDRQQIRELVPSLNLDPGHLPVLAGLWHIDGATARHDAVAWGYAKQAAKRGVEIHQLTEVQDLLIRNGRIEAVKTNRGTVQCGCVVQAVAGASSLLMAKAGIRAPIHTYPLQAMVTQPFKPFLDPLVSSSALHCYVQQTSRGEIVFGGGSDPYPLYNTRSTLDLKESLLAHAIEMFPFMANAKLMRQWAGMTDMTPDYSPIMGLSPVENYYLDAGWGTWGFKATPICGKTMAELVASGGKVPDMIAPFALERFSRFQQVNEMGATAASH
>NZ_CP018846.1|WP_079227555.1|2026334_2027246_-|bifunctional-methylenetetrahydrofolate-dehydrogenase/methenyltetrahydrofolate-cyclohydrolase-FolD
MNAIPSIKLIDGKATAARVLAEVREQVQSLRQAGVQPGLAVVLVGADAASQVYVRNKVLRAEEVGIRSLEHRLPADTTQAQLLTLIDRLNRDSGVNGILVQLPLPEHVDEHRILQAISPLKDVDGFHSENVGGLAQGRDVLTPCTPSGCMRLLRDACGELRGKHALVVGRSNIVGKPMAALLLQADCTVTVVHSRSRDLPALCRQADIVVAAVGKPRLIGADWLKPGAVVIDVGINRIEEAGHSRLVGDVDFAAALPQVAAITPVPGGVGPMTIAYLMKNTLLALDLQQQAAHQERTACLSPC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1711323 : 1718957

uncultured_Caudovirales_phage(77.78%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079227314.1\|1711323_1712328_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	2.9e-151	79.2
WP_027919749.1\|1712324_1712660_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	4.9e-42	75.7
WP_079227315.1\|1712656_1712953_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	8.1e-25	60.6
WP_079227316.1\|1712952_1713312_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.3e-37	65.8
WP_079227317.1\|1713313_1713706_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	5.0e-54	80.6
WP_079227318.1\|1713882_1715262_-	uracil-xanthine permease	H9YQ34	environmental_Halophage	5.7e-28	51.1
WP_027919754.1\|1715566_1716238_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	3.1e-104	91.5
WP_079227319.1\|1716579_1717749_-	DUF3596 domain-containing protein	A0A2H4JGM5	uncultured_Caudovirales_phage	1.1e-149	64.5
WP_079227321.1\|1718051_1718330_-	hypothetical protein	NA	NA	NA	NA
WP_079227322.1\|1718397_1718613_-	hypothetical protein	NA	NA	NA	NA
WP_079227323.1\|1718609_1718957_-	hypothetical protein	A0A0U4JP55	Pseudomonas_phage	1.1e-25	58.3

DBSCAN-SWA_2

4393772 : 4506123

131

Pseudomonas_phage(38.96%)

protease,head,holin,plate,capsid,integrase,tRNA,terminase,tail,lysis,portal

attL 4385204:4385245|attR 4512341:4512382

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4385204:4385245	attL	NA	NA	NA	NA
WP_079229340.1\|4393772_4394297_+\|tail	phage tail protein	A0A222ZFV4	Arthrobacter_phage	4.3e-13	33.7
WP_079229341.1\|4394336_4394906_+\|tail	phage tail protein	NA	NA	NA	NA
WP_079229342.1\|4394921_4395452_+\|tail	tail fiber protein	E3T4R8	Cafeteria_roenbergensis_virus	5.4e-11	34.0
WP_079229343.1\|4395451_4396003_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_161492852.1\|4396106_4402358_+	IPT/TIG domain-containing protein	A0A160DDD4	Gordonia_phage	8.6e-07	47.9
WP_079229346.1\|4403158_4403833_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	2.0e-26	36.2
WP_079229347.1\|4403849_4404497_-	7-carboxy-7-deazaguanine synthase QueE	NA	NA	NA	NA
WP_079229348.1\|4404656_4405472_-	tol-pal system protein YbgF	NA	NA	NA	NA
WP_023381906.1\|4405478_4405976_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_192858727.1\|4406030_4407311_-	Tol-Pal system protein TolB	NA	NA	NA	NA
WP_079229350.1\|4407328_4408405_-	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_008090221.1\|4408404_4408857_-	protein TolR	NA	NA	NA	NA
WP_027919953.1\|4408871_4409567_-	protein TolQ	NA	NA	NA	NA
WP_027919954.1\|4409569_4410022_-	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
WP_027919955.1\|4410147_4411194_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.0e-05	27.4
WP_079229351.1\|4411190_4411808_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_079229352.1\|4411917_4412442_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_027919958.1\|4412582_4413329_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_027919959.1\|4413438_4415214_-\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	1.3e-11	26.3
WP_027919960.1\|4415308_4415530_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_079229353.1\|4415622_4415949_-	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_027919962.1\|4416099_4416573_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	4.0e-18	36.4
WP_079229354.1\|4416851_4417445_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	2.3e-10	48.3
WP_027919964.1\|4417483_4417690_-	SlyX family protein	NA	NA	NA	NA
WP_079229355.1\|4417691_4418120_-	HIT domain-containing protein	NA	NA	NA	NA
WP_079229356.1\|4418860_4420150_+	OprD family porin	NA	NA	NA	NA
WP_079229357.1\|4420310_4422026_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_079229358.1\|4422046_4423000_+	hypothetical protein	NA	NA	NA	NA
WP_192858728.1\|4423031_4424090_-	DNA polymerase IV	NA	NA	NA	NA
WP_079229360.1\|4425048_4427691_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_079229361.1\|4427690_4428983_+	virulence factor family protein	NA	NA	NA	NA
WP_079229362.1\|4429159_4431070_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	5.4e-77	34.5
WP_027919973.1\|4431305_4432637_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_079229363.1\|4432706_4433456_-	hypothetical protein	NA	NA	NA	NA
WP_079229364.1\|4433510_4435271_-	hypothetical protein	NA	NA	NA	NA
WP_079229365.1\|4435267_4436113_-	hypothetical protein	NA	NA	NA	NA
WP_152031580.1\|4436244_4436586_+	hypothetical protein	NA	NA	NA	NA
WP_192858669.1\|4436595_4436901_+	hypothetical protein	NA	NA	NA	NA
WP_079229367.1\|4437129_4437585_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_079229368.1\|4437704_4438415_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_054883423.1\|4438462_4438924_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	1.1e-36	50.0
WP_079229369.1\|4438930_4439626_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_079229370.1\|4439690_4440470_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_079229371.1\|4440588_4441515_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_060484470.1\|4441511_4441877_-	diacylglycerol kinase	NA	NA	NA	NA
WP_027919985.1\|4441950_4442601_-	response regulator transcription factor	NA	NA	NA	NA
WP_079229372.1\|4442780_4443491_-	DTW domain-containing protein	NA	NA	NA	NA
WP_079229373.1\|4443716_4444136_+	quorum-sensing-regulated virulence factor family protein	NA	NA	NA	NA
WP_079229374.1\|4444136_4444340_-	hypothetical protein	NA	NA	NA	NA
WP_079229375.1\|4444632_4445751_+	LOG family protein	NA	NA	NA	NA
WP_079229376.1\|4445816_4446287_-	recombination regulator RecX	NA	NA	NA	NA
WP_079229377.1\|4446298_4447366_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.1e-111	61.3
WP_079229378.1\|4447470_4447953_-	nicotinamide-nucleotide amidohydrolase family protein	B5TK85	Pseudomonas_phage	2.6e-57	74.8
WP_079229379.1\|4448011_4448488_-\|lysis	lysis protein	B5TK84	Pseudomonas_phage	6.9e-34	57.7
WP_079229380.1\|4448484_4449033_-	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	8.7e-73	70.2
WP_079229381.1\|4449061_4450096_-	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.9e-133	69.9
WP_027919996.1\|4450100_4450307_-\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	7.9e-19	64.2
WP_079229382.1\|4450281_4451127_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	4.9e-83	54.3
WP_079229383.1\|4451136_4452939_-	hypothetical protein	NA	NA	NA	NA
WP_027919999.1\|4453064_4453367_-\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	7.7e-23	61.3
WP_027920000.1\|4453377_4453887_-\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	1.2e-63	69.5
WP_079229384.1\|4453900_4455067_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	9.2e-181	81.8
WP_079229385.1\|4455162_4455564_-	hypothetical protein	A0A2H4J924	uncultured_Caudovirales_phage	7.4e-05	35.4
WP_152031583.1\|4455575_4457552_-\|tail	phage tail protein	A0A077K818	Ralstonia_phage	5.5e-85	54.0
WP_079229386.1\|4457544_4458153_-\|tail	phage tail protein I	A0A2H4JDH5	uncultured_Caudovirales_phage	2.3e-66	59.4
WP_079229387.1\|4458154_4459036_-\|plate	baseplate J/gp47 family protein	A0A2H4JFK9	uncultured_Caudovirales_phage	3.9e-107	69.3
WP_079229388.1\|4459032_4459359_-	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.5e-35	67.9
WP_079229389.1\|4459431_4459992_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	1.1e-43	72.6
WP_079229390.1\|4459988_4460486_-	hypothetical protein	NA	NA	NA	NA
WP_027920007.1\|4460497_4460836_-\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	7.8e-40	73.6
WP_027920008.1\|4461314_4462061_-	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	1.7e-119	85.1
WP_079229391.1\|4462409_4462697_-	hypothetical protein	A0A2H4J7A7	uncultured_Caudovirales_phage	1.3e-22	55.8
WP_079229392.1\|4462693_4462987_-	hypothetical protein	A0A2H4JER5	uncultured_Caudovirales_phage	2.5e-34	70.1
WP_152031584.1\|4463062_4463287_-	hypothetical protein	A0A2H4JG60	uncultured_Caudovirales_phage	1.2e-25	74.3
WP_152031585.1\|4463496_4464300_-	hypothetical protein	NA	NA	NA	NA
WP_079230596.1\|4464363_4464642_-	hypothetical protein	H2BDA1	Pseudomonas_phage	5.6e-20	66.7
WP_079229394.1\|4464650_4465013_-	hypothetical protein	J7HXL1	Pseudomonas_phage	3.4e-17	49.5
WP_079229395.1\|4465009_4465498_-	glycoside hydrolase family 104 protein	Q9MC90	Pseudomonas_phage	3.7e-51	63.8
WP_079230597.1\|4465553_4466360_-	hypothetical protein	A0A2H4J1J6	uncultured_Caudovirales_phage	1.3e-61	72.0
WP_079229396.1\|4466581_4467637_-	hypothetical protein	A0A2H4JA10	uncultured_Caudovirales_phage	1.8e-151	74.1
WP_079229397.1\|4467636_4470816_-	DUF1983 domain-containing protein	A0A2H4J0B1	uncultured_Caudovirales_phage	0.0e+00	79.3
WP_079229398.1\|4470812_4471211_-	hypothetical protein	A0A2H4IYI8	uncultured_Caudovirales_phage	7.0e-56	72.7
WP_079229399.1\|4471213_4471819_-	hypothetical protein	A0A2H4J0R3	uncultured_Caudovirales_phage	5.6e-89	78.1
WP_079229400.1\|4471818_4472403_-	hypothetical protein	A0A2H4IYI9	uncultured_Caudovirales_phage	3.7e-61	57.7
WP_079229401.1\|4472446_4475701_-\|tail	phage tail tape measure protein	A0A2D1GNQ1	Pseudomonas_phage	1.5e-241	65.7
WP_152031586.1\|4475762_4476020_-	hypothetical protein	NA	NA	NA	NA
WP_079229402.1\|4476070_4476280_-	hypothetical protein	A0A2D1GNK2	Pseudomonas_phage	3.5e-14	70.6
WP_079229403.1\|4476321_4476654_-	hypothetical protein	A0A2D1GNT5	Pseudomonas_phage	9.7e-35	72.3
WP_079229404.1\|4476694_4477195_-	hypothetical protein	A0A2D1GNF2	Pseudomonas_phage	3.8e-75	85.2
WP_079229405.1\|4477250_4477637_-	DUF3168 domain-containing protein	A0A2D1GNT4	Pseudomonas_phage	8.0e-57	85.2
WP_079229406.1\|4477629_4478130_-	HK97 gp10 family phage protein	A0A2D1GNN2	Pseudomonas_phage	8.2e-62	69.5
WP_079229407.1\|4478133_4478313_-	hypothetical protein	A0A2D1GNQ5	Pseudomonas_phage	2.3e-06	48.2
WP_079229408.1\|4478321_4478648_-\|head,tail	head-tail adaptor protein	A0A2D1GNG1	Pseudomonas_phage	3.3e-27	62.0
WP_079229409.1\|4478644_4478962_-\|head,tail	phage gp6-like head-tail connector protein	A0A2D1GNK0	Pseudomonas_phage	3.3e-40	73.3
WP_079230598.1\|4478954_4479221_-	hypothetical protein	A0A2D1GNQ9	Pseudomonas_phage	6.4e-21	64.3
WP_079229410.1\|4479420_4480623_-\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	4.4e-186	80.0
WP_079229411.1\|4480612_4481287_-\|head,protease	HK97 family phage prohead protease	A0A2D1GNL2	Pseudomonas_phage	7.6e-103	84.5
WP_079229412.1\|4481264_4482476_-\|portal	phage portal protein	A0A2D1GNU4	Pseudomonas_phage	9.5e-205	84.8
WP_079229414.1\|4482681_4484358_-\|terminase	terminase large subunit	A0A0N7KZG0	Stx2-converting_phage	5.2e-193	60.8
WP_079229415.1\|4484361_4484862_-\|terminase	terminase small subunit	A0A2H4J8R0	uncultured_Caudovirales_phage	3.9e-11	37.2
WP_079229416.1\|4485027_4485363_-	HNH endonuclease	C4ML58	Xanthomonas_virus	9.5e-22	46.8
WP_079229417.1\|4485362_4485686_-\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	1.0e-25	53.5
WP_079229418.1\|4485921_4486164_+	hypothetical protein	NA	NA	NA	NA
WP_019471606.1\|4486267_4486657_-	antitermination protein Q	A0A1W6JTD2	Pseudomonas_phage	3.5e-44	64.8
WP_079229420.1\|4486985_4488272_-\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	7.2e-126	53.1
WP_079229421.1\|4488268_4488697_-	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	1.6e-50	76.5
WP_079229422.1\|4488693_4488990_-	DUF1364 domain-containing protein	A0A192Y6R9	Salmonella_phage	3.4e-31	70.8
WP_079229423.1\|4488992_4489805_-	ATP-binding protein	A0A2H4J3E5	uncultured_Caudovirales_phage	8.0e-99	67.9
WP_079229424.1\|4489794_4490649_-	replication protein	B5WZX9	Pseudomonas_phage	1.9e-37	37.3
WP_079229425.1\|4490788_4491022_+	hypothetical protein	NA	NA	NA	NA
WP_079229426.1\|4491150_4491387_-	helix-turn-helix domain-containing protein	W6MWX8	Pseudomonas_phage	1.4e-16	73.4
WP_079230599.1\|4491494_4492190_+	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	8.8e-70	56.5
WP_049587761.1\|4492731_4493115_+	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	9.8e-23	60.0
WP_079229427.1\|4493134_4493404_+	hypothetical protein	NA	NA	NA	NA
WP_079229428.1\|4493400_4493943_+	hypothetical protein	A0A2H4J7C8	uncultured_Caudovirales_phage	1.9e-11	31.1
WP_079229429.1\|4494024_4494333_+	hypothetical protein	A0A2H4JAQ1	uncultured_Caudovirales_phage	2.0e-18	53.1
WP_079229430.1\|4494337_4494919_-	hypothetical protein	NA	NA	NA	NA
WP_152031587.1\|4495021_4495405_-	hypothetical protein	NA	NA	NA	NA
WP_079229432.1\|4495507_4495687_-	hypothetical protein	NA	NA	NA	NA
WP_079229433.1\|4495821_4496601_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	1.3e-18	31.0
WP_079229434.1\|4496610_4497534_+	DNA cytosine methyltransferase	A0A142KB20	Gordonia_phage	7.1e-27	39.1
WP_079229435.1\|4497584_4498235_-	hypothetical protein	NA	NA	NA	NA
WP_079229436.1\|4499099_4499510_+	hypothetical protein	Q6JII8	Burkholderia_virus	8.1e-15	41.9
WP_079229437.1\|4499506_4499758_+	hypothetical protein	A0A2H4J399	uncultured_Caudovirales_phage	1.4e-38	94.0
WP_152031636.1\|4499820_4500093_+	hypothetical protein	A0A2H4JA03	uncultured_Caudovirales_phage	6.5e-37	88.2
WP_079229438.1\|4500083_4500275_+	DUF4224 domain-containing protein	A0A1B0VMB6	Pseudomonas_phage	6.2e-18	65.1
WP_079229439.1\|4500347_4501004_-	hypothetical protein	NA	NA	NA	NA
WP_079229440.1\|4501000_4501324_-	STAS-like domain-containing protein	A0A2H4J4X6	uncultured_Caudovirales_phage	1.3e-07	38.7
WP_152031588.1\|4501326_4502421_-	ATP-binding protein	NA	NA	NA	NA
WP_152031589.1\|4502521_4503499_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0VP19	Pseudomonas_phage	1.3e-132	70.8
WP_079229443.1\|4503549_4506123_+	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	9.0e-27	22.8
4512341:4512382	attR	NA	NA	NA	NA

DBSCAN-SWA_3

4739294 : 4747076

Planktothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079229599.1\|4739294_4740104_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.9e-25	32.1
WP_079229600.1\|4740351_4741326_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	7.5e-35	32.6
WP_079229601.1\|4741340_4741865_+	HAD family hydrolase	A0A140XBD6	Dickeya_phage	8.2e-28	48.9
WP_079229602.1\|4741873_4742446_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_079229603.1\|4742432_4742957_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_027920214.1\|4742957_4743683_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-23	26.5
WP_079229604.1\|4743858_4745352_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003255135.1\|4745430_4745739_+	ribosome-associated translation inhibitor RaiA	A0A0M7QH33	Escherichia_phage	4.4e-05	34.1
WP_027920216.1\|4745751_4746219_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_079229605.1\|4746221_4747076_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	2.4e-08	31.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018846

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection