CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018845	Herbaspirillum robiniae strain AA6 chromosome, complete genome	1 crisprs	DEDDh,cas3,WYL,csa3	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018845_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018845_1

4276333-4276432

Orphan

Consensus_repeat	Method
ATATCTTCACGCAGCATTTGGCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018845_1

>merge|NZ_CP018845|1|4276333-4276432|CRISPRCasFinder
ATATCTTCACGCAGCATTTGGCTCTCCCATCATCTGCTTCTCGGCTTCGGTCGGTGATGTGCAAATTCCGTCTGCAATATCTTCACGCAGCATTGGCTCC

>NZ_CP018845|1|1|4276333-4276432|CRISPRCasFinder
ATATCTTCACGCAGCATTTGGCTC	TCCCATCATCTGCTTCTCGGCTTCGGTCGGTGATGTGCAAATTCCGTCTGCA
ATATCTTCACGCAGCATTGGCTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018845.1\|WP_122984553.1\|4280578_4281436_+\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|235896
NZ_CP018845.1\|WP_079217944.1\|4273445_4274009_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|211789
NZ_CP018845.1\|WP_079217940.1\|4266944_4267931_-\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP018845.1\|WP_079217942.1\|4270525_4272394_+\|phosphoenolpyruvate-carboxykinase-(GTP)	unknown	unknown	gnl\|CDD\|235256
NZ_CP018845.1\|WP_079217950.1\|4282280_4283102_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP018845.1\|WP_079219297.1\|4268038_4269025_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176233
NZ_CP018845.1\|WP_079217951.1\|4283207_4284101_+\|acetylglutamate-kinase	unknown	unknown	gnl\|CDD\|234869
NZ_CP018845.1\|WP_079217937.1\|4262565_4263054_-\|asparaginase	unknown	unknown	gnl\|CDD\|376375
NZ_CP018845.1\|WP_079217939.1\|4266202_4266967_+\|L-asparaginase	unknown	unknown	unknown
NZ_CP018845.1\|WP_079217938.1\|4263155_4265747_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|366716
NZ_CP018845.1\|WP_079217948.1\|4278856_4279177_-\|NAD(P)H-dependent-oxidoreductase-subunit-E	unknown	unknown	gnl\|CDD\|225945
NZ_CP018845.1\|WP_079217953.1\|4285256_4285991_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|273917
NZ_CP018845.1\|WP_079217943.1\|4272619_4273066_-\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP018845.1\|WP_079219299.1\|4281450_4282227_+\|type-III-pantothenate-kinase	unknown	unknown	gnl\|CDD\|237352
NZ_CP018845.1\|WP_079217945.1\|4274243_4275839_+\|alkyl-hydroperoxide-reductase-subunit-F	unknown	unknown	gnl\|CDD\|237942
NZ_CP018845.1\|WP_079217941.1\|4269235_4270126_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP018845.1\|WP_079219298.1\|4279270_4280401_-\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|227939
NZ_CP018845.1\|WP_079217946.1\|4276755_4277910_-\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP018845.1\|WP_122984495.1\|4284252_4285188_-\|TraB/GumN-family-protein	unknown	unknown	gnl\|CDD\|376688
NZ_CP018845.1\|WP_079217947.1\|4278176_4278839_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225496

Protein	Function_ID	Function_description	E-value
NZ_CP018845.1\|WP_122984553.1\|4280578_4281436_+\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|235896	PRK06955, PRK06955, biotin--[acetyl-CoA-carboxylase] ligase.	6.01308e-63
NZ_CP018845.1\|WP_079217944.1\|4273445_4274009_+\|peroxiredoxin	gnl\|CDD\|211789	TIGR03137, AhpC, peroxiredoxin. This peroxiredoxin (AhpC, alkylhydroperoxide reductase subunit C) is one subunit of a two-subunit complex with subunit F(TIGR03140). Usually these are found as an apparent operon. The gene has been characterized in Bacteroides fragilis, where it is important in oxidative stress defense. This gene contains two invariant cysteine residues, one near the N-terminus and one near the C-terminus, each followed immediately by a proline residue. [Cellular processes, Detoxification, Cellular processes, Adaptations to atypical conditions].	9.79622e-137
NZ_CP018845.1\|WP_079217940.1\|4266944_4267931_-\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	3.42567e-161
NZ_CP018845.1\|WP_079217947.1\|4278176_4278839_-\|alpha/beta-hydrolase	gnl\|CDD\|225496	COG2945, COG2945, Predicted hydrolase of the alpha/beta superfamily [General function prediction only].	1.36578e-63
NZ_CP018845.1\|WP_079217950.1\|4282280_4283102_+\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	9.28182e-07
NZ_CP018845.1\|WP_079219297.1\|4268038_4269025_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176233	cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	1.21162e-168
NZ_CP018845.1\|WP_079217942.1\|4270525_4272394_+\|phosphoenolpyruvate-carboxykinase-(GTP)	gnl\|CDD\|235256	PRK04210, PRK04210, phosphoenolpyruvate carboxykinase (GTP).	0
NZ_CP018845.1\|WP_079217937.1\|4262565_4263054_-\|asparaginase	gnl\|CDD\|376375	pfam00710, Asparaginase, Asparaginase, N-terminal. This is the N-terminal domain of this enzyme.	2.3539e-26
NZ_CP018845.1\|WP_122984495.1\|4284252_4285188_-\|TraB/GumN-family-protein	gnl\|CDD\|376688	pfam01963, TraB, TraB family. pAD1 is a haemolysin/bacteriocin plasmid originally identified in Enterococcus faecalis DS16. It encodes a mating response to a peptide sex pheromone, cAD1, secreted by recipient bacteria. Once the plasmid pAD1 is acquired, production of the pheromone ceases--a trait related in part to a determinant designated traB. However a related protein is found in C. elegans, suggesting that members of the TraB family have some more general function. This family also includes the bacterial GumN protein. The family has a conserved GXXH motif close to the N-terminus, a conserved glutamate and a conserved arginine that may be catalytic. The family also includes a second conserved GXXH motif near the C-terminus. This family also contains the Tiki proteins that regulate Wnt signalling.	2.51108e-71
NZ_CP018845.1\|WP_079217938.1\|4263155_4265747_-\|chemotaxis-protein-CheW	gnl\|CDD\|366716	pfam01584, CheW, CheW-like domain. CheW proteins are part of the chemotaxis signaling mechanism in bacteria. CheW interacts with the methyl accepting chemotaxis proteins (MCPs) and relays signals to CheY, which affects flageller rotation. This family includes CheW and other related proteins that are involved in chemotaxis. The CheW-like regulatory domain in CheA binds to CheW, suggesting that these domains can interact with each other.	3.78162e-10
NZ_CP018845.1\|WP_079217948.1\|4278856_4279177_-\|NAD(P)H-dependent-oxidoreductase-subunit-E	gnl\|CDD\|225945	COG3411, COG3411, Ferredoxin [Energy production and conversion].	1.60793e-21
NZ_CP018845.1\|WP_079217953.1\|4285256_4285991_+\|HAD-IA-family-hydrolase	gnl\|CDD\|273917	TIGR01993, Suppressor_of_disruption_of_TFIIS, pyrimidine 5'-nucleotidase. This family of proteins includes the SDT1/SSM1 gene from yeast which has been shown to code for a pyrimidine (UMP/CMP) 5'nucleotidase. The family spans plants, fungi and a small number of bacteria. These enzymes are members of the haloacid dehalogenase (HAD) superfamily of hydrolases, specifically the IA subfamily (variant 3, TIGR01509).	2.00612e-41
NZ_CP018845.1\|WP_079217951.1\|4283207_4284101_+\|acetylglutamate-kinase	gnl\|CDD\|234869	PRK00942, PRK00942, acetylglutamate kinase; Provisional.	1.15451e-156
NZ_CP018845.1\|WP_079217943.1\|4272619_4273066_-\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	4.77934e-30
NZ_CP018845.1\|WP_079219299.1\|4281450_4282227_+\|type-III-pantothenate-kinase	gnl\|CDD\|237352	PRK13328, PRK13328, type III pantothenate kinase.	2.68058e-72
NZ_CP018845.1\|WP_079217945.1\|4274243_4275839_+\|alkyl-hydroperoxide-reductase-subunit-F	gnl\|CDD\|237942	PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional.	0
NZ_CP018845.1\|WP_079217941.1\|4269235_4270126_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.97502e-79
NZ_CP018845.1\|WP_079219298.1\|4279270_4280401_-\|VanZ-family-protein	gnl\|CDD\|227939	COG5652, COG5652, Predicted integral membrane protein [Function unknown].	6.75252e-08
NZ_CP018845.1\|WP_079217946.1\|4276755_4277910_-\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	8.59637e-138

>NZ_CP018845.1|WP_079217945.1|4274243_4275839_+|alkyl-hydroperoxide-reductase-subunit-F
MLDANLKTQLKAYLEKVTQPIEIVAMLDDGAKAREMQELLQEIVLLSDRITLVEHRGAANGRAPSFKLNRPGTDISVEFAAIPMGHEFTSLVLALLQVGGHPIKLDDKVIEQIKNLDGDYSFETYVSLTCQNCPEVVQALNVMSIINPRIRSVTIDGALFQNEVEQRQIMAVPTVYMNGEVFGQGRTGVEEILARLDTGAAARKGEELSAKEPYDVLIVGGGPAGAAAAIYAARKGIRTGVVAERFGGQVLDTLAIENFVSVKETEGPQFATALEQHVKAYDVDIMNVQRAEQLIAGDKLIEVKLANGGVLKGKTVILSTGARWREVNVPGEREYRNHGVAYCPHCDGPLFKGKRVSVIGGGNSGVEAAIDLAGLVQHVTLLEFAAELKADAVLVKKLKSLPNVTIVTSAQTTEITGDGKKVNGISYKERETGEVRHVELEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDAKGQTSIPGVFAAGDVTTVPYKQIVIAVGAGATAALSAFDHLIRSSVDDEAPVAKEAVAA
>NZ_CP018845.1|WP_079217944.1|4273445_4274009_+|peroxiredoxin
MSLINTTIKPFKATAYHAGKFVDISEATLKGKWSVFVFYPADFTFVCPTELEDLANNYAEFSKLGVEIYGISTDTHFAHKAWHDTSEAIKKVQYPLVGDPTATLARNFEVLIEEEGLALRGTFVINPEGQIKVLEIHDNGIGRDASELLRKVKAAQYVASHPGEVCPAKWEEGAATLKPSLDLVGKI
>NZ_CP018845.1|WP_079217943.1|4272619_4273066_-|acyl-CoA-thioesterase
MSDNSKPVPGPRAGYRHFHPIQTRWMDNDVYGHVNNVVYYSWFDTAVNHYLVDGGVLDIERSPVIGLVIETRCNYFASIAFPEQVEVGVRVAHVGRSSVRYELGIFKDGEDSAAAQGHFVHVYVGRESRRPVEIPAKMREALARISPD
>NZ_CP018845.1|WP_079217942.1|4270525_4272394_+|phosphoenolpyruvate-carboxykinase-(GTP)
MNQPLMAGVPAVNAPAYVKHQKLINWVTEIAALTKPARIYWCDGSQEEYDRLCGEMVAAGTMKKLNQEKRPNSYLACSDPSDVARVEDRTFICTPNKEDAGPTNNWTDPAEMRQTLNGLFDGSMAGRTLYVVPFSMGPLGSPIAHIGVELSDSPYVAVNMRIMTRMGRAVYDVLGADGEFVPCVHTVGAPLAAGQKDVAWPCNATKYIVHYPETREIWSYGSGYGGNALLGKKCFALRIASTMGRAQGWLAEHMLILGVESPEGKKHYVAAAFPSACGKTNFAMLIPPKAFGGWKVTTIGDDIAWIKPGADGRLYAINPEAGYFGVAPGTNEKSNYNCMASVSANTIFTNVALTDDGDVWWEGMTKEAPAHLIDWQGKDWTPEIGKETGRKAAHPNARFTVAATQNPVIDPAWDDPAGVPISAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETTAAAVGQQGVVRRDPFAMLPFAGYNMSEYFQHWLDIGKKIAASPAELPKIYCVNWFRTDENGKFVWPGFGDNMRVLKWMLDRIEDPQGVKTGGVEHLFGVTPRFADLQWEGIDFTAEQFATITSIDKAAWKQELELHAELFDKLAHKLPAELVGVKGKLEKQLAA
>NZ_CP018845.1|WP_079217941.1|4269235_4270126_+|LysR-family-transcriptional-regulator
MDRLDMLRVFCAVVEAGAFSRAAEKLSMSTSSVTNHVAALEAHFKVRLINRTTRSMSLTEEGRHCHAQALRLLADMGELEAGLRDAGATPAGVLRVDLPSVISRQYVAPALPRFMQRYPDLELRITVGDRMIDMVEEGVDVLVRIGELPDSGLVARKLMSTRYVCCAAPAFLQQNGWPASPESLDQFACLGFLNPRTRMVRPWKFTRDGEIGSHIPRGLVQMDHVESVIAAAKAGCGIIQQMSVSLVPALRNGELVPVLEDWQASGPDIYALYQSGRRETAKVKVFVDFLKEIFTT
>NZ_CP018845.1|WP_079219297.1|4268038_4269025_-|zinc-dependent-alcohol-dehydrogenase-family-protein
MQAAVLERFGAPLALADVEIPALRPGQALVRIAASGVNPLDTKIQAGNAAHAQARLPAILGIDLAGTVEAVAPGETRFQPGDEVYGMTGGVGGVQGSLAQFAAVDADLLAIKPRGLDMRQAAALPLIFITAWEGLVDRARVHAGQKVLVHGGAGGVGHIAIQIARAFGAEVYATGSAEQKGIIESLGAVAIDYRSESVDDYVARHTGGEGFDIVYDTVGGPTLDASFAAARRYHGHVVSCLGWGAHKLAPLSFRAATYSGVFTLLPLLSGRERAHHGQIMQEATRLADAGALRVLMDERRFNLHQANEAQAIVAAGQARGKLVVDVAG
>NZ_CP018845.1|WP_079217940.1|4266944_4267931_-|D-2-hydroxyacid-dehydrogenase-family-protein
MKIAILDDYQDAVRHLDCFRMLDGHDVKVFSNTVRGVGQLAARLAPFDALVLIRERSSLNKALLEKLPLLKLISQTGKVSGHIDVAAATERGIAIVEGVGDPTAPAELTWALIMAAMRRVPQYCEALRAGAWQQVSATPHHNVIGSALKGRTLGVWGYGKIGRMVAGYGRAFGMKVVVWGRDASREQATKDGYEAASDKADFFSRADVLTLHLRLNDATRAIVKASDLALMKPTACFVNTSRAELVEEGALEAALQQGKPGLAALDVYEREPLPVDSPLLKMDNVVAAPHLGYVEKDGYELYFRAAFQNILDYAAGAPKNVLNPEVLK
>NZ_CP018845.1|WP_079217939.1|4266202_4266967_+|L-asparaginase
MKPLAPGTVIFHRHRGYGVIVLVNLMTGWISARFGSEVRTLDLNLSSDEVQHADGTPIKFRRAPPDRMPHARLMAMVRELHRAGYQRLYLYTWPKPSGLHWRWHLFAGARQWIERPWREGWYGSGADYNFNPVMGWGDTPGASPQELARLLAQFDPQGLAQALGEDEEHANWFELVCATFLPDYAYSLGWHYNGKMPEHLPVIPIRRNVPEYSGPPLPWPPGWRHLWKASGKSPLLQYNPPVRTVHRFTSEPLD
>NZ_CP018845.1|WP_079217938.1|4263155_4265747_-|chemotaxis-protein-CheW
MPHATTIQTETFLPYMRDVAKCEQSLQELNLMWRVIEASAKMNCPAEAKTILPTMAATRSGFSRLERELVSSLVEEKVRNVLAEIGTKAQYVIDIVVRNLFERTADVGFLATDRELCNFVAGVTDSADAARYRLREYRNKYTVYDEIILLDAEGNVLVQIDPSTPLEHSADALIRQTLESETYVETFRATDLRPGKDRALIYSRRMHHPQTGAVIGVLCLCFHFEEEMAGIFAAHRDPEARANMLLLDGDNRVISSADDLWIPPGTVVPVNTGGQPQLMMFCGREYLVRTFASEGYQGYPGPVGWQGQVMIPVEVAFSGIVSDVLSRLSPELAEGLLSHAHSFCPPLYEIMTAAKTIQRIVWNGQVMTAGQRGEMLKLKTILDQISETGNRSNELFAQSIHDLYQTVLASSMRDAEFSTGLLVDLLDRNLYERSDDCRWWALTPELRATLAQAEIGDAEAAKLGEILAYINGLYTVYTRLFIYDRHGRIVASTGDGLDGVLGSSIDAATLEQVMSLRSQQHYHVSSFAPSPLYGDRDTYIYHAAIRALDNDGEVVGGIGIVFDSEPELRNMLRAGLAGKDKMSAFYVDRAGRILSGTDDSRPVGATLKIDPALLQVANGEARSGVIVHDGQYAIVAASASNGYREFKVSDGYKEDVIAVVFQCFGAVNEGSLQNTGGEFLLESEAASSEDLEYATFFSDQNLFAISAASVMEAVPYSSVLPTSMGSRAEQVGVLGLNRDDQHKEFIWVFDLGHLIRGTRSAVTSSSQVMIVRHGAHTIGLLVDELHAVPQFSPAQIIHTPFAMQGESMLVTQVIKANGGKLLIQAIEVERLFAYVVDGTIPLPPPAPELVAAAQAQERELMAA
>NZ_CP018845.1|WP_079217937.1|4262565_4263054_-|asparaginase
MSLRIIATGGTFDKHYDEIAGQLDFGASHLPQVISRARITAEVILEELKLLDSLEMQDADRQRILACCQNSTQQAIVIVHGTDTMQLTAQVLGQALQDKTVVLTGAMIPYEIANSDALFNFGFACGVAQVLPPGVYVAMNGQIFAWNKVAKNRSAGVFEPIR
>NZ_CP018845.1|WP_079217946.1|4276755_4277910_-|D-alanyl-D-alanine-carboxypeptidase
MKKLLAAFAATVLSITTLTASAQSLPPPTVAAKSWLLLDASANQVIASADPDMRVEPASLTKLMTAYLAFAALRDKRLSLEQEVSVSVNAWKVDPSSSKMFIEPNKPVSIDNLLYGLISVSGNDAAVAVAEAVSGTEDAFVQLMNREAQRQGLSNTHFSNPHGLPSPDTYTTARDLAILCRNLINDFPEYYKRYYSVKKFTYNNITQPNRNRLLWLDPTVDGMKTGHTSSAGYSLITSAHRPVANGERRLISVVIGTVSDQVRTQESQKLLNWGFQNFDAVKLYAKGQPVDTPDVWKGSQGKIKVGFKNDVYITIPKGTADKVKTHLDRNDPLIAPISENAKVGTLKVTIDDKTVAELPVVALESVGPAGFIGRAWDSLRLMFK
>NZ_CP018845.1|WP_079217947.1|4278176_4278839_-|alpha/beta-hydrolase
MNAHTQNFMIAGAVGQLECALDLPDAELFPVPVGLALVAHPHPLFGGTMDNKVAQTLARTFLALGYVAVRMNFRGVGKSEGVHDHGAGETDDMALLLKHMRAQYPDLPLALGGFSFGTFVQAQLQQRLLQADPAAAAERLALVGTAAGKWPMPPAPANTILIHGELDDTIPLSAVLDWARPQELPVVVIPGSDHFFHRKLQHIKNVVVEMWHRRPAAPQA
>NZ_CP018845.1|WP_079217948.1|4278856_4279177_-|NAD(P)H-dependent-oxidoreductase-subunit-E
MSDKPFYEHHVFFCLNQRKPGERTCCADKGAQAAQEHAKKRIKQLGLAGEGKVRINKAGCLERCEEGPVVVIYPQGTWYTFVDNEDIDEIIDTHIVGGKIVDRLKI
>NZ_CP018845.1|WP_079219298.1|4279270_4280401_-|VanZ-family-protein
MVAPVPAASAAPAASSFARVSLLVYTLLIVYASWYPFSGWRDMGLGPFDYLGARLPYYWTGFDVWTNVAGYAPLGALLVLAMYPRLRPLWAIWPATAVGVLLSASMEAVQTWLPTRVPSNLDLITNSAGVFLGAVLGALSSRYFLRESRFLAMRRRWFSGEASRGLAVAGLWPLALIYPQNHLFGMGHLVPPLSSFFSDLFDTPIDLATTWINNAQLSAEQYWLADVIVTACGLTGAALLFLMLLRRQAPRRRLVLLYLLACIAVKSLACALFFAPQNAFVWVSPSAAGGIMLGAMMVAGLSFAPPTAQRRVAALALILSLAATNAVPANPYYISTLETWVQGKFLNFDGAAQFLSVLWPFLAIWFLYHPVHRKQK
>NZ_CP018845.1|WP_122984553.1|4280578_4281436_+|biotin--[acetyl-CoA-carboxylase]-ligase
MTSKLPPAASSEPGAGEGHSLLVHAERIATLLAGSDNPNVKRIDVEAVARTGSTNVDLMQRLPSLQRPLLRVADRQTAGRGRAGRPWRTTPESSLTFSLAWRFGRPLHALLGLPLAIGVALAEALEVFGVQAQLKWPNDVLRDGAKLAGILIETAADGGRGDATWAVIGIGLNLAVPPELEAELQRAVGAAPELQKQPRETVLAIITSALADVLVEFERRGFGAFVGRWQSFHAYAGQQVRILDNGRVVHEGTAAGVDMMGRFLMDTEAGQVAVLAGDLSLRLQS
>NZ_CP018845.1|WP_079219299.1|4281450_4282227_+|type-III-pantothenate-kinase
MLLLIDAGNTRIKWAVAGRERAGPGRWLHEGALARGDAAQLADAWRAVGPVHAAWVSNVAGPGLRGSLEASLKEAFGPGIAIEWFASTPERAGLRNGYRNPAQLGCDRFAAAIGARSLFPGEDLLVATCGTATTIDAVSADGVFEGGMILPGLGTMATSLALSTAQLPQIGEVAPPAQAFADNTVDAIVSGCIAAQAGAIEHALAERRRARPGGALRCLLAGGAGAVLAPHLALGDVPLEKVDNLVLIGLHAAATSGG
>NZ_CP018845.1|WP_079217950.1|4282280_4283102_+|hypothetical-protein
MKLKLFFWLLVVGNVVLFGLQRGYLGAAASERREPQRLAEQLRPELLSILPPNSEKLVPQVRTQEAQAAPDAAAKPDQAPAAGAPAAPATPAPAGSTAAAAAAPTTQVAQAAQAAPGAPSCTEVGNFSATDARRFSTQLASLNLGDKVVQKLTQDVTSHMVYIPPQDGRDGADRRTAELRRLGIGDFYVIPDSFPNPALRYGISLGIFRTEEAAKAYVGQLIAKGLRSARIIARRSGAGKQVFQLRDLSPDSRSALERIKSAFPDQEIRSCSA
>NZ_CP018845.1|WP_079217951.1|4283207_4284101_+|acetylglutamate-kinase
MTTDLTKVAPQIKAEILAEALPYIRKFHGKTIVVKYGGNAMTEESLKHGFARDVILLKLVGMNPVVVHGGGPQIDAALKKIGKQGTFVQGMRITDEETMEVVEWVLGGEVQQDIVMLINHYGGQAVGLTGKDGGLIRARKMQMPDKEKPGQFLDIGYVGEIEAINPAVVKALQDDAFIPIISPIGFGDDGQAYNINADVVAGKIAEILHAEKLIMMTNIAGVQDKAGNLLTDLSAREIDEMFADGTISGGMLPKISSALDAAKSGVNTVHIIDGRIEHSLLLEVLTEQAFGTMIRSH
>NZ_CP018845.1|WP_122984495.1|4284252_4285188_-|TraB/GumN-family-protein
MKGFAQRLIIVTLALLFCFYLPARSVAAAAPEAANNDAPRRGALYRISDGRHTLHLFGTIHVGAPDFYPLESRIMRAIDQASTLALELDPQNAGALQAAVARHGLYPDGRRYEQELAPELARRTSAALRRYQLPAERLQNFRPWMLATALTVQEYASGGYKPELAVDSYLAGAVRAHGGKVIELESAERQMSVFSRLDAAQQAQFLGDTLDELDDADLARKLDELVGAWRRADSGGFAQALREMDDDKSFASRFTRHALLDERNPGLADGIAALLAGQDKAVAAIGILHLVGPGSVPELLQRKGLQVEQLY
>NZ_CP018845.1|WP_079217953.1|4285256_4285991_+|HAD-IA-family-hydrolase
MASNTTPLWLFDLDNTLHNASHAIFPTINANMNRYITRVLEEGGHPSDEAAVNHLRRHYWKLYGATLLGMVRHHGVRIEDFLHEAHLFDDLPGMVRAERGIGRWLQQLPGRKILLTNAPRRYSRELLRHLGLHRHFSHHISIEAMHVHRQLRPKPSRLMLRKLLAREKINPRRCILVEDTVDNLKTARELGVRTAWVTQYLIGNAMLGHLTAQRVRSRLPSYVDVKVSSVRKLPRRLAKLGAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

369781 : 376930

uncultured_Mediterranean_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079219033.1\|369781_370519_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.4e-73	55.8
WP_079214491.1\|370515_371499_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.4e-34	47.9
WP_079214492.1\|371740_372724_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_079214493.1\|372955_373972_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	7.8e-35	34.3
WP_079214494.1\|374150_375512_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.4e-26	26.1
WP_079214495.1\|375576_376269_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	3.5e-26	35.9
WP_079214496.1\|376504_376930_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	2.7e-21	42.1

DBSCAN-SWA_2

2128681 : 2136397

Methanothermobacter_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079215844.1\|2128681_2129878_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.7e-41	32.6
WP_079215845.1\|2129931_2130381_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	4.7e-48	62.2
WP_079215846.1\|2130392_2131484_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_079215847.1\|2131800_2134104_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.7e-168	41.7
WP_079215848.1\|2134100_2134415_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	9.9e-13	42.2
WP_079215849.1\|2134755_2134959_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	3.0e-23	80.3
WP_079215850.1\|2135140_2136397_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	61.1

DBSCAN-SWA_3

4177928 : 4183991

Enterobacteria_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079217863.1\|4177928_4178474_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.4e-46	51.7
WP_079217864.1\|4178487_4179390_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	5.2e-99	62.4
WP_079217865.1\|4179386_4180466_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.7e-89	49.7
WP_079217866.1\|4180479_4181490_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	5.0e-82	43.4
WP_175354831.1\|4181524_4182601_-	CDP-glucose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	5.1e-16	25.7
WP_079217868.1\|4183019_4183991_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.7e-101	67.3

DBSCAN-SWA_4

4480528 : 4512252

Burkholderia_phage(27.59%)

head,integrase,portal,plate,tail,terminase,lysis,capsid,protease

attL 4481155:4481171|attR 4514101:4514117

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079218117.1\|4480528_4481020_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.5e-20	48.3
4481155:4481171	attL	NA	NA	NA	NA
WP_079218118.1\|4481937_4483023_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	4.8e-91	51.4
WP_079218119.1\|4483024_4483267_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_079219314.1\|4483448_4483796_-	hypothetical protein	NA	NA	NA	NA
WP_175354689.1\|4483876_4484023_-	hypothetical protein	NA	NA	NA	NA
WP_079218120.1\|4484019_4486077_-	replication endonuclease	A4JWW0	Burkholderia_virus	1.7e-105	40.7
WP_079218121.1\|4486066_4486420_-	hypothetical protein	NA	NA	NA	NA
WP_079218122.1\|4486593_4486854_-	ogr/Delta-like zinc finger family protein	E5E3T8	Burkholderia_phage	5.5e-09	37.0
WP_079218123.1\|4486844_4487045_-	hypothetical protein	NA	NA	NA	NA
WP_079218124.1\|4487037_4487280_-	hypothetical protein	NA	NA	NA	NA
WP_148664552.1\|4487293_4487494_-	hypothetical protein	NA	NA	NA	NA
WP_079218125.1\|4487571_4488009_+	helix-turn-helix transcriptional regulator	Q6QID2	Burkholderia_phage	5.6e-14	35.2
WP_148664553.1\|4488129_4488804_+	hypothetical protein	A4PE55	Ralstonia_virus	4.6e-15	30.9
WP_148664554.1\|4488859_4490740_+	hypothetical protein	NA	NA	NA	NA
WP_079218128.1\|4490755_4491979_-	late control protein	A0A2H4JAV0	uncultured_Caudovirales_phage	3.9e-81	43.4
WP_079218129.1\|4491975_4492527_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	5.6e-35	55.3
WP_079218130.1\|4492539_4495164_-\|tail	phage tail protein	A4PE52	Ralstonia_virus	1.5e-218	54.7
WP_079218131.1\|4495164_4495278_-\|tail	GpE family phage tail protein	A0A1S5NR79	Burkholderia_phage	3.5e-05	63.6
WP_192858506.1\|4495286_4495610_-\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	5.0e-20	56.4
WP_079218132.1\|4495670_4496180_-\|tail	phage major tail tube protein	R4JEU1	Burkholderia_phage	4.5e-47	53.8
WP_079218133.1\|4496243_4497419_-\|tail	phage tail sheath protein	E5FFG9	Burkholderia_phage	8.0e-148	66.1
WP_122984498.1\|4497443_4497962_-\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_079218135.1\|4497970_4499161_-\|tail	phage tail protein	A0A2I8TVA9	Erwinia_phage	1.7e-49	39.4
WP_079218136.1\|4499157_4499778_-\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	4.2e-55	58.5
WP_079218137.1\|4499770_4500694_-\|plate	baseplate J/gp47 family protein	A0A1S6KZY6	Salmonella_phage	2.1e-71	51.5
WP_079218138.1\|4500690_4501035_-	GPW/gp25 family protein	K4I3Z7	Acidithiobacillus_phage	4.5e-19	51.6
WP_079219316.1\|4501031_4501676_-\|plate	phage baseplate assembly protein V	F1BUP5	Erwinia_phage	4.4e-23	42.1
WP_158522620.1\|4501874_4502024_+	hypothetical protein	NA	NA	NA	NA
WP_158522622.1\|4502054_4502216_+	hypothetical protein	NA	NA	NA	NA
WP_079218139.1\|4502390_4502876_-	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	8.9e-37	52.0
WP_079218140.1\|4502872_4503358_-\|tail	phage tail protein	A0A2H4J906	uncultured_Caudovirales_phage	1.9e-31	47.2
WP_079218141.1\|4503311_4503812_-\|lysis	lysis protein	NA	NA	NA	NA
WP_079218142.1\|4503877_4504408_-	glycoside hydrolase family 104 protein	C6ZR65	Salmonella_phage	8.5e-41	59.5
WP_079218143.1\|4504404_4504779_-	hypothetical protein	NA	NA	NA	NA
WP_079218144.1\|4504817_4505027_-\|tail	tail protein X	E5FFI3	Burkholderia_phage	9.2e-07	48.4
WP_079218145.1\|4505026_4505518_-\|head	head completion/stabilization protein	K4NZV5	Burkholderia_phage	1.3e-32	54.8
WP_079218146.1\|4505607_4506327_-\|integrase	integrase	A0A2H4J948	uncultured_Caudovirales_phage	2.1e-42	46.0
WP_079218147.1\|4506329_4507373_-\|capsid	phage major capsid protein, P2 family	A4PE30	Ralstonia_virus	1.8e-114	63.7
WP_079218148.1\|4507428_4508265_-\|capsid	GPO family capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	6.6e-56	48.3
WP_079218149.1\|4508408_4510187_+\|terminase	terminase	A4JWQ1	Burkholderia_virus	1.5e-219	64.1
WP_079218150.1\|4510186_4511236_+\|portal	phage portal protein	K4NZV0	Burkholderia_phage	3.9e-122	60.6
WP_079218151.1\|4511238_4511451_+	hypothetical protein	NA	NA	NA	NA
WP_079218152.1\|4511808_4512252_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	8.2e-21	44.3
4514101:4514117	attR	NA	NA	NA	NA

DBSCAN-SWA_5

5328689 : 5360951

Burkholderia_phage(43.75%)

capsid,plate,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079218911.1\|5328689_5329361_+	recombination protein NinG	H2BDI7	Pseudomonas_virus	2.8e-28	39.7
WP_079218912.1\|5329361_5330162_+	hypothetical protein	A0A125RNK1	Pseudomonas_phage	4.7e-35	59.2
WP_079218913.1\|5330154_5330802_+	hypothetical protein	Q3HQZ7	Burkholderia_phage	4.5e-52	46.8
WP_079218914.1\|5330991_5331318_+	hypothetical protein	NA	NA	NA	NA
WP_079218915.1\|5331349_5332054_+	metallophosphoesterase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.2e-58	50.7
WP_079218916.1\|5332077_5332269_+	hypothetical protein	NA	NA	NA	NA
WP_148664581.1\|5332265_5332499_+	hypothetical protein	NA	NA	NA	NA
WP_158522643.1\|5332507_5332681_+	hypothetical protein	NA	NA	NA	NA
WP_079218917.1\|5332682_5333237_+	hypothetical protein	NA	NA	NA	NA
WP_079218918.1\|5333344_5333539_-	hypothetical protein	NA	NA	NA	NA
WP_079218919.1\|5333760_5334474_+\|terminase	terminase small subunit	A0A248SKT2	Klebsiella_phage	8.7e-49	47.8
WP_079218920.1\|5334424_5335972_+\|terminase	phage terminase large subunit	H9C0C7	Vibrio_phage	9.3e-112	45.5
WP_079218921.1\|5335968_5337519_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	1.5e-157	63.1
WP_079218922.1\|5337484_5338126_+\|capsid	minor capsid protein	A9YWZ8	Burkholderia_phage	1.7e-67	60.0
WP_079219372.1\|5338203_5339517_+	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	1.6e-64	45.9
WP_079218923.1\|5339529_5340021_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	1.0e-35	54.0
WP_079218924.1\|5340036_5341074_+	DUF2184 domain-containing protein	A0A0N7IRF2	Acinetobacter_phage	1.3e-125	67.9
WP_079218925.1\|5341085_5341496_+	hypothetical protein	NA	NA	NA	NA
WP_079218926.1\|5341505_5341889_+	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	3.3e-42	64.6
WP_079218927.1\|5341913_5342411_+	hypothetical protein	A9YX26	Burkholderia_phage	9.1e-37	54.9
WP_079218928.1\|5342413_5342785_+	hypothetical protein	A9YX28	Burkholderia_phage	7.5e-44	69.1
WP_079218929.1\|5342788_5343379_+	hypothetical protein	A9YX29	Burkholderia_phage	4.0e-63	61.2
WP_079218930.1\|5343391_5344864_+	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	6.8e-104	45.0
WP_079218931.1\|5344879_5345320_+	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	1.1e-38	56.2
WP_079218932.1\|5345322_5345769_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	2.5e-17	36.7
WP_079219373.1\|5345765_5345954_+	hypothetical protein	NA	NA	NA	NA
WP_079218933.1\|5345946_5347647_+	hypothetical protein	A0A2H4J9N7	uncultured_Caudovirales_phage	2.6e-38	34.8
WP_079218934.1\|5347643_5348219_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	2.0e-19	36.5
WP_079218935.1\|5348218_5348533_+	hypothetical protein	NA	NA	NA	NA
WP_079218936.1\|5348532_5349501_+	hypothetical protein	A9YX04	Burkholderia_phage	9.2e-126	77.2
WP_079218937.1\|5349500_5350247_+	hypothetical protein	A9YX06	Burkholderia_phage	3.3e-99	72.6
WP_079218938.1\|5350256_5350610_+	hypothetical protein	A9YX11	Burkholderia_phage	6.3e-32	62.4
WP_079218939.1\|5350606_5351785_+\|plate	baseplate J/gp47 family protein	A9YX12	Burkholderia_phage	4.4e-130	64.2
WP_079218940.1\|5351786_5352449_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	7.8e-92	73.9
WP_079218941.1\|5352458_5353475_+	hypothetical protein	A9YX14	Burkholderia_phage	1.4e-23	65.6
WP_148664582.1\|5353471_5353705_+	hypothetical protein	NA	NA	NA	NA
WP_148664583.1\|5353701_5354745_+	hypothetical protein	I6R1H9	Marinomonas_phage	5.2e-26	31.6
WP_148664584.1\|5354745_5355120_-	hypothetical protein	NA	NA	NA	NA
WP_079218943.1\|5355222_5355567_+	hypothetical protein	NA	NA	NA	NA
WP_148664585.1\|5355563_5355824_+	hypothetical protein	NA	NA	NA	NA
WP_079218945.1\|5355810_5356305_+	hypothetical protein	I6NSS1	Burkholderia_phage	3.0e-40	52.5
WP_079218946.1\|5356301_5356574_+	hypothetical protein	NA	NA	NA	NA
WP_158522645.1\|5356854_5358903_-	acyltransferase family protein	A0A1R3Y5Q6	Salmonella_virus	2.9e-81	39.4
WP_079218948.1\|5358989_5359418_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	1.4e-14	39.5
WP_079218949.1\|5359569_5359752_-	type II toxin-antitoxin system HicA family toxin	A0A0R6PJD4	Moraxella_phage	7.2e-16	60.0
WP_079218950.1\|5359882_5360278_+	hypothetical protein	NA	NA	NA	NA
WP_079218951.1\|5360306_5360951_+	SOS response-associated peptidase family protein	C7BGE4	Burkholderia_phage	1.0e-48	45.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage