CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP014794	Bacillus licheniformis strain SCCB 37, complete genome	1 crisprs	DinG,csa3,DEDDh,WYL,cas3	16	23	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP014794_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP014794_1

211982-215025

Orphan

Consensus_repeat	Method
GGAGCNACNGGNNCNACNGG	CRT

49 spacers

The CRISPR arrays of NZ_CP014794_1

>merge|NZ_CP014794|1|211982-215025|CRT
GGAGTAACAGGAGTAACAGGTCCGACAGGAGCAACAGGCCCAACGGGTCCAACAGGAGTAACCGGGGCAACGGGAGCGACAGGCGCAACGGGAGCGACGGGTCCAACAGGAGCAACCGGAGCCACAGGCGCAACAGGCTCAACCGGTCCAACAGGAGTAACCGGGGCAACGGGAGCGACAGGCGCAACCGGAGCGACGGGTCCAACAGGGGCGACAGGCCCAACGGGTCCAACAGGAGTAACCGGGGCAACAGGAGCAACAGGCCCAACAGGAGCAACGGGTCCAACAGGGGCAACAGGCCCAACGGGTCCAACTGGAGCGACAGGCGCAACAGGTCCGCCAGGAGCAACCGGCCCGACGGGAGCAACCGGAGCCACAGGCTCAACCGGTCCAAAAGGAGTAACAGGAGTAACAGGTCCGACAGGAGCAACAGGCCCAACGGGTCCAACAGGAGTAACCGGGGCAACGGGAGCGACAGGAGCAACGGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACGGGTCCAACAGGGGCAACAGGAGCGACAGGTCCAACAGGGGCAACAGGAGCGACAGGTCCAACAGGGGCAACAGGTCCAACGGGAGCAACAGGCCCAACAGGAGCAACCGGCCCGACAGGCGCAACCGGAGCAACGGGTCCAACCGGAGCAACGGGTCCAACAGGAGCAACAGGTCCGACGGGAGCAACCGGCCCAACAGGCCCGACAGGAGCAACAGGTCCGACAGGAGCAACCGGCCCAACAGGAGCAACAGGTCCGACGGGAGCAACCGGCCCAACGGGTCCAACAGGAGTAACCGGGGCAACGGGAGCCACAGGCGCAACGGGAGCGACGGGTCCAACAGGGGCGACAGGCCCAACGGGTCCAACCGGAGCCACAGGTCCAACAGGAGTAACCGGGGCAACCGGAGCAACGGGAGCGACGGGTCCAACAGGGGCAACAGGAGCAACCGGGGCAACAGGAGCGACGGGAGCAACCGGGGCAACAGGAGCGACGGGAGCAACCGGGGCAACAGGAGCGACGGGAGCAACCGGGGCAACAGGAGCGACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGCCGCGGGAGCGACAGGTCCAACCGGCGCAACGGGAGCAACAGGACCAACAGGAGCAACAGGACCAACAGGCCCGACAGGCGCAACGGGAGCGACAGGAGCAACCGGTCCAACGGGAGCGACAGGCGCAACCGGTCCAACGGGAGCGACAGGAGCAACCGGCCCGACAGGGGCAACCGGAGCCACAGGCGCAACGGGATCAACGGGTCCAACAGGTCCAACAGGAGCGACAGGCCCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAGCGACAGGCCCAACCGGTCCGACGGGAGCAACCGGCCCGACAGGAGCAACCGGCCCAACCGGTCCGACGGGAGCAACAGGTCCAACGGGAGCAACCGGCCCGACAGGCGCAACGGGAGCAACCGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACAGGTCCAACGGGAGCAACCGGCCCGACAGGCGCAACGGGAGCAACCGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACAGGTCCGACGGGAGCAACAGGCGCAACCGGCCCGACAGGAGCAACCGGAGCGACAGGAGCAACAGGTCCGACGGGAGCAACGGGAGCAACCGGAGCGACAGGAGCAACAGGCGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGCGCAACGGGAGCAACCGGTCCAACCGGAGCAACGGGAGCAACCGGCCCGACAGGAGCAACAGGTCCAACGGGAGCAACCGGCCCGACAGGAGCAACAGGTCCGACGGGAGCAACCGGCGCAACCGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACAGGTCCGACGGGAGCAACAGGCGCAACCGGAGCAACCGGCGCAACCGGAGCAACGGGAGCAACCGGCCCGACAGGTCCAACGGGAGCGACAGGCGCAACGGGAGCAACCGGAGCGACAGGCGCAACAGGTCCAACCGGAGCAACCGGCCCGACAGGTCCAACGGGAGCGACAGGCGCAACAGGTCCAACCGGAGCGACAGGAGCAACAGGTCCAACGGGAGCGACAGGCCCAACAGGCCCAACTGGAGCAACCGGCCCGACGGGAGCAACCGGAGCGACAGGCCCAACAGGTCCGACGGGAGCCACGGGAGCCACGGGAGCGACAGGAGCAACCGGAGCGACAGGAGCAACAGGTCCAACAGGAGCAACGGGAGCAACCGGAGCGACAGGAGCAACGGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACCGGCCCGACGGGAGCAACCGGAGCGACAGGAGCAACCGGAGCAACGGGAGCAACCGGAGCGACAGGAGCAACAGGTCCAACAGGAGCAACGGGAGCAACCGGCCCGACAGGTCCAACGGGAGCGACAGGCGCAACGGGAGCAACCGGAGCGACAGGCCCAACAGGTCCAACGGGAGCGACAGGCGCAACGGGAGCAACCGGAGCGACAGGCCCAACCGGAGCAACGGGAGCAACCGGAGCGACAGGCCCAACCGGAGCAACGGGAGCAACCGGCCCGACGGGAGCAACGGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACAGGTCCAACCGGAGCAACGGGAGCGACAGGTCCAACAGGTCCAACCGGAGCGACAGGTCCAACTGGCCCGACAGGTCCAACTGGCCCGACAGGTCCAACCGGCCCGACAGGTCCAACTGGCCCAACAGG

>NZ_CP014794|1|1|211982-215025|CRT
GGAGTAACAGGAGTAACAGG	TCCGACAGGAGCAACAGGCCCAACG
GGTCCAACAGGAGTAACCGG	GGCAACGGGAGCGACAGGCGCAACGGGAGCGACG
GGTCCAACAGGAGCAACCGG	AGCCACAGGCGCAACAGGCTCAACC
GGTCCAACAGGAGTAACCGG	GGCAACGGGAGCGACAGGCGCAACCGGAGCGACG
GGTCCAACAGGGGCGACAGG	CCCAACGGGTCCAACAGGAGTAACC
GGGGCAACAGGAGCAACAGG	CCCAACAGGAGCAACGGGTCCAACA
GGGGCAACAGGCCCAACGGG	TCCAACTGGAGCGACAGGCGCAACAGGTCCGCCA
GGAGCAACCGGCCCGACGGG	AGCAACCGGAGCCACAGGCTCAACCGGTCCAAAAGGAGTAACA
GGAGTAACAGGTCCGACAGG	AGCAACAGGCCCAACGGGTCCAACAGGAGTAACCGGGGCAACGGGAGCGACAGGAGCAACG
GGAGCGACGGGTCCAACAGG	GGCAACAGGAGCGACGGGTCCAACAGGGGCAACA
GGAGCGACGGGTCCAACAGG	GGCAACAGGAGCGACGGGTCCAACAGGGGCAACA
GGAGCGACGGGTCCAACAGG	GGCAACAGGAGCGACGGGTCCAACAGGGGCAACA
GGAGCGACGGGTCCAACAGG	GGCAACAGGAGCGACGGGTCCAACAGGGGCAACA
GGAGCGACGGGTCCAACAGG	GGCAACAGGAGCGACGGGTCCAACAGGGGCAACA
GGAGCGACAGGTCCAACAGG	GGCAACAGGAGCGACAGGTCCAACAGGGGCAACAGGTCCAACG
GGAGCAACAGGCCCAACAGG	AGCAACCGGCCCGACAGGCGCAACCGGAGCAACGGGTCCAACC
GGAGCAACGGGTCCAACAGG	AGCAACAGGTCCGACGGGAGCAACCGGCCCAACAGGCCCGACA
GGAGCAACAGGTCCGACAGG	AGCAACCGGCCCAACAGGAGCAACAGGTCCGACG
GGAGCAACCGGCCCAACGGG	TCCAACAGGAGTAACCGGGGCAACG
GGAGCCACAGGCGCAACGGG	AGCGACGGGTCCAACAGGGGCGACAGGCCCAACGGGTCCAACC
GGAGCCACAGGTCCAACAGG	AGTAACCGGGGCAACCGGAGCAACG
GGAGCGACGGGTCCAACAGG	GGCAACAGGAGCAACCGGGGCAACA
GGAGCGACGGGAGCAACCGG	GGCAACAGGAGCGACGGGAGCAACCGGGGCAACA
GGAGCGACGGGAGCAACCGG	GGCAACAGGAGCGACGGGTCCAACCGGAGCGACAGGTCCAACAGGAGCCGCG
GGAGCGACAGGTCCAACCGG	CGCAACGGGAGCAACAGGACCAACAGGAGCAACAGGACCAACAGGCCCGACAGGCGCAACG
GGAGCGACAGGAGCAACCGG	TCCAACGGGAGCGACAGGCGCAACCGGTCCAACG
GGAGCGACAGGAGCAACCGG	CCCGACAGGGGCAACCGGAGCCACAGGCGCAACGGGATCAACGGGTCCAACAGGTCCAACA
GGAGCGACAGGCCCAACCGG	TCCGACGGGAGCAACCGGCCCGACA
GGAGCGACAGGCCCAACCGG	TCCGACGGGAGCAACCGGCCCGACA
GGAGCAACCGGCCCAACCGG	TCCGACGGGAGCAACAGGTCCAACG
GGAGCAACCGGCCCGACAGG	CGCAACGGGAGCAACCGGAGCGACA
GGAGCAACCGGCCCGACAGG	AGCAACAGGTCCAACGGGAGCAACCGGCCCGACAGGCGCAACG
GGAGCAACCGGAGCGACAGG	AGCAACCGGCCCGACAGGAGCAACCGGCCCGACAGGAGCAACAGGTCCGACGGGAGCAACA
GGCGCAACCGGCCCGACAGG	AGCAACCGGAGCGACAGGAGCAACAGGTCCGACGGGAGCAACGGGAGCAACCGGAGCGACAGGAGCAACA
GGCGCAACCGGCCCGACAGG	AGCAACCGGCCCGACAGGCGCAACGGGAGCAACCGGTCCAACCGGAGCAACG
GGAGCAACCGGCCCGACAGG	AGCAACAGGTCCAACGGGAGCAACCGGCCCGACAGGAGCAACAGGTCCGACGGGAGCAACCGGCGCAACCGGAGCGACA
GGAGCAACCGGCCCGACAGG	AGCAACAGGTCCGACGGGAGCAACAGGCGCAACCGGAGCAACCGGCGCAACCGGAGCAACG
GGAGCAACCGGCCCGACAGG	TCCAACGGGAGCGACAGGCGCAACGGGAGCAACCGGAGCGACAGGCGCAACAGGTCCAACC
GGAGCAACCGGCCCGACAGG	TCCAACGGGAGCGACAGGCGCAACAGGTCCAACCGGAGCGACAGGAGCAACAGGTCCAACGGGAGCGACAGGCCCAACAGGCCCAACT
GGAGCAACCGGCCCGACGGG	AGCAACCGGAGCGACAGGCCCAACAGGTCCGACGGGAGCCACGGGAGCCACGGGAGCGACA
GGAGCAACCGGAGCGACAGG	AGCAACAGGTCCAACAGGAGCAACGGGAGCAACCGGAGCGACAGGAGCAACG
GGAGCAACCGGCCCGACAGG	AGCAACCGGCCCGACAGGAGCAACCGGCCCGACG
GGAGCAACCGGAGCGACAGG	AGCAACCGGAGCAACGGGAGCAACCGGAGCGACAGGAGCAACAGGTCCAACAGGAGCAACG
GGAGCAACCGGCCCGACAGG	TCCAACGGGAGCGACAGGCGCAACG
GGAGCAACCGGAGCGACAGG	CCCAACAGGTCCAACGGGAGCGACAGGCGCAACG
GGAGCAACCGGAGCGACAGG	CCCAACCGGAGCAACGGGAGCAACCGGAGCGACAGGCCCAACC
GGAGCAACGGGAGCAACCGG	CCCGACGGGAGCAACGGGAGCGACAGGAGCAACCGGCCCGACAGGAGCAACAGGTCCAACC
GGAGCAACGGGAGCGACAGG	TCCAACAGGTCCAACCGGAGCGACA
GGTCCAACTGGCCCGACAGG	TCCAACTGGCCCGACAGGTCCAACCGGCCCGACA
GGTCCAACTGGCCCAACAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP014794.1\|WP_016886263.1\|217595_218138_-\|transferase	unknown	unknown	gnl\|CDD\|100053
NZ_CP014794.1\|WP_011197645.1\|204456_205869_+\|PTS-system-trehalose-specific-EIIBC-component	unknown	unknown	gnl\|CDD\|273916
NZ_CP014794.1\|WP_080626749.1\|202855_204268_+\|sodium:alanine-symporter-family-protein	unknown	unknown	gnl\|CDD\|224040
NZ_CP014794.1\|WP_003179771.1\|225473_226538_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP014794.1\|WP_080626750.1\|226623_227919_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|274399
NZ_CP014794.1\|WP_080624186.1\|199307_200060_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|237252
NZ_CP014794.1\|WP_085959889.1\|215231_216394_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP014794.1\|WP_003179769.1\|224367_225477_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NZ_CP014794.1\|WP_003179750.1\|208474_209167_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|100048
NZ_CP014794.1\|WP_061577025.1\|205941_207630_+\|alpha,alpha-phosphotrehalase	unknown	unknown	gnl\|CDD\|274115
NZ_CP014794.1\|WP_009329065.1\|207651_208368_+\|trehalose-operon-repressor	unknown	unknown	gnl\|CDD\|274116
NZ_CP014794.1\|WP_003179739.1\|202407_202794_+\|DUF1992-domain-containing-protein	unknown	unknown	gnl\|CDD\|378159
NZ_CP014794.1\|WP_075223375.1\|220724_222968_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
NZ_CP014794.1\|WP_075223376.1\|223162_224245_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133005
NZ_CP014794.1\|WP_003179731.1\|198803_198935_-\|DUF2639-domain-containing-protein	unknown	unknown	gnl\|CDD\|288026
NZ_CP014794.1\|WP_080624187.1\|209293_210592_+\|collagen-like-protein	unknown	unknown	gnl\|CDD\|189968
NZ_CP014794.1\|WP_003179756.1\|216507_217599_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	unknown	unknown	gnl\|CDD\|99740
NZ_CP014794.1\|WP_044822245.1\|200184_202146_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP014794.1\|WP_003179762.1\|219196_220570_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|223515
NZ_CP014794.1\|WP_003179761.1\|218155_219130_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566

Protein	Function_ID	Function_description	E-value
NZ_CP014794.1\|WP_016886263.1\|217595_218138_-\|transferase	gnl\|CDD\|100053	cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.	1.63987e-36
NZ_CP014794.1\|WP_011197645.1\|204456_205869_+\|PTS-system-trehalose-specific-EIIBC-component	gnl\|CDD\|273916	TIGR01992, phosphotransferase_system_trehalose_permease, PTS system, trehalose-specific IIBC component. This model represents the fused enzyme II B and C components of the trehalose-specific PTS sugar transporter system. Trehalose is converted to trehalose-6-phosphate in the process of translocation into the cell. These transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci and Streptococci which contain their own A domain as a C-terminal fusion. This family is closely related to the sucrose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively). In E. coli, B. subtilis and P. fluorescens the presence of this gene is associated with the presence of trehalase which degrades T6P to glucose and glucose-6-P. Trehalose may also be transported (in Salmonella) via the mannose PTS or galactose permease systems, or (in Sinorhizobium, Thermococcus and Sulfolobus, for instance) by ABC transporters.	0
NZ_CP014794.1\|WP_080626749.1\|202855_204268_+\|sodium:alanine-symporter-family-protein	gnl\|CDD\|224040	COG1115, AlsT, Na+/alanine symporter [Amino acid transport and metabolism].	0
NZ_CP014794.1\|WP_003179771.1\|225473_226538_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	3.52576e-71
NZ_CP014794.1\|WP_080626750.1\|226623_227919_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|274399	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase. Enzymes in this family catalyze the NAD-dependent alcohol-to-acid oxidation of nucleotide-linked sugars. Examples include UDP-glucose 6-dehydrogenase (1.1.1.22), GDP-mannose 6-dehydrogenase (1.1.1.132), UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136), UDP-N-acetyl-D-galactosaminuronic acid dehydrogenase, and UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase. These enzymes are most often involved in the biosynthesis of polysaccharides and are often found in operons devoted to that purpose. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.	6.98796e-180
NZ_CP014794.1\|WP_080624186.1\|199307_200060_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|237252	PRK12896, PRK12896, methionine aminopeptidase; Reviewed.	7.58757e-143
NZ_CP014794.1\|WP_085959889.1\|215231_216394_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.66073e-53
NZ_CP014794.1\|WP_003179769.1\|224367_225477_+\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	5.519e-169
NZ_CP014794.1\|WP_003179750.1\|208474_209167_+\|N-acetyltransferase	gnl\|CDD\|100048	cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.	9.65846e-50
NZ_CP014794.1\|WP_061577025.1\|205941_207630_+\|alpha,alpha-phosphotrehalase	gnl\|CDD\|274115	TIGR02403, Trehalose-6-phosphate_hydrolase, alpha,alpha-phosphotrehalase. Trehalose is a glucose disaccharide that serves in many biological systems as a compatible solute for protection against hyperosmotic and thermal stress. This family describes trehalose-6-phosphate hydrolase, product of the treC (or treA) gene, which is often found together with a trehalose uptake transporter and a trehalose operon repressor.	0
NZ_CP014794.1\|WP_009329065.1\|207651_208368_+\|trehalose-operon-repressor	gnl\|CDD\|274116	TIGR02404, Trehalose_operon_transcriptional_repressor, trehalose operon repressor, B. subtilis-type. This family consists of repressors of the GntR family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gram-positive lineages and does not include the TreR from E. coli. [Regulatory functions, DNA interactions].	1.1936e-116
NZ_CP014794.1\|WP_003179739.1\|202407_202794_+\|DUF1992-domain-containing-protein	gnl\|CDD\|378159	pfam09350, DUF1992, Domain of unknown function (DUF1992). This family of proteins are functionally uncharacterized.	9.89474e-19
NZ_CP014794.1\|WP_075223375.1\|220724_222968_-\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.68413e-24
NZ_CP014794.1\|WP_075223376.1\|223162_224245_+\|glycosyltransferase	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	1.05282e-45
NZ_CP014794.1\|WP_003179731.1\|198803_198935_-\|DUF2639-domain-containing-protein	gnl\|CDD\|288026	pfam11121, DUF2639, Protein of unknown function (DUF2639). This family is conserved in the Bacillaceae family. Several members are named as being YflJ, but the function is not known.	1.6997e-09
NZ_CP014794.1\|WP_080624187.1\|209293_210592_+\|collagen-like-protein	gnl\|CDD\|189968	pfam01391, Collagen, Collagen triple helix repeat (20 copies). Members of this family belong to the collagen superfamily. Collagens are generally extracellular structural proteins involved in formation of connective tissue structure. The alignment contains 20 copies of the G-X-Y repeat that forms a triple helix. The first position of the repeat is glycine, the second and third positions can be any residue but are frequently proline and hydroxy-proline. Collagens are post translationally modified by proline hydroxylase to form the hydroxy-proline residues. Defective hydroxylation is the cause of scurvy. Some members of the collagen superfamily are not involved in connective tissue structure but share the same triple helical structure. The family includes bacterial collagen-like triple-helix repeat proteins.	2.08722e-08
NZ_CP014794.1\|WP_003179756.1\|216507_217599_-\|DegT/DnrJ/EryC1/StrS-family-aminotransferase	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.26658e-109
NZ_CP014794.1\|WP_044822245.1\|200184_202146_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP014794.1\|WP_003179762.1\|219196_220570_-\|glycosyltransferase	gnl\|CDD\|223515	COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane].	6.50184e-16
NZ_CP014794.1\|WP_003179761.1\|218155_219130_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.31481e-70

>NZ_CP014794.1|WP_080624187.1|209293_210592_+|collagen-like-protein
MSIRNAVMNGGFETGTLSSWLGVNASVTSQFSHSGFFSARFLGGTVTSYIAQFVPARAGEGSEFLVSLARASFLPAPSVTIQVTYFDSQFNFLGYGLFATVPSSRIPAAENGTWLEVYQTTSPAPSGTTQAFILINNIPQAGTASVLVDDVALLSVEGGGGPTGATGPTGATGVTGATGATGATGVTGPTGAPGPTGVTGPTGVTGATGPTGPTGATGPTGATGATGPTGATGPTGATGATGPTGVTGPTGATGPTGATGSTGAPGPTGVTGPTGATGATGATGPTGATGPTGATGPGSLLGTLAQSTDPVSLTVGSETPILTTTVTSSAGQNIKLDSMAEVDIIIGPATTFEYSIIFTLYRNNSAIAQVSVDSQDEKSAGSVRVYGDIPNLTWVDTPGAGTQTYEVRINVTGTNLLAANVNTRALNAVIFD
>NZ_CP014794.1|WP_003179750.1|208474_209167_+|N-acetyltransferase
MIHETAKIGKNVVLGEHAVIEENVVIGDNVTIGHHAIIKKDTHIGSGVKIGDLAVLGKAASSNKKMARQPKQAGAPLRIEDDAIVGASAVIYRDVLLEQGVFVGDMASIRENVAIGRESIIGRNAMVENNTRIGSKATIQTGCYITADMTIEDEVFIGPCCSTSNDKYMGKGNYPYQGPTIKRGAKIGNNATLLPAVVVGEGAVIGAGAVITKDVPAGKTAVGNPGRLMK
>NZ_CP014794.1|WP_009329065.1|207651_208368_+|trehalose-operon-repressor
MKINKYMMIYKQIAEQIDQSILNAGDILPSENDLAEQHDTSRETVRKALNVLAQNGYIQKIKGKGSVVLHREKMQFPVSGLVSFKELSETLGKETSTTVHEFGLTHPDAYIQKQLRTSGDEEVWRVVRSRNINGERIILDKDYFIRKHVPLLTKEICEDSIYQYLEDECGLVISYAHKEIVVEPCTAEDQEYLDLNGYEHIVVVKNFVFLDDTTLFQYTESRHRLDKFRFVDFARREK
>NZ_CP014794.1|WP_061577025.1|205941_207630_+|alpha,alpha-phosphotrehalase
METKENPWWKKAVVYQIYPKSFKDTTGNGVGDIRGIIEKLDYIKELACDVIWLTPIYQSPQNDNGYDISDYYSIHEEYGTMADFEELLEEAHKRGIKVIMDLVVNHTSTEHRWFKEAASGKENLYRDFYIWKDMKPNGAPPTNWESKFGGSAWEFHAESGQYYLHLYDVTQADLNWENEAVRKKVYEMMHFWFEKGIDGFRLDVINVISKDQRFPDDDEGDGRRFYTDGPRVHEFLNEMNREVFSKYDSMTVGEMSSTTIADCIRYTNPESRELDMVFNFHHLKADYPNGEKWALADFDFLKLKKILSEWQTEMNKGGGWNALFWCNHDQPRIVSRYGDDGKYRKKSAKMLATVIHMLQGTPYIYQGEELGMTNPKFDDISLYRDVESLNMYRILKEAGKPEAEIIEILKAKSRDNSRTPVQWNGEENAGFTAGTPWIPVPDNYKEINAEEALNDPDSIFYHYKKLNELRKEFDIITTGDYQLILEDDQELYAYLRNGADEKLLVINNFYGKETEFQLPDDIDIEGYDAKVLISNDTDLPESFKRFTVKPYQSIVYHLAKPC
>NZ_CP014794.1|WP_011197645.1|204456_205869_+|PTS-system-trehalose-specific-EIIBC-component
MTDLNQSARRIVDAVGGADNIAAVTHCVTRLRFALLDESKVNQEVLEQIDVVKGSFSTNGQFQVVIGQGTVNNVYAELVKATGIGESSKDDVKKASEKNMNPLQRAVKTLADIFIPILPAIVTAGLLMGINNILTAQDIFFSGKSIVEVYPQWADLANMINLIAGTAFAFLPALIGWSAVKRFGGNPLLGIVLGVMLVHPDLLNAWGYGAAEQSGEIPVWNLFGLEVQKVGYQGQVLPILLASYLLAKIERFLTKRTPESIQLLVVAPITLLVTGFASFIVLGPITFAIGNVLTSGLIAVFEQFAVLGGLLYGGLYAALVITGMHHTFLAVDLQLIGSKLGGTFLWPMLALSNIAQGSAALAMMFIVKDEKQKGLSLTSGISAYLGITEPALFGVNLRYRFPFVIAMISSGIAGMFISSQGVLASSVGVGGVPGIFSIMSQYWGAFAIGMAIVLIAPFAGTYLYAKLKMK
>NZ_CP014794.1|WP_080626749.1|202855_204268_+|sodium:alanine-symporter-family-protein
MERLLNWVEYISDWLWGPPLIILLTGTGVYLTILLKFFQFRYPLYIFKQTIGSVGKKPKGEGTVTPLQALTSALSSTVGAANIVGVSAAIMFGGPGAVFWMWLVALFAMAIKFSESVLAVHYREKNEEGEYVGGPMYYITKGLSMKWLGVFFSVALMIELVPSIMVQGNSVSASLAETFSFNRLYTGIGIAFLIGLVVIGGIKRIGKVTELAVPLMAGAYIGAGFLIVVTNLSSVPAFFSLIFSNAFTSSSAFGGFAGAAVAETVRWGFARGLYSNEAGMGTAPIAHAAAMTDHPVRQGFWAVIGIVVDTLLICTTTAFVVLASGVWTGENASSDPGALAAAAFRSYFGPVGGYFVSVSLVFFVLSTITVVIFYGVKQAEFLFGRLAGHVIKFIYLAAVVIGAAGGAKAIWGFLDLALVFILLPNILAVLLLSRKVRSLYDEFFTSEKYYLKDIGQQDGVYEGDEKVNNL
>NZ_CP014794.1|WP_003179739.1|202407_202794_+|DUF1992-domain-containing-protein
MDFSSIVSEDKIKQAIKDGEFEGLPGMGKPLKKDDAAHVPEHLRMAYRVMKNAGMAGDEGALKKELMTIDDLIAKCADEDERERLIERKTETRLRLDRLADKKGMFSKPASAFYKEKVYRRLSGNKKR
>NZ_CP014794.1|WP_044822245.1|200184_202146_-|LTA-synthase-family-protein
MKRFIKERGLAFFLIAAILLWLKTYAAYVIEFNLGITNTVQHILLFVNPISSSLFFLGLGLLFKKKIQQTAIIVIHFLMSFLLYANVVYYRFFSDFITLPTIMQAKTNGGQLGDSIFSLMHPLDVLYFIDTFILIGLAVFYNRPSETTTKRPFKIVMGASILVFLANLAVAEIDRPELLTRSFDRNYLVKYLGTYNFTIYDAVQNIKSNSQRALASSSDVTEVENYIKANHDKPNAEYFGKAKGMNVVYISLESLQTFLIDYKLDGKEVTPFLNSLAHDNETFYFDNFFHQTGQGKTSDAEFMMDNSLYPLSQGSVFINKAQNTLQSAPAILKSQGYTSAAFHGNYKTFWNRNEMYKAIGYDKFFDATYYDMSEDKTKNYGLKDKPFFEESMPLLKSLKQPFYTKFITLSNHFPFEMDEGDTDFPAGDTGDSVVDHYFQSANYMDQALEQFFNDLKKAGLYDNTIVVMYGDHYGISENHNKAMAKVLGKDITPYENAQLQRVPLFIHAPGVKGIKSHKYGGEVDVAPTLLHLMGVNTKDYLMSGSDLLSPEHREIIPFRNGDFVSPEYTKTNGNYYDTKTGELLNEKDIDPNIEEAVKKELEMSDKIVDGDLLRFYKPKGFKAINPSDYDYTNHNPKTSESDAAQTTKSDSGQ
>NZ_CP014794.1|WP_080624186.1|199307_200060_-|type-I-methionyl-aminopeptidase
MIVTNDQELEGLKKIGRIVALAREEMKAKAAPGMSTKELDHIGKEVLEAHGAASAPEKEYDFPGTTCISVNDEVAHGIPSESRILKEGDLINIDISAEFGGYYSDTGISFVLGKGDEMLHKLCQSAESAFQKGLLQARAGKKQNQIGRAVYNEAKANGFTVIKNLTGHGIGRNLHEAPNHILNYYDPFDNALFKNGTVIALEPFVSTKAEHTIEAGDGWTFKTPDGSFVAQIEHTIVITKNEPIILTQLD
>NZ_CP014794.1|WP_003179731.1|198803_198935_-|DUF2639-domain-containing-protein
MHYGSKGWYVEELKKLGMTKYEGRKLQSYKKHFLANLLESVKK
>NZ_CP014794.1|WP_085959889.1|215231_216394_-|IS3-family-transposase
MGTRVHYAEEVKWEVIKMKQAGMTNKEIMEQLGIKNKTQIKTWMRWYKTGQTYRFSQQVGKQYSYGKESEEMSELEELKLKNKQLEAQLAIIKKVPGDRKELEPRVIVQVVEELSATFKIIDILGVLGIPKSTYYRWKKKYKKVELTSLEELVIKLCKKNFYHYGHRKIKSILNRKYGINVNRKTVQKIMQKFEIQCQVKKKRQKYICGESNIIVPNTLNRNFKASRLNEKWVTDITYLPYGSTMLYLSTIMDLYNNEIVAYKIGTSQDINLVLDTLREAVELRKPVGLLLHSDQGSVYTSHAYQNLAKEKGITTSMSRKGNCHDNAVIESFHSSLKSEGFNAQSRASISNSKVVQIVNQYMYRYNHVRIQAKLNYLSPLEYRGQAA
>NZ_CP014794.1|WP_003179756.1|216507_217599_-|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIRLIEPYITFEEVQAELKEIFSSGMLTKGPYVRTFADHMRQYVSAKHAFLTTSATTALSMCLKSLNVQPGDEVIVSDFSFPATVNVIEDLGAKPVFADVDLETFNMLPEELESQITSRTKAVLFVDALGNPTGITNIKQICKEYGLPLVDDAACAIGSSEYGCKSGKIADLTCFSFHPRKLLTTGEGGAITTDREELKDWLSVKLNHGAAISDGKLDFIDFGYNYRLSDIQAALGIKQLQKLDDIIHRRNLQQKAYSEQLEPLGFQSQQIGPNVVHNIQSAVFKVPKNIVRDELIQYLSDCHIESTFGTYCLSGTTYYRRKYRQIKPNSIFLEQNTITLPCHDQVNVDQVVSAIQSFSQRKG
>NZ_CP014794.1|WP_016886263.1|217595_218138_-|transferase
MKQWKSEGKGEFTLSQLGGCGENVVIEDGVRIFHPENIYIGDNVYIGHDTILKGYYKHDLVIGSNSWIGQQCFIHGAGGVTIGEFAGIGPNVRMHAAYHTDPDKPDSTILFSPLTFAPIHIEENCNIGIGASILAGVTIGAHSKIGANAVVNRNIPPYSIAVGVPAKVIKNRRMKDEDLS
>NZ_CP014794.1|WP_003179761.1|218155_219130_-|NAD-dependent-epimerase/dehydratase-family-protein
MSNMTELSGQHIFITGGAGFIGSSLIGKLIERNSVTVYDNFSRDSLRYKPYRDHPHLKVVQGDILDLNALKKAIQGASHIVHAAGIAGIDTVIQNPVKTMQVNMIGSANLLEAAAGLTECKRVVCFSTSEVFGQIAFRARETSHTVLGAVGEARWTYAVSKLAEEHMAYAYFKELGLPTVTVRPFNVYGPEQVGEGAIKTMVHRALLDEPIYIHGDGTQIRAWCYVDDMIDGILRCLTMKEAVGESFNIGNERTVITVYGLASTIIRVLGSKSQIFFGEKKEADIELRIPQVNKAKEMLGFSAKVDLEEGIRRTAESIKKNLEQ
>NZ_CP014794.1|WP_003179762.1|219196_220570_-|glycosyltransferase
MKDFKSDIIHCLEQKEWNKAMKRLKEWEAEGSHNEPDFYFLQASLSVYLGHDHNAWLWLWRGLDLFPENRSLNLLMGKVCLRTGREKESAAYLQKGDGAETASAPKLDLPVDEKTEPPAGQIRILQGTMEIANQMNTLAKGLSQHGALAHTLNYYPYYLNYAADYTWSLLKERNTPAMNAKLRRLANDLLPSYDLFHFHFGTSFTLDMSDYPILKQAEKPMVMHHWGSDVRLYSTLAKTNPYAVVKTKNEARIRYHLKRISQYVQHCIVADMELYEYVKDYYEHVHMIPTMIQLDRYTPDYRSNEKPLIVHAPTSPGIKGTRHILKAVESLKEKYDFHFHLVQGVSHEQAKKIYQKADLIIDQLHIGSYGLFAVESMAMGKPVICWISDFMKDHYPSELPLIRANPANITEVIESVLKNRDMLPEIGQKGRKYAEVHHDMVKNSKKTLAVYQSLLSE
>NZ_CP014794.1|WP_075223375.1|220724_222968_-|glycosyltransferase
MDNELEYLLDSVGLSWRETEISQLIFHHKWHDAAQKLEEKLKAAPFDPGLLISAAFVCEKKQQAQRASELYDDALLFVRREHRPRLMKEKEDLFKKMVRRPKIIFFVKPDLDRFLNSVVEHLSGTYRTKKIVVHDLNQIDAGMQWADICWFEWCDDLLIHGSKVPSAAAKTLICRLHSYEAFTFYIKKVYWQAVDQVIFDGEHLREYVLDQVKALKKEKTAVVPNGIKLDQYTFKQRQKGFHIAYVGYINYKKGPMLLLQAFKALIDKDPRYKLFIAGTFQDARYQLYFKQMIDELRLTDSVQFDGWQDDMNQYLEDKHYLICTSLLESQHMSAMEAMAKGIKPLIHNFYGAKTIYDESVVWNTIDEFVAMITSGDYTSLHYRSFIEEHYSYDLSMRKIEEMISGFAKQSELTVILNPPLITVGIINYNYSSFIDECLQSVLNQYYPNIDILIIDDHSTDGSMQKTSSYQKTHPHIRAICHSENTKLPDLAFKEIFQEAKGEYVLLLSADDFLPHNLVIHDFMQCFFEEEELDYVYGDLLLVDQHGKNAGLWTYQEYGDEELVRTIFQRGGSGIVPMVGMFKASYYQQKGFTWLVDPQKPLAGDVLNCLANTKRGWKRRYLKKPVLCYRRHQKNISYQLHKRIQSLVYVMDYIVKEFDESVYFPHIKWKELEENQRQSLKYFSIGKTFWRMARRYAQNGYTRHLDHDGKKECIQPLLNKMDEYFQLSLASDNQYERYMKNIKKIQLI
>NZ_CP014794.1|WP_075223376.1|223162_224245_+|glycosyltransferase
MVTISLCMIVKNEEEVLARCLDTVKDIVDEINIVDTGSTDKTVEIAKRYTDLVFFFEWIGDFAAARNESFKHATKDYILYLDADDVLLEEDQKKLKELKETLDPSVDSVSMYYDAGTDEFGNVTLRYRRNRLVKREKNFKWKGDCHQYLEVFGNIINADISVTHKKIRHSVGRNLNIYQKKIDRGDTFTPRDYFYYGNELRENRHYEKAIESYNKNIEMKEGWIEDKVYACINKADCHRFLGDMDNELRSLFQSFEFSKTPRAETCSRIGYNFQRRREYKAAIYWYELATTLVPDSNKWSFTYPAYYTWYPHLQMCVCYYNLGDFEKSYHHNEEARKYRPEDKSVLHNKQLLEGKLGINN
>NZ_CP014794.1|WP_003179769.1|224367_225477_+|DegT/DnrJ/EryC1/StrS-family-aminotransferase
MIPLVNLKRQFQTVKQDILKEFEHVLDSGQYILGPKVEELEKRIAEKLGVKEAVAVANGTDALVLTLEAFGIGKGDEVITTPFTFFATAEAVSRVGAEPVFADVDPETYNLDPKKIEEKITPATKAIIPVHIFGQPADMDEIMELAKKHGLLVIEDACQAFGASYKERPVGSIGDAACFSFFPTKNLGTLGDGGMVTISDPDAARQLRTLRTHGTSKKYFHDKIGFNSRLDELHAAALLILLEKIDGWNEQRRRVASRYREGLKTAEHLTLPAEKEDRTHIYHLYCIGAKNRDYIIQSLKEQDIHSGVYYPCCLHLQSVYSSLQYKKGDFPIAESLSETLFAIPMDPFLAAEEQDQIISALLKKGGGEK
>NZ_CP014794.1|WP_003179771.1|225473_226538_+|Gfo/Idh/MocA-family-oxidoreductase
MTVHFGLIGCGYMSRKHLQALAECDDAKLSAVSDLQEERMKEAEEYYASLAGEESRMTRYPQYQALLSDPKIEAVIIAAVSGLHAEMAKHALLAGKHVIVEKPMTLSLRDADELIELAEQNGLKLMVCHQMRHRPIMKKLKETIEEGKLGKIYLGTVSLRLNRSPAYYEAASWRGSWEKDGGMLVNQGIHLIDLLQWFLGDVKGVYGDMLGGSGAKETEDVAVGILTFASQAKGVVEANIVTQPNNIGSSLSIFGENGTISLEGPALNRISRWYIHGEKADAEEAAKLIDIGGEQTAMYQNFISALKRQDTLLVDGYEGKKAIETIFGIYQSVLQKQPVQLPLSSFQTTDMKNK
>NZ_CP014794.1|WP_080626750.1|226623_227919_+|nucleotide-sugar-dehydrogenase
MSKQEIHNETIAVIGLGFVGLPLAMLLISKGMRVIGVDLDKKKVEALRKGTSYISDINDQAVQDGIGTGFFRPVSDYSLIGEADAVIICVPTPLNDDAGPDLNYVKRAAQLIGAHLKKGQLVVLASSTYPGTTRDIVKPILEKSGLVCGKDFYLAYSPERVDPGNQFPIEVVPKVVGGATDACLEKVHQLYSGIYEEVVPVTSPETAELTKLLENTYRFINISFINEFAMICDRLGVNVWEVIEAASTKPYGFAAFYPGPGIGGHCIPVDPLYLQFVMKQSGLSSDFIELSEATNDRIVRYIAERSLQLAGKDKATDARILIYGVTYKRNIADVRESKSLDIIEKLIGMGADVSYHDPHVPDLDLSGKKLASVPIDSKMLKEYDCVVILTDHDALPKELLLNHANVIFDTRGVLREAAGKAKVIQLGNGRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP014794_1	1.3\|212101\|25\|NZ_CP014794\|CRT	212101-212125	25	NZ_CP014794.1	211714-211738	0	1.0
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP014794.1	211795-211819	0	1.0
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP014794.1	211552-211576	0	1.0
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP014794.1	211633-211657	0	1.0
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP014794.1	211849-211873	0	1.0
NZ_CP014794_1	1.7\|212290\|34\|NZ_CP014794\|CRT	212290-212323	34	NZ_CP014794.1	211894-211927	0	1.0
NZ_CP014794_1	1.8\|212344\|43\|NZ_CP014794\|CRT	212344-212386	43	NZ_CP014794.1	211948-211990	0	1.0
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	NZ_CP014794.1	211417-211441	0	1.0
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP014794.1	211462-211486	1	0.96
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	NZ_CP014794.1	211750-211774	1	0.96
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP014794.1	210109-210133	2	0.92
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP014794.1	211867-211891	2	0.92
NZ_CP014794_1	1.10\|212488\|34\|NZ_CP014794\|CRT	212488-212521	34	NZ_CP014794.1	211759-211792	2	0.941
NZ_CP014794_1	1.11\|212542\|34\|NZ_CP014794\|CRT	212542-212575	34	NZ_CP014794.1	211759-211792	2	0.941
NZ_CP014794_1	1.12\|212596\|34\|NZ_CP014794\|CRT	212596-212629	34	NZ_CP014794.1	211759-211792	2	0.941
NZ_CP014794_1	1.13\|212650\|34\|NZ_CP014794\|CRT	212650-212683	34	NZ_CP014794.1	211759-211792	2	0.941
NZ_CP014794_1	1.14\|212704\|34\|NZ_CP014794\|CRT	212704-212737	34	NZ_CP014794.1	211759-211792	2	0.941
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP014794.1	210037-210061	2	0.92
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP014794.1	211471-211495	2	0.92
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP014794.1	210037-210061	2	0.92
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP014794.1	211471-211495	2	0.92
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	NZ_CP014794.1	210109-210133	2	0.92
NZ_CP014794_1	1.44\|214684\|25\|NZ_CP014794\|CRT	214684-214708	25	NZ_CP014794.1	210109-210133	2	0.92

1. spacer 1.3|212101|25|NZ_CP014794|CRT matches to position: 211714-211738, mismatch: 0, identity: 1.0

agccacaggcgcaacaggctcaacc	CRISPR spacer
agccacaggcgcaacaggctcaacc	Protospacer
*************************

2. spacer 1.5|212200|25|NZ_CP014794|CRT matches to position: 211795-211819, mismatch: 0, identity: 1.0

cccaacgggtccaacaggagtaacc	CRISPR spacer
cccaacgggtccaacaggagtaacc	Protospacer
*************************

3. spacer 1.6|212245|25|NZ_CP014794|CRT matches to position: 211552-211576, mismatch: 0, identity: 1.0

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagcaacgggtccaaca	Protospacer
*************************

4. spacer 1.6|212245|25|NZ_CP014794|CRT matches to position: 211633-211657, mismatch: 0, identity: 1.0

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagcaacgggtccaaca	Protospacer
*************************

5. spacer 1.6|212245|25|NZ_CP014794|CRT matches to position: 211849-211873, mismatch: 0, identity: 1.0

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagcaacgggtccaaca	Protospacer
*************************

6. spacer 1.7|212290|34|NZ_CP014794|CRT matches to position: 211894-211927, mismatch: 0, identity: 1.0

tccaactggagcgacaggcgcaacaggtccgcca	CRISPR spacer
tccaactggagcgacaggcgcaacaggtccgcca	Protospacer
**********************************

7. spacer 1.8|212344|43|NZ_CP014794|CRT matches to position: 211948-211990, mismatch: 0, identity: 1.0

agcaaccggagccacaggctcaaccggtccaaaaggagtaaca	CRISPR spacer
agcaaccggagccacaggctcaaccggtccaaaaggagtaaca	Protospacer
*******************************************

8. spacer 1.21|213109|25|NZ_CP014794|CRT matches to position: 211417-211441, mismatch: 0, identity: 1.0

agtaaccggggcaaccggagcaacg	CRISPR spacer
agtaaccggggcaaccggagcaacg	Protospacer
*************************

9. spacer 1.5|212200|25|NZ_CP014794|CRT matches to position: 211462-211486, mismatch: 1, identity: 0.96

cccaacgggtccaacaggagtaacc	CRISPR spacer
cccaacgggtccaacaggagcaacc	Protospacer
********************.****

10. spacer 1.21|213109|25|NZ_CP014794|CRT matches to position: 211750-211774, mismatch: 1, identity: 0.96

agtaaccggggcaaccggagcaacg	CRISPR spacer
agtaaccggggcaaccggagcgacg	Protospacer
*********************.***

11. spacer 1.1|212002|25|NZ_CP014794|CRT matches to position: 210109-210133, mismatch: 2, identity: 0.92

tccgacaggagcaacaggcccaacg	CRISPR spacer
tccgacgggagcaacaggcgcaacg	Protospacer
******.************ *****

12. spacer 1.1|212002|25|NZ_CP014794|CRT matches to position: 211867-211891, mismatch: 2, identity: 0.92

tccgacaggagcaacaggcccaacg	CRISPR spacer
tccaacaggggcaacaggcccaacg	Protospacer
***.*****.***************

13. spacer 1.10|212488|34|NZ_CP014794|CRT matches to position: 211759-211792, mismatch: 2, identity: 0.941

ggcaacaggagcgacgggtccaacaggggcaaca	CRISPR spacer
ggcaaccggagcgacgggtccaacaggggcgaca	Protospacer
****** ***********************.***

14. spacer 1.11|212542|34|NZ_CP014794|CRT matches to position: 211759-211792, mismatch: 2, identity: 0.941

ggcaacaggagcgacgggtccaacaggggcaaca	CRISPR spacer
ggcaaccggagcgacgggtccaacaggggcgaca	Protospacer
****** ***********************.***

15. spacer 1.12|212596|34|NZ_CP014794|CRT matches to position: 211759-211792, mismatch: 2, identity: 0.941

ggcaacaggagcgacgggtccaacaggggcaaca	CRISPR spacer
ggcaaccggagcgacgggtccaacaggggcgaca	Protospacer
****** ***********************.***

16. spacer 1.13|212650|34|NZ_CP014794|CRT matches to position: 211759-211792, mismatch: 2, identity: 0.941

ggcaacaggagcgacgggtccaacaggggcaaca	CRISPR spacer
ggcaaccggagcgacgggtccaacaggggcgaca	Protospacer
****** ***********************.***

17. spacer 1.14|212704|34|NZ_CP014794|CRT matches to position: 211759-211792, mismatch: 2, identity: 0.941

ggcaacaggagcgacgggtccaacaggggcaaca	CRISPR spacer
ggcaaccggagcgacgggtccaacaggggcgaca	Protospacer
****** ***********************.***

18. spacer 1.28|213541|25|NZ_CP014794|CRT matches to position: 210037-210061, mismatch: 2, identity: 0.92

tccgacgggagcaaccggcccgaca	CRISPR spacer
tccgacgggagcaacaggtccgaca	Protospacer
*************** **.******

19. spacer 1.28|213541|25|NZ_CP014794|CRT matches to position: 211471-211495, mismatch: 2, identity: 0.92

tccgacgggagcaaccggcccgaca	CRISPR spacer
tccaacaggagcaaccggcccgaca	Protospacer
***.**.******************

20. spacer 1.29|213586|25|NZ_CP014794|CRT matches to position: 210037-210061, mismatch: 2, identity: 0.92

tccgacgggagcaaccggcccgaca	CRISPR spacer
tccgacgggagcaacaggtccgaca	Protospacer
*************** **.******

21. spacer 1.29|213586|25|NZ_CP014794|CRT matches to position: 211471-211495, mismatch: 2, identity: 0.92

tccgacgggagcaaccggcccgaca	CRISPR spacer
tccaacaggagcaaccggcccgaca	Protospacer
***.**.******************

22. spacer 1.30|213631|25|NZ_CP014794|CRT matches to position: 210109-210133, mismatch: 2, identity: 0.92

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccgacgggagcaacaggcgcaacg	Protospacer
******************. *****

23. spacer 1.44|214684|25|NZ_CP014794|CRT matches to position: 210109-210133, mismatch: 2, identity: 0.92

tccaacgggagcgacaggcgcaacg	CRISPR spacer
tccgacgggagcaacaggcgcaacg	Protospacer
***.********.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35466-35490	0	1.0
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251982-252006	0	1.0
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252000-252024	0	1.0
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35411-35435	1	0.96
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35484-35508	1	0.96
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251910-251934	1	0.96
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35502-35526	2	0.92
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35520-35544	2	0.92
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35430-35454	2	0.92
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	MK448909	Streptococcus phage Javan330, complete genome	28552-28576	2	0.92
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251919-251943	2	0.92
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251892-251916	2	0.92
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251964-251988	2	0.92
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	133966-133990	2	0.92
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71200-71224	2	0.92
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73639-73663	2	0.92
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125462-125486	2	0.92
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68905-68929	3	0.88
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	233512-233536	3	0.88
NZ_CP014794_1	1.3\|212101\|25\|NZ_CP014794\|CRT	212101-212125	25	CP054934	Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence	29701-29725	3	0.88
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35448-35472	3	0.88
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	6680-6704	3	0.88
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355616-355640	3	0.88
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	355643-355667	3	0.88
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	235965-235989	3	0.88
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72741-72765	3	0.88
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178914-178938	3	0.88
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270815-270839	3	0.88
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251901-251925	3	0.88
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251973-251997	3	0.88
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251991-252015	3	0.88
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73747-73771	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251952	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252018-252042	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131079-131103	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131088-131112	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP005961	Pseudomonas mandelii JR-1 plasmid unnamed, complete sequence	287999-288023	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	136-160	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	235-259	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	361-385	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-430	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321743-321767	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321788-321812	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321887-321911	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68779-68803	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68788-68812	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68797-68821	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68806-68830	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68815-68839	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68824-68848	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68833-68857	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68842-68866	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68851-68875	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68860-68884	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68869-68893	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68914-68938	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68932-68956	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73972-73996	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90219-90243	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90228-90252	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90237-90261	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90246-90270	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90255-90279	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90264-90288	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	90273-90297	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130581-130605	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130590-130614	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130599-130623	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130662-130686	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130671-130695	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130680-130704	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130689-130713	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130698-130722	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130707-130731	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130716-130740	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130725-130749	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130743-130767	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	MN693798	Marine virus AFVG_250M119, complete genome	11466-11490	3	0.88
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	MN694423	Marine virus AFVG_250M1001, complete genome	26202-26226	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125282-125306	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125339-125363	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125396-125420	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125528-125552	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125585-125609	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125642-125666	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125699-125723	3	0.88
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125756-125780	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73558-73582	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68923-68947	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71164-71188	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73918-73942	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130572-130596	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130752-130776	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251892-251916	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	451-475	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	MN694114	Marine virus AFVG_250M252, complete genome	19694-19718	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	MN694114	Marine virus AFVG_250M252, complete genome	19712-19736	3	0.88
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321698-321722	3	0.88
NZ_CP014794_1	1.44\|214684\|25\|NZ_CP014794\|CRT	214684-214708	25	MN693956	Marine virus AFVG_250M695, complete genome	17863-17887	3	0.88
NZ_CP014794_1	1.44\|214684\|25\|NZ_CP014794\|CRT	214684-214708	25	MK686071	Streptomyces phage Mischief19, complete genome	33448-33472	3	0.88
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328211-328235	3	0.88
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4771-4795	3	0.88
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53655-53679	3	0.88
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42513-42537	3	0.88
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137914-137938	3	0.88
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179499-179523	3	0.88
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68878-68902	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68941-68965	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173145-173169	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173235-173259	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173343-173367	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	297-321	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	131487-131511	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35411-35435	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35484-35508	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	472760-472784	4	0.84
NZ_CP014794_1	1.3\|212101\|25\|NZ_CP014794\|CRT	212101-212125	25	MN693590	Marine virus AFVG_25M199, complete genome	14314-14338	4	0.84
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178905-178929	4	0.84
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270806-270830	4	0.84
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NC_006869	Bacillus mycoides pSin9.7 plasmid	8648-8672	4	0.84
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116664-116688	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163674-163698	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163755-163779	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	132462-132486	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576811-576835	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576892-576916	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	136-160	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	235-259	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-430	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	442-466	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213686-213710	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213767-213791	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194882-194906	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194963-194987	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183467-183491	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183548-183572	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173145-173169	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321707-321731	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321743-321767	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321887-321911	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP011156	Bacillus cereus strain HN001 plasmid pRML01, complete sequence	127071-127095	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68914-68938	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73972-73996	4	0.84
NZ_CP014794_1	1.6\|212245\|25\|NZ_CP014794\|CRT	212245-212269	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130743-130767	4	0.84
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71527-71551	4	0.84
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73657-73681	4	0.84
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73738-73762	4	0.84
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251910-251934	4	0.84
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251982-252006	4	0.84
NZ_CP014794_1	1.19\|213001\|25\|NZ_CP014794\|CRT	213001-213025	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252000-252024	4	0.84
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251952	4	0.84
NZ_CP014794_1	1.21\|213109\|25\|NZ_CP014794\|CRT	213109-213133	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	252018-252042	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	127-151	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	226-250	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321896-321920	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68878-68902	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	68941-68965	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	72741-72765	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130734-130758	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	130761-130785	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	CP006583	Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence	59623-59647	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	MN694114	Marine virus AFVG_250M252, complete genome	19694-19718	4	0.84
NZ_CP014794_1	1.22\|213154\|25\|NZ_CP014794\|CRT	213154-213178	25	MN694114	Marine virus AFVG_250M252, complete genome	19712-19736	4	0.84
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251883-251916	4	0.882
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	805713-805737	4	0.84
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173235-173259	4	0.84
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	407482-407506	4	0.84
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	64739-64763	4	0.84
NZ_CP014794_1	1.28\|213541\|25\|NZ_CP014794\|CRT	213541-213565	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73711-73735	4	0.84
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	805713-805737	4	0.84
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173235-173259	4	0.84
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	407482-407506	4	0.84
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	64739-64763	4	0.84
NZ_CP014794_1	1.29\|213586\|25\|NZ_CP014794\|CRT	213586-213610	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73711-73735	4	0.84
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321932-321956	4	0.84
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	91-115	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71290-71314	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73675-73699	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73738-73762	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251928-251952	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	415-439	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32393-32417	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	MG209611	Aphanizomenon phage vB_AphaS-CL131, complete genome	32384-32408	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321734-321758	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	KY421186	Flavobacterium phage FL-1, complete genome	26689-26713	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	KY421186	Flavobacterium phage FL-1, complete genome	26878-26902	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NC_014025	Bacillus megaterium QM B1551 plasmid pBM500, complete sequence	51398-51422	4	0.84
NZ_CP014794_1	1.31\|213676\|25\|NZ_CP014794\|CRT	213676-213700	25	NZ_CP011518	Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence	243047-243071	4	0.84
NZ_CP014794_1	1.44\|214684\|25\|NZ_CP014794\|CRT	214684-214708	25	MN694114	Marine virus AFVG_250M252, complete genome	19694-19718	4	0.84
NZ_CP014794_1	1.44\|214684\|25\|NZ_CP014794\|CRT	214684-214708	25	MN694114	Marine virus AFVG_250M252, complete genome	19712-19736	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327941-327965	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	327977-328001	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328103-328127	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328139-328163	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328175-328199	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328193-328217	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328283-328307	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328319-328343	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328355-328379	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4501-4525	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4537-4561	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4663-4687	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4699-4723	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4735-4759	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4753-4777	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4843-4867	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4879-4903	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4915-4939	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125273-125297	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53529-53553	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53565-53589	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53601-53625	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53637-53661	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53709-53733	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42459-42483	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42531-42555	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42567-42591	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42603-42627	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42639-42663	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137860-137884	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137932-137956	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137968-137992	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138004-138028	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	138040-138064	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179445-179469	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179517-179541	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179553-179577	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179589-179613	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179625-179649	4	0.84
NZ_CP014794_1	1.48\|214927\|25\|NZ_CP014794\|CRT	214927-214951	25	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246958-246982	4	0.84
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	240539-240563	5	0.8
NZ_CP014794_1	1.1\|212002\|25\|NZ_CP014794\|CRT	212002-212026	25	MN176219	Bacillus phage 000TH010, complete genome	7953-7977	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	194954-194978	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	163683-163707	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	576820-576844	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	22123-22147	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	213695-213719	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	183476-183500	5	0.8
NZ_CP014794_1	1.5\|212200\|25\|NZ_CP014794\|CRT	212200-212224	25	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	22692-22716	5	0.8
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	251955-251988	5	0.853
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	NZ_CP053936	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence	11649-11673	5	0.8
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	NZ_CP053933	Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence	41507-41531	5	0.8
NZ_CP014794_1	1.30\|213631\|25\|NZ_CP014794\|CRT	213631-213655	25	NZ_CP009718	Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence	15499-15523	5	0.8
NZ_CP014794_1	1.2\|212047\|34\|NZ_CP014794\|CRT	212047-212080	34	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	220866-220899	6	0.824
NZ_CP014794_1	1.4\|212146\|34\|NZ_CP014794\|CRT	212146-212179	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051340-3051373	6	0.824
NZ_CP014794_1	1.4\|212146\|34\|NZ_CP014794\|CRT	212146-212179	34	NC_021304	Streptomyces phage Sujidade, complete genome	17734-17767	6	0.824
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125462-125495	6	0.824
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125273-125306	6	0.824
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116700-116733	6	0.824
NZ_CP014794_1	1.4\|212146\|34\|NZ_CP014794\|CRT	212146-212179	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3051376-3051409	7	0.794
NZ_CP014794_1	1.4\|212146\|34\|NZ_CP014794\|CRT	212146-212179	34	NC_048029	Sphingomonas phage Scott isolate SPS, complete genome	4960-4993	7	0.794
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35393-35426	7	0.794
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73720-73753	7	0.794
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178950-178983	7	0.794
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270851-270884	7	0.794
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	NZ_CP009967	Bacillus cereus E33L plasmid pBCO_1, complete sequence	321734-321767	7	0.794
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	NC_007103	Bacillus cereus E33L plasmid pE33L466, complete sequence	406-439	7	0.794
NZ_CP014794_1	1.42\|214549\|34\|NZ_CP014794\|CRT	214549-214582	34	NC_008464	Stx2-converting phage 86, complete genome	18066-18099	7	0.794
NZ_CP014794_1	1.42\|214549\|34\|NZ_CP014794\|CRT	214549-214582	34	KJ603229	Shigella phage POCJ13, complete genome	38796-38829	7	0.794
NZ_CP014794_1	1.42\|214549\|34\|NZ_CP014794\|CRT	214549-214582	34	AB255436	Stx2-converting phage 86 DNA, complete genome	18066-18099	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125330-125363	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125387-125420	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125519-125552	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125576-125609	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125633-125666	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125690-125723	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	CP037991	Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence	125747-125780	7	0.794
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	MT219824	Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence	246949-246982	7	0.794
NZ_CP014794_1	1.4\|212146\|34\|NZ_CP014794\|CRT	212146-212179	34	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173235-173268	8	0.765
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	6671-6704	8	0.765
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NC_010180	Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence	116700-116733	8	0.765
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	244738-244771	8	0.765
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NC_042038	Enterobacteriophage phiKP26, complete genome	9631-9664	8	0.765
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	KT825490	Escherichia phage C119, complete genome	1779-1812	8	0.765
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	71281-71314	8	0.765
NZ_CP014794_1	1.26\|213406\|34\|NZ_CP014794\|CRT	213406-213439	34	NZ_CP040822	Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence	35045-35078	8	0.765
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	328211-328244	8	0.765
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	4771-4804	8	0.765
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP053966	Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence	53655-53688	8	0.765
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP009638	Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence	42504-42537	8	0.765
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	137905-137938	8	0.765
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	179490-179523	8	0.765
NZ_CP014794_1	1.4\|212146\|34\|NZ_CP014794\|CRT	212146-212179	34	NZ_CP053689	Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence	173343-173376	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	154338-154371	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP039699	Novosphingobium sp. ABRDHK2 plasmid pABRDHK234, complete sequence	13522-13555	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP039699	Novosphingobium sp. ABRDHK2 plasmid pABRDHK234, complete sequence	205393-205426	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP011450	Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence	176475-176508	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP018821	Sphingomonas koreensis strain ABOJV plasmid tig00000001, complete sequence	237835-237868	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	710948-710981	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	175544-175577	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NC_020542	Sphingomonas sp. MM-1 plasmid pISP0, complete sequence	88118-88151	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP023451	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p2, complete sequence	82296-82329	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	53946-53979	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	171478-171511	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	38212-38245	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	CP021182	Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence	33588-33621	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	219010-219043	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP018225	Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence	78954-78987	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP053224	Sphingobium sp. RSMS plasmid pRSMS1, complete sequence	48080-48113	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NZ_CP041018	Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence	154738-154771	9	0.735
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	NC_019718	Enterobacteria phage vB_EcoS_Rogue1, complete genome	10097-10130	9	0.735
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	662140-662173	9	0.735
NZ_CP014794_1	1.26\|213406\|34\|NZ_CP014794\|CRT	213406-213439	34	MT360680	Klebsiella virus 2019KP1, complete genome	4983-5016	9	0.735
NZ_CP014794_1	1.42\|214549\|34\|NZ_CP014794\|CRT	214549-214582	34	NZ_CP011146	Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence	35393-35426	9	0.735
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	MN693956	Marine virus AFVG_250M695, complete genome	17854-17887	9	0.735
NZ_CP014794_1	1.49\|214972\|34\|NZ_CP014794\|CRT	214972-215005	34	NZ_LT960615	Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence	66730-66763	9	0.735
NZ_CP014794_1	1.7\|212290\|34\|NZ_CP014794\|CRT	212290-212323	34	MK962638	Achromobacter phage vB_AxyP_19-32_Axy21, complete genome	14710-14743	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN694373	Marine virus AFVG_250M164, complete genome	35074-35107	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN694490	Marine virus AFVG_250M148, complete genome	35803-35836	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN693851	Marine virus AFVG_250M123, complete genome	35633-35666	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN693612	Marine virus AFVG_250M85, complete genome	36089-36122	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN694704	Marine virus AFVG_250M367, complete genome	6539-6572	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN693690	Marine virus AFVG_250M149, complete genome	5612-5645	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN693942	Marine virus AFVG_250M366, complete genome	6536-6569	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN693949	Marine virus AFVG_250M365, complete genome	6534-6567	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN694726	Marine virus AFVG_250M757, complete genome	6746-6779	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN694308	Marine virus AFVG_250M150, complete genome	5612-5645	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN694648	Marine virus AFVG_250M756, complete genome	6687-6720	10	0.706
NZ_CP014794_1	1.18\|212947\|34\|NZ_CP014794\|CRT	212947-212980	34	MN693926	Marine virus AFVG_250M186, complete genome	7027-7060	10	0.706
NZ_CP014794_1	1.23\|213199\|34\|NZ_CP014794\|CRT	213199-213232	34	NC_031254	Arthrobacter phage Kitkat, complete genome	29974-30007	10	0.706
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49881-49914	10	0.706
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	49989-50022	10	0.706
NZ_CP014794_1	1.45\|214729\|34\|NZ_CP014794\|CRT	214729-214762	34	NZ_CP020744	Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence	50025-50058	10	0.706
NZ_CP014794_1	1.46\|214783\|43\|NZ_CP014794\|CRT	214783-214825	43	NZ_CP009336	Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence	73909-73951	10	0.767
NZ_CP014794_1	1.49\|214972\|34\|NZ_CP014794\|CRT	214972-215005	34	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	116748-116781	10	0.706
NZ_CP014794_1	1.49\|214972\|34\|NZ_CP014794\|CRT	214972-215005	34	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	110710-110743	10	0.706

1. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 0, identity: 1.0

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagcaacgggtccaaca	Protospacer
*************************

2. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaacaggagcaaccggggcaaca	Protospacer
*************************

3. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaacaggagcaaccggggcaaca	Protospacer
*************************

4. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 1, identity: 0.96

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagcaacgggcccaaca	Protospacer
******************.******

5. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 1, identity: 0.96

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagcaacgggcccaaca	Protospacer
******************.******

6. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.96

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaacaggagcaaccggggcaacc	Protospacer
************************

7. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 2, identity: 0.92

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggaacaacgggcccaaca	Protospacer
**********.*******.******

8. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 2, identity: 0.92

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggagtaacgggcccaaca	Protospacer
***********.******.******

9. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 2, identity: 0.92

cccaacaggagcaac-gggtccaaca	CRISPR spacer
cccaacaggagcaacggggcccaac-	Protospacer
*************** ***.*****

10. spacer 1.6|212245|25|NZ_CP014794|CRT matches to MK448909 (Streptococcus phage Javan330, complete genome) position: , mismatch: 2, identity: 0.92

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggggcaacgggtccagca	Protospacer
*********.************.**

11. spacer 1.21|213109|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

agtaaccggggcaaccggagcaacg	CRISPR spacer
agcaaccggggcaaccggagcaacc	Protospacer
**.*********************

12. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacgggagcaaccggggcaaca	Protospacer
.*****.******************

13. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.92

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaaccggagcaaccggggcaaca	Protospacer
.***** ******************

14. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 2, identity: 0.92

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaacaggaccaacgggggcaaca	Protospacer
********** **** *********

15. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

cgcaacgggagcaaccggagcgaca	CRISPR spacer
tgcaacgggagcaaccggagcgacc	Protospacer
.***********************

16. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 2, identity: 0.92

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcgaca	Protospacer
 ************** *********

17. spacer 1.48|214927|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tccaacaggtccaaccggagcgaca	CRISPR spacer
tccaccaggtccaacgggagcgaca	Protospacer
**** ********** *********

18. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacaggagcaacaggcccaacg	CRISPR spacer
gccgacaggagcaacaggagcaacg	Protospacer
 *****************  *****

19. spacer 1.1|212002|25|NZ_CP014794|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacaggagcaacaggcccaacg	CRISPR spacer
gccaacaggaggaacaggcccaacg	Protospacer
 **.******* *************

20. spacer 1.3|212101|25|NZ_CP014794|CRT matches to CP054934 (Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

agccacaggcgcaacaggctcaacc	CRISPR spacer
gtccacaagcgcaacaggctcaacc	Protospacer
. *****.*****************

21. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 3, identity: 0.88

cccaacaggagcaacgggtccaaca	CRISPR spacer
tccaacaggaacaacgggcccaaca	Protospacer
.*********.*******.******

22. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 3, identity: 0.88

cccaacaggagcaacgggtccaaca	CRISPR spacer
cccaacaggaggaacaggtccaact	Protospacer
*********** ***.********

23. spacer 1.6|212245|25|NZ_CP014794|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggacctacgggtccaaca	Protospacer
 ********* * ************

24. spacer 1.6|212245|25|NZ_CP014794|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.88

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggacctacgggtccaaca	Protospacer
 ********* * ************

25. spacer 1.6|212245|25|NZ_CP014794|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 3, identity: 0.88

cccaacaggagcaacgggtccaaca	CRISPR spacer
cgcaacaggagcaacgggaccaata	Protospacer
* **************** ****.*

26. spacer 1.19|213001|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggagtaaccggggcaacg	CRISPR spacer
agcaacaggagtaaccggagcaacg	Protospacer
  ****************.******

27. spacer 1.19|213001|25|NZ_CP014794|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggagtaaccggggcaacg	CRISPR spacer
accaacaggagtaaccggtgccacg	Protospacer
 ***************** ** ***

28. spacer 1.19|213001|25|NZ_CP014794|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggagtaaccggggcaacg	CRISPR spacer
accaacaggagtaaccggtgccacg	Protospacer
 ***************** ** ***

29. spacer 1.21|213109|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

agtaaccggggcaaccggagcaacg	CRISPR spacer
agcaaccggggcaacaggagcaacc	Protospacer
**.************ ********

30. spacer 1.21|213109|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

agtaaccggggcaaccggagcaacg	CRISPR spacer
agcaaccggggcaacaggagcaacc	Protospacer
**.************ ********

31. spacer 1.21|213109|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

agtaaccggggcaaccggagcaacg	CRISPR spacer
agcaaccggggcaacaggagcaacc	Protospacer
**.************ ********

32. spacer 1.21|213109|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

agtaaccggggcaaccggagcaacg	CRISPR spacer
agtaaccggagcaacgggagcaaca	Protospacer
*********.***** ********.

33. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaaccggagcaaccggagcaact	Protospacer
****** ***********.*****

34. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaacaggggcaaccggagcaacc	Protospacer
*********.********.*****

35. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

36. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
tgcaacaggagcaacaggagcaaca	Protospacer
 ************** **.******

37. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP005961 (Pseudomonas mandelii JR-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcaacagaagcaacaggggcaact	Protospacer
********.****** ********

38. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

39. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

40. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

41. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

42. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

43. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

44. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

45. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

46. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

47. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

48. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

49. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

50. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

51. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

52. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

53. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

54. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

55. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

56. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

57. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

58. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

59. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

60. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

61. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

62. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

63. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

64. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

65. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

66. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

67. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

68. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

69. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

70. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

71. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

72. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

73. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

74. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

75. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

76. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

77. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
.************** **.******

78. spacer 1.22|213154|25|NZ_CP014794|CRT matches to MN693798 (Marine virus AFVG_250M119, complete genome) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaaca	Protospacer
.************** **.******

79. spacer 1.22|213154|25|NZ_CP014794|CRT matches to MN694423 (Marine virus AFVG_250M1001, complete genome) position: , mismatch: 3, identity: 0.88

ggcaacaggagcaaccggggcaaca	CRISPR spacer
ggcgacaggagcaactggggcaact	Protospacer
***.***********.********

80. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

81. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

82. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

83. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

84. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

85. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

86. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

87. spacer 1.30|213631|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tccgacgggagcaacaggtccaacg	CRISPR spacer
tccaacgggagcaacaggtccatca	Protospacer
***.****************** *.

88. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcgacc	Protospacer
 ************** ********

89. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacaggagcaaca	Protospacer
 ************** *****.***

90. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaatgggagcaaccggagcaaca	Protospacer
 ****.***************.***

91. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagaaacaggagcgaca	Protospacer
 ********** *** *********

92. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacaggagcaaca	Protospacer
 ************** *****.***

93. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacaggagcaaca	Protospacer
 ************** *****.***

94. spacer 1.31|213676|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaaccggggcaaca	Protospacer
 *****************.**.***

95. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcaaca	Protospacer
 ************** *****.***

96. spacer 1.31|213676|25|NZ_CP014794|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
cgcaacgggagcaaccggcgcaacg	Protospacer
****************** **.**.

97. spacer 1.31|213676|25|NZ_CP014794|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
cgcaacgggagcaaccggcgcaacg	Protospacer
****************** **.**.

98. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 3, identity: 0.88

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcaaca	Protospacer
 ************** *****.***

99. spacer 1.44|214684|25|NZ_CP014794|CRT matches to MN693956 (Marine virus AFVG_250M695, complete genome) position: , mismatch: 3, identity: 0.88

tccaacgggagcgacaggcgcaacg	CRISPR spacer
accaacaggagccacaggcgcaacg	Protospacer
 *****.***** ************

100. spacer 1.44|214684|25|NZ_CP014794|CRT matches to MK686071 (Streptomyces phage Mischief19, complete genome) position: , mismatch: 3, identity: 0.88

tccaacgggagcgacaggcgcaacg	CRISPR spacer
tgcaacgggaccggcaggcgcaacg	Protospacer
* ******** **.***********

101. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcgaca	Protospacer
  ********** ************

102. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcgaca	Protospacer
  ********** ************

103. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcgaca	Protospacer
  ********** ************

104. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcgaca	Protospacer
  ********** ************

105. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcgaca	Protospacer
  ********** ************

106. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcgaca	Protospacer
  ********** ************

107. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
agcaacaggagcaacagggccaacg	Protospacer
  *.************** ******

108. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
agcaacaggagcaacagggccaacg	Protospacer
  *.************** ******

109. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
agcaacaggagcaacaggcccaaca	Protospacer
  *.********************.

110. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
atcgacaggagcaaccggcccaaca	Protospacer
 .************* ********.

111. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
atcgacaggagcaaccggcccaacc	Protospacer
 .************* ********

112. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
cccaacaggaggaacaggcccaact	Protospacer
.**.******* ************

113. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
gccaacaggaggaacaggcccaacc	Protospacer
 **.******* ************

114. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
cccaacaggagcaacgggcccaaca	Protospacer
.**.***********.********.

115. spacer 1.1|212002|25|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
cccaacaggagcaacgggcccaaca	Protospacer
.**.***********.********.

116. spacer 1.1|212002|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacaggagcaacaggcccaacg	CRISPR spacer
cctgacaggagcaacaggcccgaca	Protospacer
.*.******************.**.

117. spacer 1.3|212101|25|NZ_CP014794|CRT matches to MN693590 (Marine virus AFVG_25M199, complete genome) position: , mismatch: 4, identity: 0.84

agccacaggcgcaacaggctcaacc	CRISPR spacer
cgcgacaggcgcaacaggcgcaaca	Protospacer
 ** *************** ****

118. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacgggtccaacaggagtaacc	CRISPR spacer
ggtaacgggaccaacaggagtaacc	Protospacer
  .****** ***************

119. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacgggtccaacaggagtaacc	CRISPR spacer
ggtaacgggaccaacaggagtaacc	Protospacer
  .****** ***************

120. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NC_006869 (Bacillus mycoides pSin9.7 plasmid) position: , mismatch: 4, identity: 0.84

cccaacgggtccaacaggagtaacc	CRISPR spacer
accaacaggtccaacaggagaaaca	Protospacer
 *****.************* ***

121. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacgggtccaacaggagtaacc	CRISPR spacer
tccaaccggtccaacgggagtaacg	Protospacer
.***** ********.********

122. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacc	Protospacer
 **********.****** *****

123. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacg	Protospacer
 **********.****** *****.

124. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
ggcaacaggagcaacaggtccaata	Protospacer
  *************.*******.*

125. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacc	Protospacer
 **********.****** *****

126. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacg	Protospacer
 **********.****** *****.

127. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

128. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

129. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

130. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
gccaacaggagcaacgggagcaacg	Protospacer
 *****************  ****.

131. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacc	Protospacer
 **********.****** *****

132. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacg	Protospacer
 **********.****** *****.

133. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacg	Protospacer
 **********.****** *****.

134. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacc	Protospacer
 **********.****** *****

135. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacc	Protospacer
 **********.****** *****

136. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
accaacaggagtaacgggaccaacg	Protospacer
 **********.****** *****.

137. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacaggcccaaca	Protospacer
  *************.**.******

138. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
gccaacaggagcaacgggagcaacg	Protospacer
 *****************  ****.

139. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

140. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

141. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP011156 (Bacillus cereus strain HN001 plasmid pRML01, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
tccaacaggagcaacaggtcctact	Protospacer
.**************.***** **

142. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

143. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

144. spacer 1.6|212245|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

cccaacaggagcaacgggtccaaca	CRISPR spacer
agcaacaggagcaacgggagcaaca	Protospacer
  ****************  *****

145. spacer 1.19|213001|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggagtaaccggggcaacg	CRISPR spacer
tgaaacaggagtaaccggagcaacc	Protospacer
*  ***************.*****

146. spacer 1.19|213001|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggagtaaccggggcaacg	CRISPR spacer
agcgacaggagtaaccggagcaacg	Protospacer
  *.**************.******

147. spacer 1.19|213001|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggagtaaccggggcaacg	CRISPR spacer
agcaacgggagtaaccggagcaacg	Protospacer
  ****.***********.******

148. spacer 1.19|213001|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggagtaaccggggcaacg	CRISPR spacer
ggcaacaggagcaaccggggcaacc	Protospacer
  *********.************

149. spacer 1.19|213001|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggagtaaccggggcaacg	CRISPR spacer
ggcaacaggagcaaccggggcaaca	Protospacer
  *********.************.

150. spacer 1.19|213001|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggagtaaccggggcaacg	CRISPR spacer
ggcaacaggagcaaccggggcaaca	Protospacer
  *********.************.

151. spacer 1.21|213109|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

agtaaccggggcaaccggagcaacg	CRISPR spacer
ggcaaccggagcaaccggagcaact	Protospacer
.*.******.**************

152. spacer 1.21|213109|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

agtaaccggggcaaccggagcaacg	CRISPR spacer
ggcaacaggggcaaccggagcaacc	Protospacer
.*.*** *****************

153. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaacg	Protospacer
.************** **.*****.

154. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaacg	Protospacer
.************** **.*****.

155. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaacg	Protospacer
.************** **.*****.

156. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacagggccaacg	Protospacer
.************** *** ****.

157. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacagggccaacg	Protospacer
.************** *** ****.

158. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagtaaccggagcaacg	Protospacer
.**********.******.*****.

159. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaacg	Protospacer
.************** **.*****.

160. spacer 1.22|213154|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacaggagcaacg	Protospacer
.************** **.*****.

161. spacer 1.22|213154|25|NZ_CP014794|CRT matches to CP006583 (Mesorhizobium huakuii 7653R plasmid pMHb, complete sequence) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
agcaacagcagcaagcggggcaacc	Protospacer
.******* ***** *********

162. spacer 1.22|213154|25|NZ_CP014794|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
cgcaacgggagcaaccggcgcaacg	Protospacer
 *****.*********** *****.

163. spacer 1.22|213154|25|NZ_CP014794|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

ggcaacaggagcaaccggggcaaca	CRISPR spacer
cgcaacgggagcaaccggcgcaacg	Protospacer
 *****.*********** *****.

164. spacer 1.23|213199|34|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
accaaccggagcaacgggagcaaccggggcaaca	Protospacer
. **** *****.*********************

165. spacer 1.28|213541|25|NZ_CP014794|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
accgacggcagcgaccggcccgacc	Protospacer
 ******* ***.***********

166. spacer 1.28|213541|25|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
atcgacaggagcaaccggcccaaca	Protospacer
 .****.**************.***

167. spacer 1.28|213541|25|NZ_CP014794|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
accgacggcagcgaccggcccgacc	Protospacer
 ******* ***.***********

168. spacer 1.28|213541|25|NZ_CP014794|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
accgacggcagcgaccggcccgacc	Protospacer
 ******* ***.***********

169. spacer 1.28|213541|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
cccaacgggagcaaccggcccaacg	Protospacer
.**.*****************.**.

170. spacer 1.29|213586|25|NZ_CP014794|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
accgacggcagcgaccggcccgacc	Protospacer
 ******* ***.***********

171. spacer 1.29|213586|25|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
atcgacaggagcaaccggcccaaca	Protospacer
 .****.**************.***

172. spacer 1.29|213586|25|NZ_CP014794|CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
accgacggcagcgaccggcccgacc	Protospacer
 ******* ***.***********

173. spacer 1.29|213586|25|NZ_CP014794|CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
accgacggcagcgaccggcccgacc	Protospacer
 ******* ***.***********

174. spacer 1.29|213586|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaaccggcccgaca	CRISPR spacer
cccaacgggagcaaccggcccaacg	Protospacer
.**.*****************.**.

175. spacer 1.30|213631|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaacaggtccaacg	CRISPR spacer
gccgacgggagcaacaggagcaaca	Protospacer
 *****************  ****.

176. spacer 1.30|213631|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

tccgacgggagcaacaggtccaacg	CRISPR spacer
gccgacgggagcaacaggagcaaca	Protospacer
 *****************  ****.

177. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agtaacgggagcaaccggagtgacc	Protospacer
 *.*****************.***

178. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcagccggagcaacg	Protospacer
 ************.*******.**.

179. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagtaaccggagcaacg	Protospacer
 **********.*********.**.

180. spacer 1.31|213676|25|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
ggcaaccggagcaaccggagcaact	Protospacer
 ***** **************.**

181. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacaggagtgacg	Protospacer
 ************** ****.***.

182. spacer 1.31|213676|25|NZ_CP014794|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcgatc	Protospacer
 ************** *******.

183. spacer 1.31|213676|25|NZ_CP014794|CRT matches to MG209611 (Aphanizomenon phage vB_AphaS-CL131, complete genome) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcaacg	Protospacer
 ************** *****.**.

184. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacaggagtgacg	Protospacer
 ************** ****.***.

185. spacer 1.31|213676|25|NZ_CP014794|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaaccggagcaatc	Protospacer
 ********************.*.

186. spacer 1.31|213676|25|NZ_CP014794|CRT matches to KY421186 (Flavobacterium phage FL-1, complete genome) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagcaacgggagcaacg	Protospacer
 ************** *****.**.

187. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NC_014025 (Bacillus megaterium QM B1551 plasmid pBM500, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
agcaacgggagctaccggagccact	Protospacer
 *********** ******** **

188. spacer 1.31|213676|25|NZ_CP014794|CRT matches to NZ_CP011518 (Pandoraea oxalativorans strain DSM 23570 plasmid pPO70-1, complete sequence) position: , mismatch: 4, identity: 0.84

cgcaacgggagcaaccggagcgaca	CRISPR spacer
cgcaacgggggcgaccggagcgatc	Protospacer
*********.**.**********.

189. spacer 1.44|214684|25|NZ_CP014794|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

tccaacgggagcgacaggcgcaacg	CRISPR spacer
cgcaacgggagcaaccggcgcaacg	Protospacer
. **********.** *********

190. spacer 1.44|214684|25|NZ_CP014794|CRT matches to MN694114 (Marine virus AFVG_250M252, complete genome) position: , mismatch: 4, identity: 0.84

tccaacgggagcgacaggcgcaacg	CRISPR spacer
cgcaacgggagcaaccggcgcaacg	Protospacer
. **********.** *********

191. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

192. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

193. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

194. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

195. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

196. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

197. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

198. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

199. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

200. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

201. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

202. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

203. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

204. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

205. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

206. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

207. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

208. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

209. spacer 1.48|214927|25|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
ctcaacaggtccaacgggagcaaca	Protospacer
..************* *****.***

210. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

211. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

212. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

213. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

214. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

215. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

216. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

217. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

218. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

219. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

220. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

221. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

222. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

223. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

224. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

225. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

226. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

227. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

228. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

229. spacer 1.48|214927|25|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
agcaacaggtcctaccggagcaaca	Protospacer
  ********** ********.***

230. spacer 1.48|214927|25|NZ_CP014794|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 4, identity: 0.84

tccaacaggtccaaccggagcgaca	CRISPR spacer
cgcaacaggtcctacaggagcgaca	Protospacer
. ********** ** *********

231. spacer 1.1|212002|25|NZ_CP014794|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.8

tccgacaggagcaacaggcccaacg	CRISPR spacer
agggacaggaccaacaggcccaaca	Protospacer
   ******* *************.

232. spacer 1.1|212002|25|NZ_CP014794|CRT matches to MN176219 (Bacillus phage 000TH010, complete genome) position: , mismatch: 5, identity: 0.8

tccgacaggagcaacaggcccaacg	CRISPR spacer
cgagacaggagcaacaggcccagca	Protospacer
.  *******************.*.

233. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
agtaacgggaccaacaggagtaacg	Protospacer
  .****** **************

234. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
agtaacgggaccaacaggagtaacg	Protospacer
  .****** **************

235. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
agtaacgggaccaacaggagtaacg	Protospacer
  .****** **************

236. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
tttcactggtccaacaggagtaacc	Protospacer
... ** ******************

237. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
agtaacgggaccaacaggagtaacg	Protospacer
  .****** **************

238. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
agtaacgggaccaacaggagtaacg	Protospacer
  .****** **************

239. spacer 1.5|212200|25|NZ_CP014794|CRT matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 5, identity: 0.8

cccaacgggtccaacaggagtaacc	CRISPR spacer
tttcactggtccaacaggagtaacc	Protospacer
... ** ******************

240. spacer 1.23|213199|34|NZ_CP014794|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.853

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
aggagcaggagcaaccggagcaaccggggcaaca	Protospacer
.* *.*******.** ******************

241. spacer 1.30|213631|25|NZ_CP014794|CRT matches to NZ_CP053936 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.8

tccgacgggagcaacaggtccaacg	CRISPR spacer
agaaacgggagcaacaggtccaacc	Protospacer
   .********************

242. spacer 1.30|213631|25|NZ_CP014794|CRT matches to NZ_CP053933 (Bacillus thuringiensis strain FDAARGOS_794 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.8

tccgacgggagcaacaggtccaacg	CRISPR spacer
agaaacgggagcaacaggtccaacc	Protospacer
   .********************

243. spacer 1.30|213631|25|NZ_CP014794|CRT matches to NZ_CP009718 (Bacillus thuringiensis strain HD682 plasmid pBGN_2, complete sequence) position: , mismatch: 5, identity: 0.8

tccgacgggagcaacaggtccaacg	CRISPR spacer
agaaacgggagcaacaggtccaacc	Protospacer
   .********************

244. spacer 1.2|212047|34|NZ_CP014794|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.824

-ggcaacgggagcgacaggcgcaacgggagcgacg	CRISPR spacer
cggccg-gagagcgacaggagcgacgggagcgacg	Protospacer
 *** . *.********** **.************

245. spacer 1.4|212146|34|NZ_CP014794|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.824

ggcaacgggagcgacaggcgcaaccggagcgacg	CRISPR spacer
tgggaccggagcgaccggcgcaaccggagcgacc	Protospacer
 * .** ******** *****************

246. spacer 1.4|212146|34|NZ_CP014794|CRT matches to NC_021304 (Streptomyces phage Sujidade, complete genome) position: , mismatch: 6, identity: 0.824

ggcaacgggagcgacaggcgcaaccggagcgacg	CRISPR spacer
cgacaccggagcgaccggcgcaaccggagcgacc	Protospacer
 *  ** ******** *****************

247. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcgacaggtccatca	Protospacer
.*** **********************. ** *.

248. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
ctcaacaggtccaacgggagcaacaggtccatca	Protospacer
*.*******************.*****. ** *.

249. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 6, identity: 0.824

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
cccaaccggtccaacgggagcaacaggtataaca	Protospacer
****** **************.*****...***.

250. spacer 1.4|212146|34|NZ_CP014794|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

ggcaacgggagcgacaggcgcaaccggagcgacg	CRISPR spacer
tagcaccggagcgaccggcgcaaccggagcgact	Protospacer
 .  ** ******** *****************

251. spacer 1.4|212146|34|NZ_CP014794|CRT matches to NC_048029 (Sphingomonas phage Scott isolate SPS, complete genome) position: , mismatch: 7, identity: 0.794

ggcaacgggagcgacaggcgcaaccggagcgacg	CRISPR spacer
ctcgaccggagcgacaggcgcagccggagcggca	Protospacer
  *.** ***************.********.*.

252. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 7, identity: 0.794

agcaaccggcccaacaggagcaacag------gtccgacg	CRISPR spacer
agcaacgggcccaacaggagcaacagaaggttgt------	Protospacer
****** *******************      **

253. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.794

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccggcccaacgggagcaacgggagtaacc	Protospacer
***************.********.**  ..**

254. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 7, identity: 0.794

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
atcaaccggaccaacaggagccacaggagtaacg	Protospacer
* ******* *********** *****  ..***

255. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 7, identity: 0.794

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
atcaaccggaccaacaggagccacaggagtaacg	Protospacer
* ******* *********** *****  ..***

256. spacer 1.23|213199|34|NZ_CP014794|CRT matches to NZ_CP009967 (Bacillus cereus E33L plasmid pBCO_1, complete sequence) position: , mismatch: 7, identity: 0.794

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaacaggagtgacg	Protospacer
.***********.*********** **.*..**.

257. spacer 1.23|213199|34|NZ_CP014794|CRT matches to NC_007103 (Bacillus cereus E33L plasmid pE33L466, complete sequence) position: , mismatch: 7, identity: 0.794

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
agcaacaggagcaacgggagcaacaggagtgacg	Protospacer
.***********.*********** **.*..**.

258. spacer 1.42|214549|34|NZ_CP014794|CRT matches to NC_008464 (Stx2-converting phage 86, complete genome) position: , mismatch: 7, identity: 0.794

agcaaccggcccgacaggagcaaccggcccgacg	CRISPR spacer
cccggcaggcccgacaggagcaaccggaccggcg	Protospacer
  *..* ******************** ***.**

259. spacer 1.42|214549|34|NZ_CP014794|CRT matches to KJ603229 (Shigella phage POCJ13, complete genome) position: , mismatch: 7, identity: 0.794

agcaaccggcccgacaggagcaaccggcccgacg	CRISPR spacer
cccggcaggcccgacaggagcaaccggaccggcg	Protospacer
  *..* ******************** ***.**

260. spacer 1.42|214549|34|NZ_CP014794|CRT matches to AB255436 (Stx2-converting phage 86 DNA, complete genome) position: , mismatch: 7, identity: 0.794

agcaaccggcccgacaggagcaaccggcccgacg	CRISPR spacer
cccggcaggcccgacaggagcaaccggaccggcg	Protospacer
  *..* ******************** ***.**

261. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

262. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

263. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

264. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

265. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

266. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

267. spacer 1.45|214729|34|NZ_CP014794|CRT matches to CP037991 (Bacillus mycoides strain TH26 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
tccaccaggtccaacgggagcaacaggtccatca	Protospacer
.*** ****************.*****. ** *.

268. spacer 1.45|214729|34|NZ_CP014794|CRT matches to MT219824 (Escherichia coli strain RT18-1 plasmid pRT18-1_294k_tetX, complete sequence) position: , mismatch: 7, identity: 0.794

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
cgcaacaggtcctacaggagcgacaggtcctaca	Protospacer
* ********** **.***********. * **.

269. spacer 1.4|212146|34|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggcaacgggagcgacaggcgcaaccggagcgacg	CRISPR spacer
agtaacgggatcgacaggagcaaccggcccaaca	Protospacer
.*.******* ******* ********  *.**.

270. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.765

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
tggacaaggcccaacaggaggaacaggtccaact	Protospacer
 * *   ************* *********.**

271. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NC_010180 (Bacillus mycoides KBAB4 plasmid pBWB401, complete sequence) position: , mismatch: 8, identity: 0.765

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
cccaaccggtccaacgggagcaacaggtataaca	Protospacer
  *******.*****.************ ..**.

272. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
atcaacaggcccaacaggaccaacaggattcact	Protospacer
* **** ************ ******* .. **

273. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NC_042038 (Enterobacteriophage phiKP26, complete genome) position: , mismatch: 8, identity: 0.765

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
tcctatgggcccaacaggtgcaacaggtccggct	Protospacer
  * *. *********** ************.*

274. spacer 1.18|212947|34|NZ_CP014794|CRT matches to KT825490 (Escherichia phage C119, complete genome) position: , mismatch: 8, identity: 0.765

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
tcctatgggcccaacaggtgcaacaggtccggct	Protospacer
  * *. *********** ************.*

275. spacer 1.23|213199|34|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.765

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
gttaacaggagtaacgggagcaaccggagtgacc	Protospacer
* .********..**************.*..**

276. spacer 1.26|213406|34|NZ_CP014794|CRT matches to NZ_CP040822 (Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence) position: , mismatch: 8, identity: 0.765

tccaacgggagcgacaggcgcaaccggtccaacg	CRISPR spacer
cgccacgggggcgacaggcgcagccggtgccgcg	Protospacer
. * *****.************.***** * .**

277. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agcaacaggtcctaccggagcgacaggtcctacc	Protospacer
  ********** ** ***********. * **

278. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 8, identity: 0.765

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agcaacaggtcctaccggagcgacaggtcctacc	Protospacer
  ********** ** ***********. * **

279. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP053966 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.765

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agcaacaggtcctaccggagcgacaggtcctacc	Protospacer
  ********** ** ***********. * **

280. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP009638 (Bacillus cereus 03BB108 plasmid pBFI_4, complete sequence) position: , mismatch: 8, identity: 0.765

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agcaacaggtcctaccggagcgacaggtcctacc	Protospacer
  ********** ** ***********. * **

281. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 8, identity: 0.765

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agcaacaggtcctaccggagcgacaggtcctacc	Protospacer
  ********** ** ***********. * **

282. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.765

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agcaacaggtcctaccggagcgacaggtcctacc	Protospacer
  ********** ** ***********. * **

283. spacer 1.4|212146|34|NZ_CP014794|CRT matches to NZ_CP053689 (Arthrobacter citreus strain NEB 577 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

ggcaacgggagcgacaggcgcaaccggagcgacg	CRISPR spacer
aataacgggatcgacaggagcaaccggcccaacc	Protospacer
...******* ******* ********  *.**

284. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

285. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP039699 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK234, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

286. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP039699 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK234, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

287. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP011450 (Sphingomonas sanxanigenens DSM 19645 = NX02 plasmid pNXO2, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

288. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP018821 (Sphingomonas koreensis strain ABOJV plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

289. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

290. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

291. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NC_020542 (Sphingomonas sp. MM-1 plasmid pISP0, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

292. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP023451 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

293. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

294. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

295. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

296. spacer 1.18|212947|34|NZ_CP014794|CRT matches to CP021182 (Sphingomonas wittichii DC-6 plasmid pDC01, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

297. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

298. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP018225 (Tardibacter chloracetimidivorans strain JJ-A5 plasmid pHSL4, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

299. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP053224 (Sphingobium sp. RSMS plasmid pRSMS1, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

300. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NZ_CP041018 (Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ggcaaccggcccagcaggatcaacagggcatgtc	Protospacer
.************.***** ******* *  ..

301. spacer 1.18|212947|34|NZ_CP014794|CRT matches to NC_019718 (Enterobacteria phage vB_EcoS_Rogue1, complete genome) position: , mismatch: 9, identity: 0.735

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
ttctatcggcccaacaggcgccacaggtccatcc	Protospacer
  * *.************ ** ********. *

302. spacer 1.23|213199|34|NZ_CP014794|CRT matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 9, identity: 0.735

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
gtggacgacggcgtcgggcgcaaccggggcaaca	Protospacer
*  .**.. .*** **** ***************

303. spacer 1.26|213406|34|NZ_CP014794|CRT matches to MT360680 (Klebsiella virus 2019KP1, complete genome) position: , mismatch: 9, identity: 0.735

tccaacgggagcgacaggcgcaaccggtccaacg	CRISPR spacer
agccacgggagccactggcgcaaccggtgctgcc	Protospacer
  * ******** ** ************ * .*

304. spacer 1.42|214549|34|NZ_CP014794|CRT matches to NZ_CP011146 (Bacillus cereus strain FORC_013 plasmid pFORC13, complete sequence) position: , mismatch: 9, identity: 0.735

agcaaccggcccgacaggagcaaccggcccgacg----	CRISPR spacer
agcaacgggcccaacaggagcaacag----aaggttgt	Protospacer
****** *****.*********** *    .* *

305. spacer 1.45|214729|34|NZ_CP014794|CRT matches to MN693956 (Marine virus AFVG_250M695, complete genome) position: , mismatch: 9, identity: 0.735

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
ccttggaataccaacaggagccacaggcgcaacg	Protospacer
**. . *.  *****.***** ************

306. spacer 1.49|214972|34|NZ_CP014794|CRT matches to NZ_LT960615 (Hartmannibacter diazotrophicus strain E19T plasmid HDIAp1, complete sequence) position: , mismatch: 9, identity: 0.735

tccaactggcccgacaggtccaaccggcccgaca	CRISPR spacer
tccaactggcccgacaagttcaacagatcgcccg	Protospacer
****************.**.**** *..*   *.

307. spacer 1.7|212290|34|NZ_CP014794|CRT matches to MK962638 (Achromobacter phage vB_AxyP_19-32_Axy21, complete genome) position: , mismatch: 10, identity: 0.706

tccaactggagcgacaggcgcaacaggtccgcca	CRISPR spacer
ggcaacaggagcgacaggcgcagcagcaaccgga	Protospacer
  **** ***************.***   *   *

308. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN694373 (Marine virus AFVG_250M164, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

309. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN694490 (Marine virus AFVG_250M148, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

310. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN693851 (Marine virus AFVG_250M123, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

311. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN693612 (Marine virus AFVG_250M85, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

312. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN694704 (Marine virus AFVG_250M367, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

313. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN693690 (Marine virus AFVG_250M149, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

314. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN693942 (Marine virus AFVG_250M366, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

315. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN693949 (Marine virus AFVG_250M365, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

316. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN694726 (Marine virus AFVG_250M757, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

317. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN694308 (Marine virus AFVG_250M150, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

318. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN694648 (Marine virus AFVG_250M756, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

319. spacer 1.18|212947|34|NZ_CP014794|CRT matches to MN693926 (Marine virus AFVG_250M186, complete genome) position: , mismatch: 10, identity: 0.706

agcaaccggcccaacaggagcaacaggtccgacg	CRISPR spacer
agcaaccagcccaagaggagcaaccgtctgaaga	Protospacer
*******.****** ********* * .. .* .

320. spacer 1.23|213199|34|NZ_CP014794|CRT matches to NC_031254 (Arthrobacter phage Kitkat, complete genome) position: , mismatch: 10, identity: 0.706

ggcaacaggagcgacgggagcaaccggggcaaca	CRISPR spacer
caaggacggagcgccgggagctaccggggcaacg	Protospacer
 . ..  ****** ******* ***********.

321. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agaaataggtccaacgggagcaacaggtctgaca	Protospacer
   **.***************.*****. ..**.

322. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agaaataggtccaacgggagcaacaggtctgaca	Protospacer
   **.***************.*****. ..**.

323. spacer 1.45|214729|34|NZ_CP014794|CRT matches to NZ_CP020744 (Bacillus mycoides strain Gnyt1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

cccaacaggtccaacgggagcgacaggcgcaacg	CRISPR spacer
agaaataggtccaacgggagcaacaggtctgaca	Protospacer
   **.***************.*****. ..**.

324. spacer 1.46|214783|43|NZ_CP014794|CRT matches to NZ_CP009336 (Bacillus thuringiensis strain HD1011 plasmid 1, complete sequence) position: , mismatch: 10, identity: 0.767

cccaaccggagcaacgggagcaaccggagcgacaggcccaacc	CRISPR spacer
agtaaccggagcaacgggagaaacaggagcgacaggagtagct	Protospacer
  .***************** *** ***********  .*.*.

325. spacer 1.49|214972|34|NZ_CP014794|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 10, identity: 0.706

tccaactggcccgacaggtccaaccggcccgaca	CRISPR spacer
aaacactggaccgacaggtccaacaggccaaagt	Protospacer
    ***** ************** **** .*

326. spacer 1.49|214972|34|NZ_CP014794|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 10, identity: 0.706

tccaactggcccgacaggtccaaccggcccgaca	CRISPR spacer
aaacactggaccgacaggtccaacaggccaaagt	Protospacer
    ***** ************** **** .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

837 : 15376

Bacillus_phage(81.25%)

plate,tail,holin,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009329208.1\|837_1287_+	collagen-like protein	D6R3Z0	Bacillus_phage	4.0e-15	53.3
WP_009329207.1\|1302_1653_+\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	1.3e-32	60.0
WP_069500677.1\|1582_1957_+\|head	phage head closure protein	Q9ZXF2	Bacillus_phage	2.4e-37	65.6
WP_069500676.1\|1949_2333_+	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	5.9e-44	69.3
WP_069500675.1\|2329_2710_+	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	1.8e-32	54.8
WP_009329203.1\|2709_3318_+\|tail	major tail protein	Q9ZXE9	Bacillus_phage	8.2e-56	54.6
WP_009329202.1\|3377_3713_+	hypothetical protein	Q9ZXE8	Bacillus_phage	5.0e-31	58.9
WP_025807965.1\|3910_7801_+\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	62.7
WP_009330398.1\|7800_8637_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	2.0e-113	71.8
WP_080626726.1\|8649_10359_+	alkaline phosphatase	D6R400	Bacillus_phage	1.9e-219	69.2
WP_069500673.1\|10395_11970_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-261	86.6
WP_069500672.1\|12006_13353_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.9e-86	86.3
WP_080626727.1\|13365_13689_+	bZIP transcription factor	M4ZR44	Bacillus_phage	7.8e-13	46.4
WP_080626728.1\|13685_13871_+	XkdX family protein	NA	NA	NA	NA
WP_069500916.1\|13933_14203_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	9.6e-25	61.8
WP_080626729.1\|14218_14482_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-32	77.0
WP_080626730.1\|14533_15376_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	3.7e-46	54.3

DBSCAN-SWA_2

88810 : 98734

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003179530.1\|88810_90106_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	27.1
WP_061576038.1\|90180_90897_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	2.4e-46	42.4
WP_003179532.1\|90898_91153_+	phosphoribosylformylglycinamidine synthase subunit PurS	M4QPE7	Synechococcus_phage	8.0e-05	33.3
WP_003179533.1\|91149_91833_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_009329142.1\|91816_94045_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.2e-158	41.5
WP_003179536.1\|94020_95451_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.5e-52	32.9
WP_011197613.1\|95574_96615_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.3
WP_080626734.1\|96611_97199_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.1e-28	41.1
WP_003179539.1\|97195_98734_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	4.3e-77	52.0

DBSCAN-SWA_3

328491 : 335429

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080626760.1\|328491_328815_+	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	1.4e-06	35.7
WP_080626761.1\|328989_329325_+	hypothetical protein	NA	NA	NA	NA
WP_080626762.1\|329321_329567_+	hypothetical protein	NA	NA	NA	NA
WP_155761925.1\|329566_329740_+	hypothetical protein	NA	NA	NA	NA
WP_080626763.1\|329740_330067_+	hypothetical protein	R4JGJ3	Bacillus_phage	9.9e-08	36.1
WP_080626765.1\|330418_330802_+	hypothetical protein	A0A2H4J134	uncultured_Caudovirales_phage	6.0e-20	40.7
WP_080626766.1\|331574_332369_+	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	4.8e-64	52.3
WP_080626767.1\|332338_332839_+	hypothetical protein	NA	NA	NA	NA
WP_026588499.1\|332838_333042_+	hypothetical protein	NA	NA	NA	NA
WP_080626768.1\|333038_334388_+	AAA family ATPase	A0A2H4IZL9	uncultured_Caudovirales_phage	1.7e-125	52.6
WP_080626769.1\|334409_335429_+	DNA primase	A0A2H4J6E6	uncultured_Caudovirales_phage	9.5e-73	45.9

DBSCAN-SWA_4

339158 : 430020

Bacillus_phage(43.75%)

transposase,protease,terminase,tRNA,holin,portal,head,capsid,integrase,tail

attL 391269:391284|attR 430440:430455

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017474282.1\|339158_339914_+	hypothetical protein	A0A0N9SJW5	Paenibacillus_phage	1.1e-52	49.8
WP_080626771.1\|339937_340369_+	hypothetical protein	A0A2H4IZM8	uncultured_Caudovirales_phage	8.8e-12	41.0
WP_080626772.1\|340409_341489_+	hypothetical protein	A0A2H4J459	uncultured_Caudovirales_phage	2.8e-14	36.5
WP_080626773.1\|341694_343992_+	DNA polymerase I	A0A2H4J6W7	uncultured_Caudovirales_phage	6.0e-123	37.5
WP_080626774.1\|343992_345042_+	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	2.2e-80	53.8
WP_048356262.1\|345041_345362_+	hypothetical protein	NA	NA	NA	NA
WP_080626775.1\|345343_345877_+	hypothetical protein	NA	NA	NA	NA
WP_080626776.1\|345882_346248_+	hypothetical protein	M4HNF9	Bacillus_phage	1.7e-11	38.1
WP_080626777.1\|346252_346510_+	hypothetical protein	NA	NA	NA	NA
WP_080626778.1\|346506_346701_+	hypothetical protein	NA	NA	NA	NA
WP_080626779.1\|346697_346898_+	hypothetical protein	NA	NA	NA	NA
WP_155761926.1\|346894_347044_+	hypothetical protein	NA	NA	NA	NA
WP_114555277.1\|347037_347400_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J6X7	uncultured_Caudovirales_phage	9.6e-28	55.0
WP_080626780.1\|347406_349506_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	R4JDX9	Bacillus_phage	0.0e+00	78.4
WP_006640508.1\|349537_349870_+	DUF1140 family protein	NA	NA	NA	NA
WP_075876064.1\|349908_350877_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	4.5e-149	80.3
WP_080626781.1\|350927_351509_+	deoxyuridine 5'-triphosphate nucleotidohydrolase	D2XR49	Bacillus_phage	2.0e-43	55.1
WP_048354323.1\|351508_351736_+	hypothetical protein	A0A1P8CX04	Bacillus_phage	6.0e-20	78.2
WP_155761927.1\|351736_351907_+	hypothetical protein	NA	NA	NA	NA
WP_080626782.1\|351911_352469_+	hypothetical protein	A0A142F1S8	Bacillus_phage	8.7e-28	61.4
WP_080626783.1\|352484_353549_+	hypothetical protein	A0A1P8CWY7	Bacillus_phage	2.4e-34	51.9
WP_016885220.1\|353545_354106_+	hypothetical protein	A0A0N9SJZ0	Paenibacillus_phage	6.7e-36	46.4
WP_080626784.1\|354094_354481_-	hypothetical protein	A0A0N9SHP7	Paenibacillus_phage	2.0e-07	37.0
WP_080626785.1\|354591_355866_+	N-6 DNA methylase	A0A0N9ST12	Paenibacillus_phage	1.9e-150	65.3
WP_080626786.1\|355865_356255_+	DUF134 domain-containing protein	A0A0N9RZI0	Paenibacillus_phage	2.5e-18	43.3
WP_080626787.1\|356247_356736_+	hypothetical protein	NA	NA	NA	NA
WP_080626788.1\|356824_357625_+	hypothetical protein	A0A0N9S810	Paenibacillus_phage	7.0e-71	54.6
WP_080626789.1\|357657_357969_-	hypothetical protein	NA	NA	NA	NA
WP_080626790.1\|357980_359408_-	lipase	NA	NA	NA	NA
WP_017474209.1\|359458_359803_+	DUF1433 domain-containing protein	NA	NA	NA	NA
WP_080626791.1\|359939_360158_+	helix-turn-helix transcriptional regulator	A0A1Z1DA26	Bacillus_phage	1.3e-08	43.1
WP_080626792.1\|361143_361422_+	hypothetical protein	NA	NA	NA	NA
WP_016885205.1\|361411_361786_+	hypothetical protein	NA	NA	NA	NA
WP_048407310.1\|361778_362327_+	hypothetical protein	NA	NA	NA	NA
WP_053075443.1\|362327_362717_+	HNH endonuclease	C7BGG5	Burkholderia_phage	9.4e-05	35.2
WP_080626793.1\|363033_363333_+	hypothetical protein	NA	NA	NA	NA
WP_080626794.1\|363743_364082_+	HNH endonuclease	A0A0K2CZH3	Paenibacillus_phage	1.3e-13	57.8
WP_011197905.1\|364201_364525_+\|terminase	P27 family phage terminase small subunit	A0A0K2CZN8	Paenibacillus_phage	6.8e-33	69.8
WP_080626795.1\|364499_366281_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	1.9e-246	67.1
WP_073411216.1\|366292_367591_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	4.3e-86	44.2
WP_069500356.1\|367544_368291_+\|protease	Clp protease ClpP	A0A0K2CYC6	Paenibacillus_phage	2.4e-57	49.6
WP_017474201.1\|368290_369445_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	4.9e-126	61.6
WP_026080791.1\|369485_369983_+	hypothetical protein	NA	NA	NA	NA
WP_017474199.1\|369985_370225_+\|head,tail	phage gp6-like head-tail connector protein	A0A0C5ABB4	Paenibacillus_phage	1.5e-08	40.5
WP_080626796.1\|370229_370565_+\|head	phage head closure protein	A0A2I7SC03	Paenibacillus_phage	1.1e-22	50.5
WP_080626797.1\|370561_370984_+	hypothetical protein	NA	NA	NA	NA
WP_011197913.1\|370980_371325_+	hypothetical protein	A0A0S2SY15	Bacillus_phage	1.0e-15	40.9
WP_011197914.1\|371333_371915_+\|tail	phage tail protein	NA	NA	NA	NA
WP_073411210.1\|371865_372180_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	2.1e-23	64.6
WP_011197916.1\|372230_372566_+	hypothetical protein	H0USX2	Bacillus_phage	1.2e-11	40.7
WP_080626798.1\|372808_378109_+\|tail	phage tail tape measure protein	A0A288WG88	Bacillus_phage	8.1e-99	42.6
WP_069500360.1\|378109_378931_+\|tail	phage tail family protein	A6M962	Geobacillus_virus	1.5e-65	48.5
WP_069500361.1\|378940_380467_+	hypothetical protein	A6M966	Geobacillus_virus	8.4e-49	36.3
WP_080627101.1\|381985_382558_+	hypothetical protein	A0A2I7S7J8	Vibrio_phage	1.3e-07	40.4
WP_080626799.1\|384030_384327_+	hypothetical protein	M4ZR44	Bacillus_phage	1.3e-17	50.0
WP_003181188.1\|384327_384522_+	XkdX family protein	NA	NA	NA	NA
WP_003181190.1\|384525_384789_+\|holin	holin	NA	NA	NA	NA
WP_080626800.1\|384855_385791_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	9.6e-96	65.9
WP_011197925.1\|385812_386070_+\|holin	holin	A0A0U4JE55	Bacillus_phage	2.3e-20	52.9
WP_016885193.1\|386513_386780_-	hypothetical protein	NA	NA	NA	NA
WP_016885192.1\|386800_388315_-	glycosyltransferase	NA	NA	NA	NA
WP_016885191.1\|388378_388594_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069500365.1\|388753_389572_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_069500366.1\|389644_389974_+	YolD-like family protein	O64030	Bacillus_phage	2.2e-07	34.6
391269:391284	attL	NA	NA	NA	NA
WP_003179971.1\|392778_392988_-	hypothetical protein	NA	NA	NA	NA
WP_003179974.1\|394190_394406_+	hypothetical protein	D6R3Y4	Bacillus_phage	7.9e-22	73.5
WP_011201594.1\|394399_394750_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4J4U2	uncultured_Caudovirales_phage	4.8e-08	57.1
WP_069500368.1\|394808_395147_-	hypothetical protein	NA	NA	NA	NA
WP_003179977.1\|395172_396897_-\|transposase	transposase	A0A1L2JY53	Aeribacillus_phage	8.4e-05	33.6
WP_100224395.1\|397171_397459_+	DUF3800 domain-containing protein	Q71TB8	Escherichia_phage	6.4e-19	47.8
WP_009329006.1\|397689_398130_-	hypothetical protein	NA	NA	NA	NA
WP_071583540.1\|403489_404815_+	TGS domain-containing protein	NA	NA	NA	NA
WP_003179982.1\|405061_405280_+	hypothetical protein	NA	NA	NA	NA
WP_003179983.1\|405667_406432_+	type I 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_017474999.1\|406837_408613_+	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_025807987.1\|408815_409583_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-30	37.6
WP_087634947.1\|409579_410593_+	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003179993.1\|410589_411426_+	ABC transporter permease	NA	NA	NA	NA
WP_003179995.1\|411439_412570_+	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_071583541.1\|412600_413059_-	hypothetical protein	NA	NA	NA	NA
WP_003179999.1\|413055_413262_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003180000.1\|413811_414024_+	hypothetical protein	NA	NA	NA	NA
WP_003180002.1\|414131_414878_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.2e-09	23.8
WP_080626803.1\|414843_416313_+	hypothetical protein	NA	NA	NA	NA
WP_026699457.1\|416302_417211_+	PqqD family protein	NA	NA	NA	NA
WP_011197680.1\|417207_417492_+	hypothetical protein	NA	NA	NA	NA
WP_003180010.1\|417599_417869_+	30S ribosomal protein S14	NA	NA	NA	NA
WP_009328997.1\|418193_418823_-	hypothetical protein	NA	NA	NA	NA
WP_071583959.1\|418903_420052_+\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_009328996.1\|420115_421021_+	amidase domain-containing protein	NA	NA	NA	NA
WP_085959525.1\|421055_421538_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_003180021.1\|421629_422244_+	YhbD family protein	NA	NA	NA	NA
WP_003180023.1\|422258_422969_+	hypothetical protein	NA	NA	NA	NA
WP_003180026.1\|422983_423685_+	hypothetical protein	NA	NA	NA	NA
WP_009328994.1\|424085_425981_+	serine/threonine protein kinase PrkA	A0MN77	Thermus_phage	3.3e-103	36.6
WP_080626804.1\|427062_428655_-	hypothetical protein	I3VYZ3	Thermoanaerobacterium_phage	2.6e-32	24.5
WP_150194401.1\|428825_429014_-	hypothetical protein	NA	NA	NA	NA
WP_080626805.1\|429135_430020_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3M2X0	Bacillus_phage	2.7e-55	40.1
430440:430455	attR	NA	NA	NA	NA

DBSCAN-SWA_5

446353 : 504397

Bacillus_phage(86.0%)

holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080626823.1\|446353_446593_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	1.7e-17	58.9
WP_080626824.1\|446614_446803_+	hypothetical protein	NA	NA	NA	NA
WP_080626825.1\|446906_447119_+	hypothetical protein	U5PTT2	Bacillus_phage	3.6e-11	60.0
WP_080626826.1\|447115_447436_+	hypothetical protein	NA	NA	NA	NA
WP_087634952.1\|447425_447785_+	hypothetical protein	NA	NA	NA	NA
WP_087634953.1\|447880_448555_+	poly-gamma-glutamate hydrolase family protein	O64134	Bacillus_phage	2.8e-41	49.3
WP_087634954.1\|448523_448730_+	hypothetical protein	O64134	Bacillus_phage	4.3e-09	57.4
WP_080626827.1\|448729_450484_+	right-handed parallel beta-helix repeat-containing protein	F8WPS8	Bacillus_phage	4.5e-123	43.4
WP_155761929.1\|450702_450855_+	hypothetical protein	NA	NA	NA	NA
WP_080626829.1\|450906_451134_+	hypothetical protein	NA	NA	NA	NA
WP_080626830.1\|451359_452106_+	DUF3603 family protein	A0A109ZRE1	Bacillus_phage	3.5e-32	34.9
WP_087634999.1\|452128_452521_+	dCMP deaminase family protein	F8WPT6	Bacillus_phage	2.8e-49	72.8
WP_080626832.1\|452414_452774_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	S5MA41	Brevibacillus_phage	9.3e-07	39.1
WP_071583448.1\|452897_453131_+	hypothetical protein	NA	NA	NA	NA
WP_080626833.1\|453133_453331_+	hypothetical protein	NA	NA	NA	NA
WP_071583450.1\|453516_453918_+	hypothetical protein	NA	NA	NA	NA
WP_080626834.1\|453914_454226_+	hypothetical protein	NA	NA	NA	NA
WP_080626835.1\|454325_455108_+	hypothetical protein	A0A0E3T6A0	Bacillus_phage	2.8e-32	35.3
WP_080626836.1\|455117_455606_+	hypothetical protein	NA	NA	NA	NA
WP_080626837.1\|455580_456282_+	hypothetical protein	A0A0E3X9H9	Bacillus_phage	1.5e-37	38.6
WP_080626838.1\|456295_456793_+	hypothetical protein	A0A1L2JY27	Aeribacillus_phage	1.3e-30	51.2
WP_080626839.1\|456891_457536_+	hypothetical protein	A0A1D6X8E5	Bacillus_phage	5.2e-08	39.3
WP_080626840.1\|457664_457943_+	hypothetical protein	U5PY47	Bacillus_phage	8.7e-13	50.0
WP_080626841.1\|457942_458500_+	hypothetical protein	NA	NA	NA	NA
WP_080626842.1\|458522_459296_+	hypothetical protein	U5Q178	Bacillus_phage	3.4e-70	50.2
WP_080626843.1\|459357_459660_-	hypothetical protein	NA	NA	NA	NA
WP_071583460.1\|460138_460816_+	hypothetical protein	A0A1D6X837	Bacillus_phage	1.5e-21	33.3
WP_080626844.1\|460815_462402_+	hypothetical protein	S5MLT2	Bacillus_phage	1.2e-93	36.7
WP_080626845.1\|462494_463853_+	hypothetical protein	A0A0E3JT25	Bacillus_phage	1.4e-148	58.9
WP_080626846.1\|463869_464919_+	hypothetical protein	A0A1D6X836	Bacillus_phage	1.2e-59	41.6
WP_071583464.1\|464939_465359_+	hypothetical protein	U5PXS9	Bacillus_phage	1.6e-29	56.9
WP_080626847.1\|465388_466318_+	hypothetical protein	A0A0E3X9I2	Bacillus_phage	3.6e-95	58.7
WP_071583466.1\|466390_466789_+	hypothetical protein	A0A0E3T6A9	Bacillus_phage	1.3e-14	40.5
WP_142396724.1\|466851_467154_+	hypothetical protein	A0A0E3T7L9	Bacillus_phage	2.2e-25	58.2
WP_155761930.1\|467153_467315_+	hypothetical protein	U5Q1C8	Bacillus_phage	1.0e-05	58.7
WP_080626849.1\|467718_468111_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_080626850.1\|468178_468898_+	hypothetical protein	A0A1D6X862	Bacillus_phage	2.3e-28	36.0
WP_080626851.1\|468916_469387_+	hypothetical protein	U5Q195	Bacillus_phage	4.0e-42	59.5
WP_080626852.1\|469649_470102_+	hypothetical protein	U5PWN1	Bacillus_phage	1.2e-27	42.6
WP_080626853.1\|470094_470592_+	hypothetical protein	NA	NA	NA	NA
WP_080626854.1\|470597_471062_+	hypothetical protein	S5MLT8	Bacillus_phage	2.9e-29	41.1
WP_080626855.1\|471074_477035_+\|tail	phage tail tape measure protein	A0A0E3M0Y3	Bacillus_phage	5.7e-08	56.4
WP_080626856.1\|477034_477397_+	hypothetical protein	A0A0E3T7M6	Bacillus_phage	2.6e-33	55.4
WP_080626857.1\|477413_481523_+	hypothetical protein	A0A1D6X857	Bacillus_phage	9.3e-143	45.4
WP_080626858.1\|481542_483945_+	hypothetical protein	R4JGT1	Bacillus_phage	1.1e-159	47.1
WP_080626859.1\|483965_484505_+	hypothetical protein	A0A1L2JY73	Aeribacillus_phage	2.8e-07	42.0
WP_080626860.1\|484526_484991_+	hypothetical protein	A0A0H3UZD0	Geobacillus_virus	1.0e-29	47.0
WP_080626861.1\|485090_485393_+	hypothetical protein	NA	NA	NA	NA
WP_080626862.1\|485420_486500_+	LysM peptidoglycan-binding domain-containing protein	O64040	Bacillus_phage	2.9e-19	68.7
WP_080626863.1\|486512_486797_+\|holin	phage holin	J7KDR1	Streptococcus_phage	6.6e-08	42.2
WP_080626864.1\|486871_487237_+	hypothetical protein	NA	NA	NA	NA
WP_080626865.1\|487295_487814_+	hypothetical protein	NA	NA	NA	NA
WP_080626866.1\|487824_488376_-	hypothetical protein	U5Q1A7	Bacillus_phage	6.2e-26	41.1
WP_080626867.1\|488372_489221_-	thymidylate synthase	A0A1P8CX42	Bacillus_phage	3.3e-79	52.1
WP_080626868.1\|489207_489723_-	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	7.0e-24	41.3
WP_080626869.1\|489733_490465_-	PD-(D/E)XK nuclease family protein	S5M851	Bacillus_phage	7.1e-54	40.4
WP_080626870.1\|490464_491091_-	3'-5' exonuclease	A0A0N9SJX9	Paenibacillus_phage	9.1e-26	37.8
WP_071583484.1\|491118_491301_-	hypothetical protein	NA	NA	NA	NA
WP_080626871.1\|491316_492327_-	toprim domain-containing protein	S5M855	Bacillus_phage	2.8e-85	48.7
WP_071583486.1\|492329_492509_-	hypothetical protein	NA	NA	NA	NA
WP_080626872.1\|492564_493905_-	hypothetical protein	A0A1D6X893	Bacillus_phage	5.9e-123	53.1
WP_080626873.1\|493897_494437_-	hypothetical protein	A0A0E3X9J6	Bacillus_phage	2.5e-32	45.6
WP_080626874.1\|494466_495189_-	sigma-70 family RNA polymerase sigma factor	U5Q0I1	Bacillus_phage	7.5e-32	38.9
WP_080626875.1\|495227_495440_-	hypothetical protein	NA	NA	NA	NA
WP_080626876.1\|495432_495819_-	hypothetical protein	NA	NA	NA	NA
WP_080626877.1\|495891_496176_-	hypothetical protein	NA	NA	NA	NA
WP_080626878.1\|496240_496684_-	hypothetical protein	S5MLV8	Bacillus_phage	9.0e-28	49.0
WP_080626879.1\|496742_497411_-	AAA family ATPase	F8WPX9	Bacillus_phage	3.5e-39	47.1
WP_080626880.1\|497441_497987_-	hypothetical protein	NA	NA	NA	NA
WP_080626881.1\|498010_498550_-	hypothetical protein	NA	NA	NA	NA
WP_080626882.1\|498579_499581_-	AAA family ATPase	A0A0E3T6D1	Bacillus_phage	9.7e-70	47.5
WP_080626883.1\|499570_499828_-	hypothetical protein	NA	NA	NA	NA
WP_080626884.1\|499891_500842_-	hypothetical protein	A0A1D6X8A5	Bacillus_phage	1.9e-51	43.4
WP_080626885.1\|500950_501991_-	ribonucleotide-diphosphate reductase subunit beta	A0A0E3JQ77	Bacillus_phage	9.9e-134	67.4
WP_080626886.1\|502066_504397_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0E3M3E9	Bacillus_phage	3.2e-257	57.6

DBSCAN-SWA_6

828616 : 895880

Bacillus_phage(27.78%)

terminase,plate,holin,coat,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009328811.1\|828616_829066_-\|coat	spore coat protein	NA	NA	NA	NA
WP_011197778.1\|829216_829705_-\|coat	spore coat protein	NA	NA	NA	NA
WP_009328809.1\|829836_830349_-\|coat	spore coat protein	NA	NA	NA	NA
WP_009328808.1\|830419_830818_-	hypothetical protein	NA	NA	NA	NA
WP_009328807.1\|830866_831253_-\|coat	spore coat protein	NA	NA	NA	NA
WP_011197779.1\|831399_831756_+	DUF1360 domain-containing protein	NA	NA	NA	NA
WP_009328806.1\|832042_832252_+	hypothetical protein	NA	NA	NA	NA
WP_011197781.1\|832331_832463_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_009328805.1\|832592_832850_+	sporulation protein	NA	NA	NA	NA
WP_011197782.1\|832888_835171_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	1.0e-90	35.6
WP_016885900.1\|835292_835550_+	hypothetical protein	NA	NA	NA	NA
WP_009328801.1\|835589_836177_-	DedA family protein	NA	NA	NA	NA
WP_009328799.1\|837254_838145_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-84	55.6
WP_011197785.1\|838167_838563_-	GtrA family protein	NA	NA	NA	NA
WP_009328797.1\|838727_839147_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009328796.1\|839156_839666_-	hypothetical protein	NA	NA	NA	NA
WP_009328793.1\|839730_840453_-	esterase family protein	NA	NA	NA	NA
WP_011197786.1\|840443_840776_-	hypothetical protein	NA	NA	NA	NA
WP_011197787.1\|840969_841458_-	DNA damage-inducible protein DinB	NA	NA	NA	NA
WP_009328787.1\|841538_842486_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_009328785.1\|842794_843919_+	methionine biosynthesis PLP-dependent protein	A0A0B5JD48	Pandoravirus	5.3e-16	25.6
WP_011197788.1\|843908_845084_+	cystathionine beta-lyase	A0A0B5JD48	Pandoravirus	6.7e-22	29.3
WP_011197789.1\|845129_846320_-	DUF819 domain-containing protein	NA	NA	NA	NA
WP_011197790.1\|846493_847063_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_009328774.1\|847052_847337_+	hypothetical protein	NA	NA	NA	NA
WP_017474216.1\|847512_848886_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	3.8e-08	23.9
WP_080626900.1\|849190_850177_-	family 43 glycosylhydrolase	NA	NA	NA	NA
WP_016885898.1\|850778_850862_-	hypothetical protein	NA	NA	NA	NA
WP_061565996.1\|851300_851480_+	hypothetical protein	NA	NA	NA	NA
WP_017474214.1\|851513_852092_+	maltose O-acetyltransferase	NA	NA	NA	NA
WP_017474213.1\|852178_852466_-	hypothetical protein	NA	NA	NA	NA
WP_017474212.1\|852673_853564_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011197796.1\|853884_855714_+	assimilatory sulfite reductase (NADPH) flavoprotein subunit	NA	NA	NA	NA
WP_080626901.1\|855741_857460_+	assimilatory sulfite reductase (NADPH) hemoprotein subunit	NA	NA	NA	NA
WP_003180765.1\|857517_858405_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003180767.1\|858496_859369_+	DMT family transporter	NA	NA	NA	NA
WP_003180768.1\|859416_859794_+	glyoxalase	NA	NA	NA	NA
WP_009328757.1\|859837_860386_-	hypothetical protein	NA	NA	NA	NA
WP_003180772.1\|860838_861573_+	LysM peptidoglycan-binding domain-containing protein	A0A217ER34	Bacillus_phage	4.2e-30	60.8
WP_011197798.1\|861628_863053_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	5.1e-16	24.6
WP_075223542.1\|863068_863647_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_075223543.1\|863659_863995_-	hypothetical protein	NA	NA	NA	NA
WP_003180779.1\|864023_864437_-	hypothetical protein	NA	NA	NA	NA
WP_003180781.1\|864811_865294_-	DUF600 family protein	NA	NA	NA	NA
WP_003180784.1\|867564_868212_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	4.1e-45	47.5
WP_003180785.1\|868225_868882_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	4.0e-40	49.7
WP_003180787.1\|869070_869424_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.7e-19	49.6
WP_003180788.1\|869596_869857_+	helix-turn-helix transcriptional regulator	S5MA07	Brevibacillus_phage	7.9e-08	41.2
WP_003180790.1\|869846_870143_+	hypothetical protein	NA	NA	NA	NA
WP_080624211.1\|870143_870974_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.3e-27	31.0
WP_035317447.1\|870873_871674_+	ATP-binding protein	A6XMI1	Bacillus_virus	6.1e-59	48.1
WP_003180798.1\|871944_872286_+	hypothetical protein	NA	NA	NA	NA
WP_003180800.1\|872282_872486_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.9e-12	54.7
WP_003180803.1\|872606_873110_+	sigma-70 family RNA polymerase sigma factor	A0A0K2CNQ1	Brevibacillus_phage	1.4e-21	38.7
WP_003180804.1\|873252_874053_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	5.7e-65	51.4
WP_009328741.1\|874049_875348_+\|terminase	PBSX family phage terminase large subunit	M4ZRM5	Bacillus_phage	7.2e-150	60.2
WP_003180808.1\|875351_876866_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.4e-143	55.5
WP_009328740.1\|876873_877722_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-57	62.8
WP_009328739.1\|877739_878675_+\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	1.1e-102	64.1
WP_011201613.1\|878762_879143_+	DUF3199 family protein	NA	NA	NA	NA
WP_009328738.1\|879139_879496_+	DUF3599 family protein	NA	NA	NA	NA
WP_080626902.1\|879492_879981_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	3.8e-35	45.2
WP_003180824.1\|879993_880434_+	hypothetical protein	NA	NA	NA	NA
WP_003180826.1\|880434_880659_+	hypothetical protein	NA	NA	NA	NA
WP_011197804.1\|880658_882005_+\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	1.5e-78	40.2
WP_003180830.1\|882006_882450_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	2.1e-24	44.7
WP_003180832.1\|882632_883082_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	4.1e-12	38.7
WP_003180833.1\|883123_883261_+	hypothetical protein	NA	NA	NA	NA
WP_080626903.1\|883264_887047_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.7e-42	45.3
WP_003180838.1\|887039_887696_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	4.0e-24	32.6
WP_009328734.1\|887752_888733_+	hypothetical protein	H7BV96	unidentified_phage	9.2e-41	32.3
WP_003180843.1\|888729_889038_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.0e-06	37.3
WP_003180844.1\|889056_889482_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	5.4e-14	39.0
WP_009328732.1\|889474_890518_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	9.7e-73	44.3
WP_009328731.1\|890504_891425_+	YmfQ family protein	A0A0A7RTT8	Clostridium_phage	5.0e-12	28.3
WP_003180850.1\|891438_891825_+	hypothetical protein	NA	NA	NA	NA
WP_003180851.1\|891840_893046_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	9.3e-27	48.3
WP_003180853.1\|893083_894115_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	1.0e-18	48.2
WP_003180856.1\|894217_894487_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	64.0
WP_003180859.1\|894501_894765_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.3e-28	67.8
WP_003180861.1\|894815_895880_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	1.1e-44	50.8

DBSCAN-SWA_7

1896796 : 1908976

Staphylococcus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080626939.1\|1896796_1897390_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	37.6
WP_009327962.1\|1897379_1898135_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.4e-07	23.6
WP_003183108.1\|1898317_1898413_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_003183111.1\|1898533_1899055_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003183113.1\|1899065_1899440_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003183115.1\|1899541_1900006_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-45	70.7
WP_003183117.1\|1900040_1901237_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	53.9
WP_003183118.1\|1901258_1901906_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.4e-39	41.5
WP_003183120.1\|1901917_1903006_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-64	38.1
WP_003183123.1\|1903366_1903711_-	hypothetical protein	NA	NA	NA	NA
WP_003183125.1\|1903973_1906160_-	AAA family ATPase	A0A220BYT7	Staphylococcus_phage	1.4e-150	41.3
WP_003183127.1\|1906286_1906724_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_003183128.1\|1906882_1907188_-	hypothetical protein	NA	NA	NA	NA
WP_009327959.1\|1907177_1908308_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.4e-77	43.3
WP_080626940.1\|1908538_1908976_-	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	3.2e-17	43.3

DBSCAN-SWA_8

2300487 : 2393935

101

Bacillus_phage(78.0%)

protease,head,plate,terminase,tRNA,holin,coat,tail,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003183980.1\|2300487_2301633_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	5.5e-85	43.2
WP_069500660.1\|2301661_2302690_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003183984.1\|2302730_2302931_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003183985.1\|2302923_2303928_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.2e-06	30.3
WP_003183986.1\|2303937_2304543_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003183987.1\|2304665_2305187_-	intercompartmental signaling factor BofC	NA	NA	NA	NA
WP_003183988.1\|2305429_2306080_+	serine/threonine protein kinase	NA	NA	NA	NA
WP_003183990.1\|2306357_2306537_-	small acid-soluble spore protein H	NA	NA	NA	NA
WP_003183991.1\|2306632_2307097_-	DNA damage-inducible protein DinB	NA	NA	NA	NA
WP_003183992.1\|2307157_2307868_-	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.0e-49	55.9
WP_003183993.1\|2308281_2308461_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.5e-21	76.3
WP_003183994.1\|2308552_2308879_-	hypothetical protein	NA	NA	NA	NA
WP_003183995.1\|2309020_2309743_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_080626953.1\|2311415_2312051_-	sporulation protein	NA	NA	NA	NA
WP_003184005.1\|2312223_2313276_-\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_003184007.1\|2313391_2314501_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_009327769.1\|2314522_2315362_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_003184010.1\|2315342_2316917_-	L-aspartate oxidase	NA	NA	NA	NA
WP_009327768.1\|2317017_2318196_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	1.2e-31	25.3
WP_003184015.1\|2318164_2318707_+	transcription repressor NadR	NA	NA	NA	NA
WP_003184017.1\|2318750_2319620_-	prephenate dehydratase	NA	NA	NA	NA
WP_003184018.1\|2319628_2320072_-	ACT domain-containing protein	NA	NA	NA	NA
WP_080626954.1\|2320185_2321472_-	GTPase ObgE	NA	NA	NA	NA
WP_003184022.1\|2321504_2322083_-	sporulation protein	NA	NA	NA	NA
WP_003184023.1\|2322308_2322590_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003184025.1\|2322602_2322944_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003184027.1\|2322956_2323265_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_003184028.1\|2323421_2324288_-	stage IV sporulation protein FB	NA	NA	NA	NA
WP_003184030.1\|2324280_2325072_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_003184032.1\|2325217_2325646_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_061578553.1\|2325645_2325966_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003184035.1\|2326010_2326817_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_011198163.1\|2326819_2327500_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_003184039.1\|2327554_2328073_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003184040.1\|2328069_2328978_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003184042.1\|2329008_2330019_-	rod shape-determining protein	NA	NA	NA	NA
WP_080626955.1\|2330618_2331203_+	hypothetical protein	Q9ZXD6	Bacillus_phage	6.3e-05	26.1
WP_080626956.1\|2331301_2331670_+	YolD-like family protein	O64030	Bacillus_phage	2.0e-17	40.4
WP_035338316.1\|2331892_2333014_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	2.4e-53	35.1
WP_025807654.1\|2333266_2334883_+	ribonuclease YeeF family protein	NA	NA	NA	NA
WP_006637262.1\|2334895_2335312_+	hypothetical protein	A0A2H4J4V0	uncultured_Caudovirales_phage	3.6e-26	44.1
WP_080626957.1\|2335342_2336296_-	LysM peptidoglycan-binding domain-containing protein	A0A141HSE6	Bacillus_phage	1.2e-61	42.0
WP_069500507.1\|2336343_2336607_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	7.9e-32	77.0
WP_069500916.1\|2336622_2336892_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	9.6e-25	61.8
WP_039072971.1\|2336955_2337138_-	XkdX family protein	A0EWM9	Staphylococcus_virus	1.8e-06	47.9
WP_069500506.1\|2337134_2337458_-	hypothetical protein	Q9ZXE0	Bacillus_phage	5.8e-08	37.9
WP_080626958.1\|2337470_2338910_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.4e-58	40.5
WP_080626959.1\|2338948_2340502_-	hypothetical protein	M4ZSB3	Bacillus_phage	7.3e-234	77.2
WP_080626960.1\|2340538_2342248_-	alkaline phosphatase	D6R400	Bacillus_phage	3.6e-218	69.1
WP_017475032.1\|2342260_2343097_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	1.4e-114	72.2
WP_080626961.1\|2343096_2346987_-\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	65.1
WP_009329202.1\|2347184_2347520_-	hypothetical protein	Q9ZXE8	Bacillus_phage	5.0e-31	58.9
WP_080626962.1\|2347580_2348189_-\|tail	phage tail protein	Q9ZXE9	Bacillus_phage	1.4e-55	54.6
WP_009329204.1\|2348188_2348569_-	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	3.0e-32	55.6
WP_009329205.1\|2348565_2348949_-	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	4.1e-45	70.9
WP_009329206.1\|2348941_2349316_-\|head	phage head closure protein	Q9ZXF2	Bacillus_phage	1.2e-36	63.9
WP_080626963.1\|2349245_2349596_-\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.8e-32	59.1
WP_009329208.1\|2349611_2350061_-	collagen-like protein	D6R3Z0	Bacillus_phage	4.0e-15	53.3
WP_017475036.1\|2350086_2351403_-\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	7.9e-96	50.0
WP_025807960.1\|2351443_2352073_-\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	6.0e-94	81.8
WP_009330378.1\|2353493_2355203_-\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	1.0e-300	87.3
WP_017475039.1\|2355821_2356148_-	hypothetical protein	Q9T203	Bacillus_phage	3.7e-31	56.5
WP_003185368.1\|2357511_2357736_-\|coat	spore coat protein	NA	NA	NA	NA
WP_009329244.1\|2358485_2358866_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	8.8e-48	82.9
WP_025807623.1\|2358978_2359356_-	hypothetical protein	R4JMS5	Bacillus_phage	4.3e-31	57.9
WP_009329249.1\|2359371_2359887_-	hypothetical protein	D6R425	Bacillus_phage	1.1e-82	83.6
WP_017695850.1\|2359890_2360061_-	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	5.1e-08	56.6
WP_017474566.1\|2360057_2360597_-	nuclease	Q9ZXC2	Bacillus_phage	1.1e-88	89.9
WP_080626964.1\|2360593_2361031_-	hypothetical protein	Q9ZXC3	Bacillus_phage	1.5e-62	75.9
WP_080626965.1\|2361008_2361380_-	hypothetical protein	NA	NA	NA	NA
WP_080626966.1\|2361601_2364034_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	80.0
WP_017474381.1\|2364094_2364535_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	2.9e-71	89.0
WP_017474382.1\|2364553_2364907_-	hypothetical protein	Q9ZXC6	Bacillus_phage	3.9e-26	56.6
WP_080626967.1\|2364896_2365832_-	AAA family ATPase	Q9ZXC7	Bacillus_phage	3.2e-160	91.0
WP_057957666.1\|2365835_2366393_-	hypothetical protein	Q9ZXC8	Bacillus_phage	2.4e-70	71.4
WP_069500681.1\|2366586_2366856_-	hypothetical protein	Q9ZXC9	Bacillus_phage	9.0e-23	55.8
WP_048355993.1\|2366852_2367044_-	hypothetical protein	NA	NA	NA	NA
WP_080626968.1\|2367194_2367434_-	helix-turn-helix transcriptional regulator	D6R414	Bacillus_phage	3.3e-16	62.0
WP_048355991.1\|2367683_2368127_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	4.9e-42	63.9
WP_048355990.1\|2368158_2368638_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.3e-43	59.9
WP_080626969.1\|2368677_2370066_+	recombinase family protein	Q9T200	Bacillus_phage	6.9e-159	60.5
WP_009329283.1\|2370078_2370465_-	DNA repair protein RadC	NA	NA	NA	NA
WP_003184048.1\|2370519_2371092_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003184050.1\|2371245_2372277_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_003184052.1\|2372480_2373230_-	prepilin peptidase	NA	NA	NA	NA
WP_003184054.1\|2373372_2374677_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_003184055.1\|2374752_2377395_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.8e-161	42.3
WP_003184058.1\|2377856_2378048_+	hypothetical protein	NA	NA	NA	NA
WP_016885545.1\|2378067_2379090_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_063906779.1\|2379117_2380575_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_009329296.1\|2380723_2382019_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_009329298.1\|2382044_2383019_-	porphobilinogen synthase	NA	NA	NA	NA
WP_080626970.1\|2383022_2383814_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_009329302.1\|2383803_2384745_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_011198166.1\|2384784_2385615_-	cytochrome c	NA	NA	NA	NA
WP_009329306.1\|2385620_2386982_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003184074.1\|2387170_2387656_+	hypothetical protein	NA	NA	NA	NA
WP_003184076.1\|2387704_2388292_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_080626971.1\|2388288_2390613_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	7.7e-187	45.2
WP_080626972.1\|2390831_2392487_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	1.4e-17	35.7
WP_003184083.1\|2392669_2393935_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.2e-147	63.5

DBSCAN-SWA_9

2736240 : 2775789

Bacillus_phage(63.89%)

protease,terminase,holin,coat,portal,head,capsid,integrase,tail,transposase

attL 2733941:2734000|attR 2775882:2775957

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2733941:2734000	attL	NA	NA	NA	NA
WP_087635001.1\|2736240_2736675_+	DUF4231 domain-containing protein	A0A0S2MYH2	Enterococcus_phage	3.4e-27	47.9
WP_080627000.1\|2736671_2737076_+	TIR domain-containing protein	NA	NA	NA	NA
WP_080627001.1\|2737077_2737275_-	hypothetical protein	Q4ZA73	Staphylococcus_virus	3.9e-15	65.0
WP_080627002.1\|2737571_2739071_+\|transposase	transposase	NA	NA	NA	NA
WP_080627003.1\|2739085_2739484_+	hypothetical protein	NA	NA	NA	NA
WP_080627004.1\|2739529_2740609_-	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	5.2e-45	53.0
WP_080627005.1\|2740660_2740924_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.3e-31	75.9
WP_071583811.1\|2740939_2741209_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	3.3e-25	62.9
WP_080627006.1\|2741271_2741454_-	XkdX family protein	A0EWM9	Staphylococcus_virus	1.8e-06	47.9
WP_080627007.1\|2741450_2741774_-	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-13	47.4
WP_080627106.1\|2741786_2743133_-	DUF2479 domain-containing protein	D6R402	Bacillus_phage	1.9e-65	42.3
WP_080627008.1\|2743149_2745795_-	peptidase G2	D6R401	Bacillus_phage	1.4e-293	57.0
WP_080627009.1\|2745831_2747544_-	alkaline phosphatase	D6R400	Bacillus_phage	1.2e-216	65.6
WP_080627010.1\|2747556_2748393_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	1.3e-107	67.1
WP_080627011.1\|2748392_2752862_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.3e-70	42.4
WP_043054229.1\|2753070_2753436_-	hypothetical protein	NA	NA	NA	NA
WP_043054228.1\|2753489_2754107_-\|tail	tail protein	NA	NA	NA	NA
WP_043054227.1\|2754121_2754505_-	phage protein	NA	NA	NA	NA
WP_043054226.1\|2754501_2754900_-	hypothetical protein	NA	NA	NA	NA
WP_080627012.1\|2754899_2755208_-\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	9.7e-13	37.6
WP_003185351.1\|2755197_2755500_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.2e-12	46.3
WP_065643430.1\|2755520_2755946_-	collagen-like protein	D6R3Z0	Bacillus_phage	2.9e-15	56.0
WP_075646713.1\|2755968_2757249_-\|capsid	phage major capsid protein	A0A288WGE9	Bacillus_phage	2.6e-75	43.8
WP_080627013.1\|2757318_2758050_-\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	8.9e-57	56.4
WP_071583905.1\|2757994_2759305_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	3.2e-105	46.3
WP_035316082.1\|2759305_2759497_-	DUF1056 family protein	NA	NA	NA	NA
WP_071583906.1\|2759509_2761219_-\|terminase	terminase large subunit	W8CZ43	Bacillus_phage	2.1e-210	63.8
WP_071583907.1\|2761215_2761731_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	6.3e-33	44.0
WP_080627014.1\|2761961_2762336_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	1.8e-29	51.7
WP_080627015.1\|2762362_2762671_-	hypothetical protein	NA	NA	NA	NA
WP_006637235.1\|2762885_2763110_-\|coat	spore coat protein	NA	NA	NA	NA
WP_003185369.1\|2763848_2764229_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	3.0e-48	83.7
WP_080627017.1\|2764603_2765428_+	hypothetical protein	NA	NA	NA	NA
WP_080627107.1\|2765511_2765706_-	hypothetical protein	NA	NA	NA	NA
WP_080627018.1\|2765829_2766345_-	hypothetical protein	D6R425	Bacillus_phage	1.1e-82	83.6
WP_003185375.1\|2766347_2766518_-	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	8.8e-08	54.7
WP_080627019.1\|2766514_2767054_-	nuclease	Q9ZXC2	Bacillus_phage	5.9e-90	91.1
WP_080627020.1\|2767050_2767488_-	hypothetical protein	Q9ZXC3	Bacillus_phage	4.2e-62	75.2
WP_080627021.1\|2767756_2770195_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	80.3
WP_061578359.1\|2770255_2770696_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	3.1e-73	91.8
WP_080627022.1\|2770695_2771628_-	AAA family ATPase	Q9ZXC7	Bacillus_phage	1.2e-154	90.4
WP_080627023.1\|2771631_2772189_-	hypothetical protein	Q9ZXC8	Bacillus_phage	1.6e-69	71.9
WP_080627024.1\|2772281_2772524_-	hypothetical protein	NA	NA	NA	NA
WP_080627025.1\|2772617_2772884_-	hypothetical protein	Q9ZXC9	Bacillus_phage	9.5e-17	51.2
WP_017474831.1\|2773007_2773277_-	hypothetical protein	S5MC08	Brevibacillus_phage	8.4e-21	50.0
WP_026587143.1\|2773282_2773468_-	helix-turn-helix transcriptional regulator	A0A1C8E998	Bacillus_phage	1.5e-16	70.5
WP_080627026.1\|2773736_2774165_+	helix-turn-helix transcriptional regulator	Q5YAA4	Bacillus_phage	1.2e-45	65.2
WP_080627027.1\|2774173_2774596_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	2.0e-45	61.6
WP_080627028.1\|2774640_2775789_+\|integrase	site-specific integrase	A0A2H4JCB7	uncultured_Caudovirales_phage	3.6e-52	34.6
2775882:2775957	attR	NA	NA	NA	NA

DBSCAN-SWA_10

4376294 : 4404794

Bacillus_phage(40.91%)

protease,terminase,tRNA,portal,head,integrase

attL 4384886:4384901|attR 4397952:4397967

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003179225.1\|4376294_4376771_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_003179227.1\|4376751_4377441_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_003179229.1\|4377453_4377912_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_003179232.1\|4377901_4378927_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.1e-67	42.5
WP_080624180.1\|4379166_4381092_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.2e-61	32.3
WP_003179234.1\|4381238_4381745_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_003179237.1\|4381748_4382396_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003179239.1\|4382438_4382618_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_011201569.1\|4382624_4383401_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.3e-15	28.7
WP_003179243.1\|4383446_4383641_-	YdiK family protein	NA	NA	NA	NA
WP_003179245.1\|4383637_4384372_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003179248.1\|4384597_4384882_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.9e-19	52.7
4384886:4384901	attL	NA	NA	NA	NA
WP_003179250.1\|4384926_4386561_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.1e-159	57.7
WP_025807787.1\|4386642_4387860_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	8.0e-143	64.9
WP_025807788.1\|4387873_4388506_-	helix-turn-helix domain-containing protein	A0A1B2APZ3	Phage_Wrath	1.9e-71	62.4
WP_025807791.1\|4388670_4388919_+	helix-turn-helix transcriptional regulator	A0A1B2APZ4	Phage_Wrath	1.1e-19	65.8
WP_025807793.1\|4388945_4389140_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025807794.1\|4389152_4389854_+	Rha family transcriptional regulator	A0A0S2MVD8	Bacillus_phage	4.4e-85	67.8
WP_025807795.1\|4389866_4390265_+	hypothetical protein	NA	NA	NA	NA
WP_025807797.1\|4390363_4390708_+	hypothetical protein	A0A0K2CZE4	Paenibacillus_phage	6.6e-10	55.8
WP_025807799.1\|4390712_4390922_+	hypothetical protein	NA	NA	NA	NA
WP_009330098.1\|4390911_4391124_-	hypothetical protein	NA	NA	NA	NA
WP_025807801.1\|4391178_4391397_+	hypothetical protein	NA	NA	NA	NA
WP_017475008.1\|4391498_4391717_+	hypothetical protein	NA	NA	NA	NA
WP_025807804.1\|4391709_4392588_+	replication protein	V9QKF6	Oenococcus_phage	4.7e-52	44.6
WP_025807806.1\|4392571_4393405_+	ATP-binding protein	Q2I8C8	Bacillus_phage	5.4e-34	37.0
WP_025807808.1\|4393728_4394277_+	hypothetical protein	A0A0K2CNP4	Brevibacillus_phage	5.2e-09	43.3
WP_017474694.1\|4394381_4394531_+	BH0509 family protein	NA	NA	NA	NA
WP_017474644.1\|4394601_4394802_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	4.2e-09	50.9
WP_017474645.1\|4394837_4395071_+	hypothetical protein	NA	NA	NA	NA
WP_017474597.1\|4395584_4395833_+	hypothetical protein	NA	NA	NA	NA
WP_025808209.1\|4396130_4396571_+	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	2.3e-36	51.1
WP_080627099.1\|4396570_4397113_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	3.3e-56	60.6
WP_025808178.1\|4397342_4398146_+	hypothetical protein	NA	NA	NA	NA
4397952:4397967	attR	NA	NA	NA	NA
WP_048407332.1\|4398486_4398708_+	hypothetical protein	NA	NA	NA	NA
WP_026080869.1\|4398943_4399585_+	hypothetical protein	NA	NA	NA	NA
WP_080627100.1\|4399744_4400119_+	HNH endonuclease	Q38456	Bacillus_phage	4.4e-60	81.5
WP_017475039.1\|4400087_4400414_+	hypothetical protein	Q9T203	Bacillus_phage	3.7e-31	56.5
WP_009330377.1\|4400500_4401034_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	2.8e-68	80.2
WP_009330378.1\|4401033_4402743_+\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	1.0e-300	87.3
WP_009330392.1\|4402930_4404175_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.4e-206	83.4
WP_025807960.1\|4404164_4404794_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	6.0e-94	81.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage