CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015027	Sporosarcina sp. P33 chromosome, complete genome	2 crisprs	RT,DEDDh,csa3,cas3,PrimPol,DinG	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015027_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015027_1

1821409-1821541

Orphan

Consensus_repeat	Method
ACTTAGTCGTACACAACGTGCGAGCAAAT	PILER-CR

2 spacers

csa3

The CRISPR arrays of NZ_CP015027_1

>merge|NZ_CP015027|1|1821409-1821541|PILER-CR
CTAAGTCATACACAACGTGCGAGTTAGTTACCAATGCTCTTAAATATGTATGGGATTTAGTCGTACACAACGTGCGAGCAAATCCACCACTTATAATTTATGAAACTTAGTCGTACACAACGTGCGAGCAAGT

>NZ_CP015027|1|1|1821409-1821541|PILER-CR
CTAAGTCATACACAACGTGCGAGTTAGTT	ACCAATGCTCTTAAATATGTATGGGATTTAG
TCGTACACAACGTGCGAGCAAATCCACCA	CTTATAATTTATGAAACTTAG
TCGTACACAACGTGCGAGCAAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015027.1\|WP_081243417.1\|1811318_1811996_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725
NZ_CP015027.1\|WP_081243429.1\|1826393_1826873_-\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	unknown	unknown	gnl\|CDD\|376840
NZ_CP015027.1\|WP_081243427.1\|1822511_1823966_+\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP015027.1\|WP_081243431.1\|1828614_1829403_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293819
NZ_CP015027.1\|WP_081243433.1\|1830213_1831542_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369363
NZ_CP015027.1\|WP_081243418.1\|1812052_1812565_-\|DUF1456-family-protein	unknown	unknown	gnl\|CDD\|227144
NZ_CP015027.1\|WP_081243419.1\|1812665_1813028_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP015027.1\|WP_081243422.1\|1815399_1817661_+\|bifunctional-glutamate--cysteine-ligase-GshA/glutathione-synthetase-GshB	unknown	unknown	gnl\|CDD\|179427
NZ_CP015027.1\|WP_155961328.1\|1824129_1825782_-\|mercury(II)-reductase	unknown	unknown	gnl\|CDD\|273944
NZ_CP015027.1\|WP_081243425.1\|1820937_1821288_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015027.1\|WP_081243428.1\|1825852_1826182_-\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
NZ_CP015027.1\|WP_081243416.1\|1810289_1811078_+\|DUF817-domain-containing-protein	unknown	unknown	gnl\|CDD\|377545
NZ_CP015027.1\|WP_081243421.1\|1814277_1815111_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP015027.1\|WP_081243426.1\|1821771_1822392_-\|amino-acid-transporter	unknown	unknown	gnl\|CDD\|224198
NZ_CP015027.1\|WP_081243430.1\|1827284_1828508_-\|PDZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP015027.1\|WP_081243432.1\|1829414_1830227_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227190
NZ_CP015027.1\|WP_081243420.1\|1813154_1814273_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP015027.1\|WP_081243424.1\|1819199_1820075_+\|5'-methylthioadenosine/S-adenosylhomocysteine-nucleosidase	unknown	unknown	gnl\|CDD\|350159
NZ_CP015027.1\|WP_081243423.1\|1817816_1818662_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP015027.1\|WP_081243434.1\|1831532_1833356_-\|cell-wall-metabolism-sensor-histidine-kinase-WalK	unknown	unknown	gnl\|CDD\|380161

Protein	Function_ID	Function_description	E-value
NZ_CP015027.1\|WP_081243417.1\|1811318_1811996_-\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	5.24029e-66
NZ_CP015027.1\|WP_081243429.1\|1826393_1826873_-\|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH	gnl\|CDD\|376840	pfam02590, SPOUT_MTase, Predicted SPOUT methyltransferase. This family of proteins are predicted to be SPOUT methyltransferases.	4.03091e-85
NZ_CP015027.1\|WP_081243427.1\|1822511_1823966_+\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	8.63517e-149
NZ_CP015027.1\|WP_081243431.1\|1828614_1829403_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293819	cd07733, YycJ-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis YycJ and related proteins; MBL-fold metallo hydrolase domain. Includes the uncharacterized Bacillus subtilis YycJ protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	2.44777e-72
NZ_CP015027.1\|WP_081243433.1\|1830213_1831542_-\|hypothetical-protein	gnl\|CDD\|369363	pfam07435, YycH, YycH protein. This family contains the bacterial protein YycH which is approximately 450 residues long. YycH plays a role in signal transduction and is found immediately downstream of the essential histidine kinase YycG. YycG forms a two component system together with its cognate response regulator YycF. PhoA fusion studies have shown that YycH is transported across the cytoplasmic protein. It is postulated that YycH functions as an antagonist to YycG. The molecule is made up of three domains, and has a novel three-dimensional structure. The N-terminal domain features a calcium binding site and the central domain contains two conserved loop regions.	6.92756e-64
NZ_CP015027.1\|WP_081243418.1\|1812052_1812565_-\|DUF1456-family-protein	gnl\|CDD\|227144	COG4807, COG4807, Uncharacterized protein conserved in bacteria [Function unknown].	4.42405e-45
NZ_CP015027.1\|WP_081243419.1\|1812665_1813028_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	8.83291e-31
NZ_CP015027.1\|WP_081243422.1\|1815399_1817661_+\|bifunctional-glutamate--cysteine-ligase-GshA/glutathione-synthetase-GshB	gnl\|CDD\|179427	PRK02471, PRK02471, bifunctional glutamate--cysteine ligase GshA/glutathione synthetase GshB.	0
NZ_CP015027.1\|WP_155961328.1\|1824129_1825782_-\|mercury(II)-reductase	gnl\|CDD\|273944	TIGR02053, Mercuric_reductase, mercury(II) reductase. This model represents the mercuric reductase found in the mer operon for the detoxification of mercury compounds. MerA is a FAD-containing flavoprotein which reduces Hg(II) to Hg(0) utilizing NADPH. [Cellular processes, Detoxification].	0
NZ_CP015027.1\|WP_081243428.1\|1825852_1826182_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	5.78287e-18
NZ_CP015027.1\|WP_081243416.1\|1810289_1811078_+\|DUF817-domain-containing-protein	gnl\|CDD\|377545	pfam05675, DUF817, Protein of unknown function (DUF817). This family consists of several bacterial proteins of unknown function.	1.26542e-124
NZ_CP015027.1\|WP_081243421.1\|1814277_1815111_+\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	6.1995e-115
NZ_CP015027.1\|WP_081243426.1\|1821771_1822392_-\|amino-acid-transporter	gnl\|CDD\|224198	COG1279, COG1279, Lysine efflux permease [General function prediction only].	9.91888e-60
NZ_CP015027.1\|WP_081243430.1\|1827284_1828508_-\|PDZ-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	1.11928e-83
NZ_CP015027.1\|WP_081243432.1\|1829414_1830227_-\|hypothetical-protein	gnl\|CDD\|227190	COG4853, COG4853, Uncharacterized protein conserved in bacteria [Function unknown].	1.24647e-45
NZ_CP015027.1\|WP_081243420.1\|1813154_1814273_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP015027.1\|WP_081243424.1\|1819199_1820075_+\|5'-methylthioadenosine/S-adenosylhomocysteine-nucleosidase	gnl\|CDD\|350159	cd09008, MTAN, 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidases. This subfamily includes both bacterial and plant 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidases (MTANs): bacterial MTANs show comparable efficiency in hydrolyzing MTA and SAH, while plant enzymes are highly specific for MTA and are unable to metabolize SAH or show significantly reduced activity towards SAH. MTAN is involved in methionine and S-adenosyl-methionine recycling, polyamine biosynthesis, and bacterial quorum sensing. This subfamily belongs to the nucleoside phosphorylase-I (NP-I) family, whose members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases, such as purine nucleoside phosphorylase (PNPs, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases, such as AMP nucleosidase (AMN, EC 3.2.2.4), and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	4.65902e-58
NZ_CP015027.1\|WP_081243423.1\|1817816_1818662_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	7.22308e-17
NZ_CP015027.1\|WP_081243434.1\|1831532_1833356_-\|cell-wall-metabolism-sensor-histidine-kinase-WalK	gnl\|CDD\|380161	NF033092, HK_WalK, cell wall metabolism sensor histidine kinase WalK. This model describes WalK as found in Staphylococcus aureus (sp\|Q2G2U4.1\|WALK_STAA8). A shorter version, as found in Streptococcus pneumoniae, called WalK(Spn) or VicK, is not included. WalK is part of a two-component system and works with partner protein WalR.	0

>NZ_CP015027.1|WP_081243425.1|1820937_1821288_+|hypothetical-protein
MHINGYTELVNLINTELKTNDDFAFIICDDGKPAEISNFYNALKNPSNKRVYPDLQIKKSHDANCNLIQLADLINFISSVYFRQAYGHPPRKRHQAKIVDFYTQFIQSKLKFHEYK
>NZ_CP015027.1|WP_081243424.1|1819199_1820075_+|5'-methylthioadenosine/S-adenosylhomocysteine-nucleosidase
MRRISLRNLRLVGFIVCMIFLATIVSGCNSAATSTSDTEKRPIIVQGPMPIEAEKFAEKLNDMEVEESGNFVFYKGTIDEYPVIVTKTSKGMENTAAATALAIEKYDPIAIINQGTSGGHDPDLHVFDIVLGKRTVNIGSMKTASAEENEGMDPSLWKPMDLMASEGSAGEDPNAEKIRYFEGDDELLAAANAVKDQYKLGKVVEGTIGSADLWNNEVDRINWFHEKYGTSVEEMEGAAAAQISESYNVPFLGIRILSNNKTNDGQYNPETASANQDYVYLVLKEYISKLK
>NZ_CP015027.1|WP_081243423.1|1817816_1818662_-|DMT-family-transporter
MLKAYAWLTLCVMVWGSNFVFGKMLVQDFSPALLTSLRLLFIVLFLIGLSSYKLQVKRLHTYDLLAVFFLGVFGVFINQWSFFAGLETADPTTSALILATTPILTGVLAGIFLKEKLTIRMLLGSVVAIIGIYFVVAKGDMSSIHIDKGLWWIVVTMITFAMLIIVTRLLSNRMDPLAITLYSNVVGLVVSVPFIFLLDTPIRMSSKVSDWSFLIGTAVVVHGIAMLIWNNNIRYVDASKASILSNLEPFVAMIMGLILLYKPIMGPEIVGSLFIVGGVVL
>NZ_CP015027.1|WP_081243422.1|1815399_1817661_+|bifunctional-glutamate--cysteine-ligase-GshA/glutathione-synthetase-GshB
MDLKKMLADERVKPYVSKARYGIEKEGQRVDLSGNLATTDHPAAIGMGDEHPYIQRDFSETQMELITPVLDTLDELFNCLSSIHDVAYRSMGKEEMLWPLSMPPALPEKEEDIVIAKLNNSENVLYRRSLANSYGRRKQMICGIHFNFEFSDDLLRTLFDLQSETDDYHRFKTDIYLKLTRNYLYYRWLVTYFYGASPASEENFYGCDDRPNEPVRSIRSSRYGYRNHDDVAVSFSTIQKYIEDLTSAVNRGQLVEEKEFYTAMRLRGSEQVAEFINDGVRYVEVRNIDLNPFETNGISYEQAEFLHIFLLYLLQKDEDPQNDEWGHAGDARNDAVALEHPLARTQFEAEAYELVNGMEMLSKELDFPVSESLFDDLRERIADPSKTLAGRLYTESQKSSQRQVAVEIANETHTKLWEKPYELTGFTDMELSTQILMYDAIQLGISIKILDRHDQFLELKLGDHVEYVKNGNMTSKDTYIATLIMENKTVTKRILHDKGFRVPLGDEFNSVEDALRAYKLFAKTPFVVKPKTTNYGLGISIFKDGAGYEDFEQAVNIAFDEDSSILIEEFLSGTEYRFFVLQDKVLAVMLRVPANVTGDGIHTIKELVTEKNRDPLRGTDHRTPLELIQLGELEILMLKGQGYQLDSIPADGEIVYLRENSNVSTGGDSIDVTDQISEEYKKIAADAVAALGAKISGIDLIIDDLDVPAANPGAYGIIEANFNPSMYMHIYPYKGTSRRLTTDVLHYLFPELT
>NZ_CP015027.1|WP_081243421.1|1814277_1815111_+|S-formylglutathione-hydrolase
MSLERVEQRRSFGGEQCKYNHYSEVLKCNMTFSIYLPSNKEQKEIPLIWWLSGLTCTDDNFSQKSGFQRLAEKHQAAVIIPDTSPRGEDIADDEAFDLGQGAGFYVDATQAPWAENYQMYTYITEELSNIASTLVPHFSRKESIMGHSMGGYGALMIGMKNADRFQAISAFSPISSPSDVPWGTKAFSTYLGENKADWKEWDTAELVKKEGIPPILITQGTSDGFYPEQLNEKPFLENAEQHGQAVDYNKAEGYDHSYFFISSFLEQHFDFHMKHLK
>NZ_CP015027.1|WP_081243420.1|1813154_1814273_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFKPGEPLQIVEIDVEEPKANEVLVKILYTSVCHTDAYTLSGDDAEGVFPAVLGHEGAGVVVSVGEGVTSVKPGDHVIPLYTPECGKCKFCLSGKTNLCSAIRETQGKGLMPDGTTRFSYNGEPIYHYMGTSTFSEYTVVSEISLVKVDDENAPLDKVCLFGCGVTTGIGAVHNTAKVEEGAVTAVFGLGAIGLAVIQGLQQAKAGRIIAVDLNEDKFELAEKMGATDFINPSKYDKPIQEVIVEMTDGGVDYSFECIGNVEVMKAALECCHKGWGESIIIGVAAAGKEIHTRPFQLVTGRVWRGSAFGGVKGRSELPGMIEDYMNGDIDLDSFITHQMNFTDINEAFDLLHKGESIRTILTYGE
>NZ_CP015027.1|WP_081243419.1|1812665_1813028_-|helix-turn-helix-transcriptional-regulator
MVIHYKDKTYFTSKDLALSVIGGRWKIAIIWCLLQESTLRLSEIQKKLPDANQRMLIRQLRELEEDNIVTRYVYPVVPPKVEYQLSEIGLLLEPVVTSICDFGDQFMNSIEKANGENTAE
>NZ_CP015027.1|WP_081243418.1|1812052_1812565_-|DUF1456-family-protein
MNNNDVLSRLRYALDLKDSAMAEIFALGGMELKKAEVKEMLTKTNDDSTDEMQMNEYAKEIDNITLESFLNGLISLKRGVRENTEHAPQPFLMSEEGHRNVNNILLKKVKIALSLTSEDMLQILGDAGVIISKNELSAVLRKEGHRNYKPCGDRYARNFLKGLAMRYRNQ
>NZ_CP015027.1|WP_081243417.1|1811318_1811996_-|peptidylprolyl-isomerase
MRNKAWYFIISVMALAILLAGCGKTAENGPADTPKEQPKEEPKEQAVDYSADVKENPIVTITMENDEKIVLELEPAVAPNTVANFISLVEDGYYDGLIFHRVIPGFMIQGGDSSGDGSGGPGHAIDGEFTSNGFENNMKHERGVLSMARTMDPNSAGSQFFIMTDDTASLDGEYAAFGKVIEGMETVDAIVAAETDSADKPVEEQKMKKVEADTKGFDYPAPVTH
>NZ_CP015027.1|WP_081243416.1|1810289_1811078_+|DUF817-domain-containing-protein
MNLHALQMKALHSMQQLFYFGWQQALSCIFPVIIFGSLALTQVIPLPFLPRYDWLLLIFIAVQWRMLKSGLETRDELKVITLFHILGLTLEIFKVHMGSWSYPEEGYFKILDVPLYSGFMYASVASYLCQAWRRLDVSLIQWPRLWAVGPLAAAIYANFFTHHYWIDVRWWLSALVLLLFWRSSVSYEVNGTRYRMPLTLAFALIGFFVWIAENIATFFGAWTYPNQSAAWHVVGIGKLSSWLLLVIVSFLIVAVLKQIKKS
>NZ_CP015027.1|WP_081243426.1|1821771_1822392_-|amino-acid-transporter
MEPLLHGMILAFGLILPLGVQNVFVFNQGATHKKFTNALPAIITAGVCDTILIYLAVAGVSIIVFSFEWLKILLFLVGFLFLAYMGWVMWKNSPEVSANQEKIQFSARRQVTFAASVSLLNPHAIMDTIGVIGTSSLAYTGWEKWIFTVACIVVSWLWFFSLAISGRKIGQIDKNGKFLKRMNQVSAVIIWVMAIYMGYHLYSFLN
>NZ_CP015027.1|WP_081243427.1|1822511_1823966_+|PLP-dependent-aminotransferase-family-protein
MPEIEWKPQKNSSFPLHQQISDYMKKKIMSGEWTIGTKIPSQRSLARLFQVNRSTIVFALEELVADGLIESKVGSGTKVINNTWSLLTSTPPPDWINYVKAGIHKPNISVIQEINKAEADPNIFRLGTGELSPNLLPTSKMREILQIDHKQPLTLGYMEPRGSLPLRKTISTYLRSKGIEASPESILIVSGGLQALQLISIGLLKRGSTILHETPSYLNSVHVFQSAGMNLLGIPLDDDGIKCDSIGRMKRQHHAALLYTIPNFHNPTGFLMSKRRRMELLKVCQQESIPIIEDDVYGDLWLDTPPPSPLKSNDTQGNVLYIGSVSKTLSPGLRIGWVVGPEPVIERLADIKMQTDYGSSSLSQYAVDKWLSSGMYEDFLKEIRVELRFRRDFTIQILEKYFSDIATWIEPKGGFYIWLRIQSGVSSGKLFDLALREGILLNPGSVYEKHDSQHLRISYSYASIEQLENGLITLSQLIKKSSIN
>NZ_CP015027.1|WP_155961328.1|1824129_1825782_-|mercury(II)-reductase
MINKTVQVKIPVQGMTCVGCENHVIDALARAGASNIKADYHRGNATFEIEKGSIINAKRAINDIGYQVGEEAIDSEGKFFALNSEDGKYDLLIIGSGSAAFSAAIKAVEKGAKVAMVERGTIGGTCVNIGCVPSKTMLRAGEINYSSANNPFTGLNTKAEPVNMANLMEQKNELVQGMREQKYVDLIGEYGFDMIHGEASFMNEKTVIVNGKQYTANNFLISTGATPSIPDITGLSEVDYLTSTTALELKEVPKRLGIIGSGYIAMELGQLFNDLGAEVSLMQRSERLLKEYDQEISEAIDIALTKRGLKFIKSVTYKKVEQDGDIKKVHIEVNGKEQIIEVDQLLVATGRTPNTKSLNLKAAGVEVGTRGEVIVNNYLQTSNPHIYAAGDVTLGPQFVYVAAYEGGIVAENTLSSTKKKIDLRFVPGVTFTNPSIATVGLTEKKAKDQGYDVKRSVLSLDSVPRALVNRETDGVFKLVVDNKTQKILGAHVVAENAGDVIYSATLAVQFGLTVDDIRNTMAPYLTMNEGLKLAALTLDKDVSKLSCCAG
>NZ_CP015027.1|WP_081243428.1|1825852_1826182_-|helix-turn-helix-transcriptional-regulator
MDEAYIKEIQSETASKFFYGLSNPARLEIVLALLDEEKNVSQLVEDLNMKQSQISNQLICLKTCGFVTSRKEGKFVYYKVTDPRIRDIIQLGQSVVVENAGRINSCTRL
>NZ_CP015027.1|WP_081243429.1|1826393_1826873_-|23S-rRNA-(pseudouridine(1915)-N(3))-methyltransferase-RlmH
MNITIVTVGKLKEKYLKQGIEEYIKRLNSYAKMQLIEVADEKAPETLSEADMEIVKKKEADRILAKIAPDAHVIALAIDGKMKTSEEFAVSMESLMTYGKSKIVFVIGGSLGLHSSVLQRANEKLSFSKMTFPHQLMKLVLVEQIYRGFRIIKGEPYHK
>NZ_CP015027.1|WP_081243430.1|1827284_1828508_-|PDZ-domain-containing-protein
MDDERRTEWQPSQPSEPKREQKRKGEFWPALFGALLGGAIVFALMTYAAGLSADDSAVQSAKTENTPDSQHVQIPMDISSEVTDVVDEVATAVVGITNIQTVQDFWSARKTTQEAGSGSGVIYKKSGDKAYIVTNHHVVENSEQLEVTFDDGTKTEGKLIGSDLWTDLAVVEIDAKDVDAVVEFGDSDTLKRGESVIAIGNPLGLGFAGSVTVGVISGKDRSIPMDLNKDGIIDWQADVLQTDAAINPGNSGGALINMAGQLIGINSMKISQETVEGIGLAIPINIALPIIEHLEETGQVNRPTMGVSLLDLQQIPIQQQQQTLKLPKDITEGVVVTDIMSNSPAVAAGMEKYDTIVQLDEEKVTDMVSLRKYLYNKKEIGDQLKVTVYRDGKKMELEMVLKDGNTF
>NZ_CP015027.1|WP_081243431.1|1828614_1829403_-|MBL-fold-metallo-hydrolase
MRFSILASGSTGNSLYIETDEHAFLVDAGMSGKKIEGLLGSINRSMQHIDGIFVTHEHSDHIKGIGVLARKYKTPIYANAKTWQAMDGLVGEIPVDQRFHFDMETVKTFGSLDIQSFAVSHDAADPMFYTFNEGGRKLAIITDTGYVSDRMKGHIQGADSFVFESNHDVSMLQMGRYPWSIKRRILSDVGHVSNEDAAVAMSEVVAEKNTQIYLAHLSLDNNMKDLARMSVAQTLEDCGIRAGEFVHLHDTDAAEPTELVLV
>NZ_CP015027.1|WP_081243432.1|1829414_1830227_-|hypothetical-protein
MDWNRTKTIFIIVFSILNVFLYWLYLDRQMGVGDMQVLGKTSVEETLRLENITYDPIPFSKKEVSYLSAHIATFSEEKLDKLSNQSFSWDEKSRLLSRMKKKVSIKNDEGELEFDEFLSKYVLKGEEYVLWELDEEDQRAVFFQRVKNETIFYSPNAMLIVHWDDDGKVTHYEQRMLEEFLSFNHKKDLLSQDDAVTSLVTRGYLQPDSTVMQVKSGYSTLVQLTETQVFAPTWNVQVKLKDGTIEHYFINAIEGKVIEFQPEMLEEQIE
>NZ_CP015027.1|WP_081243433.1|1830213_1831542_-|hypothetical-protein
MGLKRIETIKSIVLLLLVSLSVLFTVTIWNYSPNYEPLEQSQTVDISISKKKTIDEIIKPYKLLTHLKDQVLGSVNTEKIDTILAEMNTWHLSNLQLVSQDMNKADIARVLRQPSQMTLYFPGEVPMLVYDNVLLVDDTSIPEATFNRLVIDWSRSTQAPVIHMLSEISGLHYQAQVTLPNKTSFLRNVVDVGQSFEEYAEIDRGNATFLAVPKNPVKVTRNTYYQEEINPLRFRDALFSDPNAVRRSQVDPTHEEYGDDHAFMNVNTEIKRLSYVMPAVESQEIAIPSELLLNTIDFVNEHGGWTDEFRYAYMNPISRYVKFQLYAEGLPVFSEHSGTNEITETWGDNRVFKYIRPYYSLDVNIEAVKEELPSGVEVAEALRESEELDFELIEEITPGYFMIHDVEKKLIILQPCWYYLIKDNWLRFMPGDLQGGGSSGLE
>NZ_CP015027.1|WP_081243434.1|1831532_1833356_-|cell-wall-metabolism-sensor-histidine-kinase-WalK
MQKVGFFRSIQVKFVLIYVLLILVAMQIIGLYFARELEQTLKENFTNSIVDRMNLVEFSVREEITKKRKDDDPTLEQSLKNVLAEFTSDDIIEIRVINSKYRILASSSFENQTRVGQHSTNDNVRKSITSETIKDVVEIDPQSHNRVLSLAKPIFNGNEIVGSLYVEANIESVFQQIEEINRILAGAAAVSLTITIIVGIFIARAFTRPISDMRRQAQAMAKGNFTRKVKVYGMDEMGQLAIAFNHLTNQLQESQSTTESERRKLTSVLENMTDGVISTDRKGRISLINDSALQMLNVTNDLVINRPIASILGIEDEYTFEELIQLNESIPLDFSTEEQSYILRATISVTQRETGFVNGLIVVLHDNTEQEKIDMERREFVSNVSHELRTPLTTMRSYLEALAEGAYKNEEIAPNFLRVTQNETERMIRLVNDLLKLSRMDSKEYELNKEWVEFNRFFNAVIERFEFSKSQNVRFTRNLYSSSLFVEIDTDKLTQVLDNIISNALKYSPDGGEVRFGVTVSGDYIKVMISDDGMGIPKSNVNRIFDRFYRADRARSRALGGTGLGLAIAKEMIAAHKGDIWAQSEEGKGTTIFFKLPFEQQEDGEWD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015027_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015027_2

2672071-2672220

Orphan

Consensus_repeat	Method
AAGACTTATTGAAAACGATTTCAAA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP015027_2

>merge|NZ_CP015027|2|2672071-2672220|PILER-CR
AATAGTTTTTGAAAACGATTTCAAATGCCTTCCGAGCAAACAAATAAATAATTAAATTTTTTTGTCTTTGTTGAAAACGATTTCAAAGAGTAATGTTAAAATTCAATTTCGCTGAATCATATAGCAAGACTTATTGAAAACGATTTCAAG

>NZ_CP015027|2|2|2672071-2672220|PILER-CR
AATAGTTTTTGAAAACGATTTCAAA	TGCCTTCCGAGCAAACAAATAAATAATTAAATTTTTTTGTCT
TTGTTGAAAACGATTTCAAAGAGTA	ATGTTAAAATTCAATTTCGCTGAATCATATAGCAAGAC
TTATTGAAAACGATTTCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015027.1\|WP_081244114.1\|2668076_2668892_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|270700
NZ_CP015027.1\|WP_081244110.1\|2664870_2665935_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015027.1\|WP_081244113.1\|2667190_2667781_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015027.1\|WP_081244107.1\|2658081_2658516_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015027.1\|WP_081244112.1\|2666298_2666850_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015027.1\|WP_081244118.1\|2673214_2674027_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235506
NZ_CP015027.1\|WP_081244119.1\|2674056_2675076_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270321
NZ_CP015027.1\|WP_081244866.1\|2670942_2671896_+\|D-glycerate-dehydrogenase	unknown	unknown	gnl\|CDD\|240626
NZ_CP015027.1\|WP_081244115.1\|2669086_2669794_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP015027.1\|WP_081244124.1\|2678810_2679809_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP015027.1\|WP_081244120.1\|2675195_2675729_+\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|225632
NZ_CP015027.1\|WP_081244117.1\|2672330_2673107_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293797
NZ_CP015027.1\|WP_081244121.1\|2675760_2677035_+\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP015027.1\|WP_081244122.1\|2677063_2677711_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224707
NZ_CP015027.1\|WP_081244116.1\|2669895_2670594_-\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	unknown	unknown	gnl\|CDD\|162788
NZ_CP015027.1\|WP_081244108.1\|2660779_2661007_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015027.1\|WP_081244125.1\|2680618_2681803_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP015027.1\|WP_081244123.1\|2677745_2678645_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP015027.1\|WP_081244109.1\|2661330_2664783_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224263
NZ_CP015027.1\|WP_081244867.1\|2679836_2680598_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187605

Protein	Function_ID	Function_description	E-value
NZ_CP015027.1\|WP_081244114.1\|2668076_2668892_+\|phosphotransferase	gnl\|CDD\|270700	cd05151, ChoK-like, Choline Kinase and similar proteins. This subfamily is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate and displays negligible activity towards N-methylated derivatives of Etn. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.19211e-34
NZ_CP015027.1\|WP_081244118.1\|2673214_2674027_+\|glucose-1-dehydrogenase	gnl\|CDD\|235506	PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	1.92836e-78
NZ_CP015027.1\|WP_081244119.1\|2674056_2675076_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270321	cd13603, PBP2_TRAP_Siap_TeaA_like, Substrate-binding domain of a sialic acid binding Tripartite ATP-independent Periplasmic transport system (SiaP) and related proteins; the type 2 periplasmic-binding protein fold. This subfamily includes the periplasmic-binding component of TRAP transport systems such as SiaP (a sialic acid binding virulence factor), TeaA (an ectoine binding protein), and an uncharacterized TM0322 from hyperthermophilic bacterium Thermotoga maritima. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.30634e-111
NZ_CP015027.1\|WP_081244866.1\|2670942_2671896_+\|D-glycerate-dehydrogenase	gnl\|CDD\|240626	cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH). D-glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase, HPR) catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. In humans, HPR deficiency causes primary hyperoxaluria type 2, characterized by over-excretion of L-glycerate and oxalate in the urine, possibly due to an imbalance in competition with L-lactate dehydrogenase, another formate dehydrogenase (FDH)-like enzyme. GDH, like FDH and other members of the D-specific hydroxyacid dehydrogenase family that also includes L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase, typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form, despite often low sequence identity. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	2.0146e-136
NZ_CP015027.1\|WP_081244115.1\|2669086_2669794_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	1.75791e-84
NZ_CP015027.1\|WP_081244124.1\|2678810_2679809_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	7.4515e-106
NZ_CP015027.1\|WP_081244120.1\|2675195_2675729_+\|TRAP-transporter-small-permease	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	3.78249e-26
NZ_CP015027.1\|WP_081244117.1\|2672330_2673107_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293797	cd07711, MBLAC1-like_MBL-fold, uncharacterized human metallo-beta-lactamase domain-containing protein 1 and related proteins; MBL-fold metallo hydrolase domain. Includes the MBL-fold metallo hydrolase domain of uncharacterized human MBLAC1 and related proteins. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	3.58152e-31
NZ_CP015027.1\|WP_081244121.1\|2675760_2677035_+\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	1.80921e-126
NZ_CP015027.1\|WP_081244122.1\|2677063_2677711_+\|hypothetical-protein	gnl\|CDD\|224707	COG1794, RacX, Aspartate racemase [Cell envelope biogenesis, outer membrane].	0.000385316
NZ_CP015027.1\|WP_081244116.1\|2669895_2670594_-\|noncanonical-pyrimidine-nucleotidase,-YjjG-family	gnl\|CDD\|162788	TIGR02254, hydrolase_haloacid_dehalogenase-like_family, noncanonical pyrimidine nucleotidase, YjjG family. This HAD superfamily includes including YjjG from E. coli and YfnB from B. subtilis. YjjG has been shown to act as a house-cleaning enzyme, cleaving nucleotides with non-canonical nucleotide bases. This family is a member of the haloacid dehalogenase (HAD) superfamily of hydrolases which are characterized by three conserved sequence motifs. By virtue of an alpha helical domain in-between the first and second conserved motif, this family is a member of subfamily IA (TIGR01549).	1.6148e-60
NZ_CP015027.1\|WP_081244125.1\|2680618_2681803_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.75034e-154
NZ_CP015027.1\|WP_081244123.1\|2677745_2678645_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	7.41786e-78
NZ_CP015027.1\|WP_081244109.1\|2661330_2664783_+\|hypothetical-protein	gnl\|CDD\|224263	COG1344, FlgL, Flagellin and related hook-associated proteins [Cell motility and secretion].	2.04681e-34
NZ_CP015027.1\|WP_081244867.1\|2679836_2680598_+\|glucose-1-dehydrogenase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.84217e-98

>NZ_CP015027.1|WP_081244866.1|2670942_2671896_+|D-glycerate-dehydrogenase
MSETLLKQLSDQFIVSYHPDITKLSDSFYDDLRTADGIIGSKLIINKPFIQKALNIKIVSSISAGYDNIDVDYLTSKNIMLTNTPGVLADSVVDTIFALMLAAARRVPELDNFVKEGEWKHQRISSNLYGLDVHHKVLGIVGMGGIGKTLARRAKYGFDMNVIYYNRKQDKDAERKLGVTYMPYNELLSRADYIVVLVPLTNDTYKMIGEEAFFYMKSSAIFINCSRGDVVDEEELIKALTSRKIFAAGLDVYSKEPLPSDSRLLKLSNVITLPHVGSSTQETKDKMIGLAIENLIDGLNGKLPKNLINAEVVDRKL
>NZ_CP015027.1|WP_081244116.1|2669895_2670594_-|noncanonical-pyrimidine-nucleotidase,-YjjG-family
MSYDLLLFDLDDTLFDFDETEKHALGKTFHTFGLPNGLDAYRDTYRAISSVIWDELEQGHIAIEELKVERFRRLFAHHELQIDASHFGELYIENLGYESHLIDGVEEMISRLSEYRLAILTNGFTLAQHARIAGSPLRNTFEAIIASEETGYRKPQREIFEYTFNKLGITDPSRVLMIGDSLTSDIQGGINAGIDTCWFNRDRRENHTGIQPTYEIHSWEEFSPGRVTAICK
>NZ_CP015027.1|WP_081244115.1|2669086_2669794_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MKPLIGVTSDIDQNGDTLVQTRYIQAVRQAGGVPVVLPVGLEATEEVCERLDGLLLIGGEDIDPYLYGEEPHRQLGKVLPERDESELALINTMAVQDKAVFGICRGYQLINVAFGGTIYQDMYAQLSEDLLQHHQLTDLDFAFHSIDMVGDSKLAEWAGTSEVRVNSLHHQAVKEVQAPLVVTAVAKDGVIEAIESTAHRFVVGVQWHPEAMVKRGDRLSLKLFEQFIEAASGKR
>NZ_CP015027.1|WP_081244114.1|2668076_2668892_+|phosphotransferase
MFPIEELTYIKRLGGLTNLNFLVAHKGQKYVLRFPAHEFEDIINRHHEKANQQIAAEIGVTVGNAVFTDEGIKMTPYYDATADLTRDLMGTAEYLEKIAGVLSALHSSNKEFPNRFDYWGEVEKYKITLAEIPSLYVLLEERLRKLMQGERQEYVPCHMDSVTANFIQNDARQLLLIDWEYSANYLPEWDLAAFILERELSEEQEQVLLDYYGLPASLKPSLELQKLKSDFLWSLWSLVKEKEDPSFEQYTAKRTERLIEGLEQYYRVYGN
>NZ_CP015027.1|WP_081244113.1|2667190_2667781_+|hypothetical-protein
MDIKQYIKTAWEGLPNAPTELAPSYLGKFFQMVKNKQFDRRIKKVEEPFLRVLQMIPLNDFKYFEDKIGPIVIQRIFLDDEDDKAEFLILGFENCVKNEIKDEDLIIYYFDLISELRVLDLKRLVSFSGRTDETPIRPEESSKEELLLHSSDIKLNRLGLIQVKMGWSSENGDQINYNFPIELTKRGNKFLDFIGF
>NZ_CP015027.1|WP_081244112.1|2666298_2666850_-|hypothetical-protein
MTFDNIESCAVIAGAITTAVFSFLIWRANIQSAKAAKGAADAANESAQVSKMIFESQEELKKNVRDQLKRDILTQFQKIEKQVRTLKDSGITSEVMNKLPVSINITNHELGTYFETSERKVIHQAMSKYEEYIKRYFVEGIPKFIENEELTKDTQDLHDKVFNVILLFIETHVATVEVNISDH
>NZ_CP015027.1|WP_081244110.1|2664870_2665935_+|hypothetical-protein
MISNNRYKQKRSKQDAYLSNTERAARIATLLTIIAGLFYILTIVFKFYITLFKNKVYLDFPVQIEHMVSSSVITFLLLIIGHLIYQVYRDTYTYNSYFGSKQMKTKKMDLIADKTYYNLFQSIKHYLLIFFLINIIFLFITEILNENYVVYPILLIMTIFMIIWCVIEFKKLLIYFKNLRYNYGYYFITIILLGFIIMLGIAFSAQSKSLLVEFGESNNYSLILSIESENFKPENIHIEYLVNNEKNEQIKNRETILNSKDFRYGYIQNTQELREEEGRIKKDKKTAVLNNSFIKYIYEDNIYEYLTEGENFVVFTIEIQSLGTSNYIKIFNQIHKDKNGELKITKDKFEWKGV
>NZ_CP015027.1|WP_081244109.1|2661330_2664783_+|hypothetical-protein
MIIKNGSFGLQRNMNQANERLEKSMAKLSSGKRITSAAVDASGLAISEKLRALQRGSRQALQNVQDAQSLAQTADAAMQELTDVVQRIRELTIQAMNGTNTDVQFDSDSVDTLIIQNEVDELKKNLRDIVHKTEFNTHKLLTNTVPGEYVYADRSVSVDRSARTVPVSGNAVFGGNTAKIEPSSYTKQVNIGSDSRTVEEVTASYPPVNGKVTTVMDQKPRWSADGETILFQSTRDGQRYSVPANGSVDPRVDADTSEAATRKEAGDYRLEMVNSSLQLQKRSGSNWTVERSYTNYNIADGLHGYNFAPTADSDGKWSFAFSDSDGNISKVVINTQNGSISSPVSVIPNTDKLNLPPINNTISLGGTPDLYRMNEGDASLVVHKVTDSGSQQLTYWDETGTAPVSGYYTVNGSQITFHEDAKIGFDPNSEDDAQDYYTFRFVRGNSAAIHSETIPSQAQLYNVNGEPGPMSLRIQIDGKGTIAREHYLADRPADPENTTGVYIDKATGKAEFYGDLRPAHNETVRITYVPDSDSDRGVQTYVLPAEIDIYNLNSLDPTLPKSLEVYAGGRKIAYDASMTDGYTYDPATRRISLYGNSRPDVSIGEKIHYKYIADYSSTNTNEVVYGIPLGSAKPEVFNLGDADAPNSIRVFRGEEEINYSDTDGFQYNAITNTIELFGNSRPNVEDKYFVRMVTVLEDPVKHDDMLEIPLFDKPVLYQPDSLGIPEMLNVTIAGKVITYDETKQDGYFYNKQTNAVEIYGNSRPDAKDSTLLLPKISVTFVTESGLVNLYNNSYDIPLGAGASSYGIEGEGNVKGLKVFKDTVEIPYDAEDGYTINPETNLVSLHGSYRPTAKTAPNSIRVYSVPESSLSATVPEGSTVHKVSIGITEILPAVDENGHGYLFENGKVKLIGDARPDAVFGRPSYAMEVIYTEPLSMDLPVNPLLTDDTAYCDHETGSALPDAEVVPDSQVIRLNGQVLTPDQYNISDSRVTLINSEVTLAVGSNTISADYQIRQGIHYADNSYTFQVGGNSGNQQVLNIASFDNMLVDMSAVCVRTAEHAAKGLEIIDRSMNFILGELGNIGAAENSLTHIAANLRIGEESMTAALSRIEDLDVAKELMNSTKLQMLTQVGQTLAGHDKQRREGILGLLK
>NZ_CP015027.1|WP_081244108.1|2660779_2661007_+|hypothetical-protein
MDSKHQEELKRLYSQLEQVKQRDRILEEIEKRLYKMKQIAQYTADHNLDKDETMQLEMQIRDHQKAISSLENYLI
>NZ_CP015027.1|WP_081244107.1|2658081_2658516_+|hypothetical-protein
MIEKIGYLVKKANDKTSWRNRLAALKEISEIDCPQRKDVVIRLAIHDNVFAVKEEACRIANKLGLEKNGKAIKLGKKDIGFKSKDFNKVFARIKRESKMEEFNLELFKEKFENSNPEMYDVMSFDKKGKFDNWIENIYNGLPRK
>NZ_CP015027.1|WP_081244117.1|2672330_2673107_+|MBL-fold-metallo-hydrolase
MTEQNRREEQILVYNHEIFVQGFPGKSKTHGGLGWSTITLLTNDTHNIIVDAGSFGVRKILLEKLRQKGLTFDDIDYVLLTHTHWDHSVNWTMFPNATIVIGDVDLEWALNDATQDMDIPELYIKELSHYPKTKVVGHLDEVLPGIVAHQTSGHTPGHITYTVDNGNYDLIFCGDAAKNRAELLSQEVDMTLNLEESKASIQYIWNLWEAKQDSLVIPGHDIPMKLENGVPVYVLERRADLQCWFSSTLNDVFKAKIT
>NZ_CP015027.1|WP_081244118.1|2673214_2674027_+|glucose-1-dehydrogenase
MKQQDNQRVIITGGSKGLGRGVCLSLAAQGASIVIADIDKEAGLKCEKEIIDQGGNALFVNTDVSSMEDIENLFDKADEFLGGVDVLVNNAGIAHGPNSERHFLKTDYTMWDRLMKVHLYGMFMCSQMAAVRMVEQGTGGNIINMSSGGATQAHRNRVAYDTTKGAIEAATRAMALDLAPKSIRVNSVMPGAMEVEERTSVGEESSPGDVIPLGRLGLPEDVGSAVKFLISPEASYITGHVLVVDGGLTAQLRPPKMDADVKSEFEQFSK
>NZ_CP015027.1|WP_081244119.1|2674056_2675076_+|TRAP-transporter-substrate-binding-protein
MLKRNAKFIFLFSIITSLFLAACSGNDDNASAEGGKTKKIEFTAGHTLTPDSARHKAMEKFKEALEEKSDGTMTLKLFPQSQLGGEVEMQEAAQSGNQDIVFTSSSTLVNLAPEFSVLDLPYIFNDMDHANKALRSDAGTQLLDLLPDHQLVGLGYLEAVERNIFSNKPIKKAADIKGMKNRVIQSPVYVKTYKALGSQPTPMAYSELYTALQQGVVDGGDASADQFVLDKFVEVSDYYNITKMNYIPMVGIMSKSVWDGLTEEQQEIVQSSFDVASEFAPEEFERQVNSFLEEMKEKGIEVIEPDIDSFKEATEQVKTKILKDIPSGNDLYEAFQNVE
>NZ_CP015027.1|WP_081244120.1|2675195_2675729_+|TRAP-transporter-small-permease
MAYLKFVDKLNKFFELLLATVFFIMTCLIFIQVLVRFVFTYFDFNVSVPWTEEIARYIMIWVVFLGAALSMRKDNMIQLDPLVNAMSVKSGKIVKIASLVTTAIFFIIIIVLGYDYVMRGMEQMSPVLQIPMGIAFLSIPFGAIVMVLNIIAIMVESKMMKKDIRFISTNDEELNIE
>NZ_CP015027.1|WP_081244121.1|2675760_2677035_+|TRAP-transporter-large-permease
MILYLFVILGVLFLISTPIAVALGFSSLIIFEIDGVPLDIVLQRAFSGLNSFSLMAVPFFILAGNLMQGGGIAKRLMDFANVLVGWFRGGIAAATIIGTMFFSTLSGSSAATTAAMGSITIPNMTKRGYPKPFAAALIAASGELGVIIPPSLALIMYGLAANVSIGDLFLAGITPGLFIGFTLLLAVYIVIRIKGYGQGESLIRENWLKKLGGTFKNAIWTIFMPIIILGGIYSGIFTPTEAAAVAVVYGLIIGFFVHKELTISKTIKIFTESAITSGIILIIVGFSTVFGYLLTIYQVPHAIAEFMFNFTDNPLVFLLIVNIMILITGMFMEALAAIIILAPILVPVAVQFGIDPVHFGIIMTVNFAIGMITPPLAVNLYVACQVAKIKLTDIIPPLLIFLVVLLIDLFIITYIPAISTWILG
>NZ_CP015027.1|WP_081244122.1|2677063_2677711_+|hypothetical-protein
MKIGILHATPNAVEPLNKAIKQLLPESIVLNFVNEHIQYYANEIKGIDDKVCRDFVQMANTAQEAEVDVIIVACTVLTPIVDLVKPFVSIPIIAVDKPMLDLAVTNYTKIGVVATNAPSGPATKKQLEGIAKEQNKQIIVETAIDTQAMIELKSGEIANHNELNVKAAQKLKDLGCEVIILAQITQAVAEERVKEVGLPVLTSPTEAAKTIKKLI
>NZ_CP015027.1|WP_081244123.1|2677745_2678645_+|NAD(P)-dependent-oxidoreductase
MKLSFIGLGVMGRGMALNLAKGKSEGEYDLTVCDANESSLKEFQEMGVSTTSNVQETADSEYVFLCLPNLEVVQSVILGENGLLKNMKAGQKIIDFSTISYVGAVDIAEKCKSEGVIFMDCPISGQQLKSEKGTLSIMCGGDEETFNEIMPYLDRMGEQILYMGENGAGQLTKMINNCALNICCASFSELMPVGVKLGLDPEKLGDVLMTATGASFASQTLIPKVLDGNFEHGFSLERAYKDMESMYEVLIKEEIPLPTLNGTMQSYQLALRNGQRDYYKHAMICYYEDLLGVKVRRGQ
>NZ_CP015027.1|WP_081244124.1|2678810_2679809_+|LacI-family-transcriptional-regulator
MMKRVTIKDVAKHANVSPSTVSRVLNNYLHVKPEKRKKVEESIRILNFEPNEIARSLITKKTKTIGLIVDDITNPFFSESAKIVINLARSNGYEILIYDTSGESDIEQSLNFLINRNISGLLVGSASNEESNYNKLKSFDIPLVYFNREPKDNIFDSVTMDNKKASQIAVNYLVAQGHENIAFLSGPLKYSTYIDRLEGYKNALQQNNIPIKNENILLETFSIQKLENCLGTLLTAKDRPTAILASSDNIAITALSIISKLGLTVPDDVAVIGFDNISISSNPYINLSTISQQKSKMLSTALEILINKIESSEVVNTKNIKIEPILIKRKTT
>NZ_CP015027.1|WP_081244867.1|2679836_2680598_+|glucose-1-dehydrogenase
MKELFNLTDKVAIVTGASKGIGREIALALAKCGADVALIARGEKELIEVSKEIEELGRKSLVVPLDLMNIEEIDEKVELIQKHFGKIDILINNAGLNIAKPALEVTEEDWDLVLDINLKSVFFISKAVGKHMIPNKQGKIINMSSQMAFVGFYKRAAYSSSKGGITQMTKALSIEWAEHNVNVNAIAPTFIKTPMTESMFEEEGFQEEVLNRIPLKRLGKVEDILGAVIYLASPSSNLVTGHTLVVDGGWTAW
>NZ_CP015027.1|WP_081244125.1|2680618_2681803_+|iron-containing-alcohol-dehydrogenase
MNQISVNIQDFRIPSNIKAGRNSFSTIHKDIEELAPQKIVLVSDQGLLKSGLIDEIKYELLVHGVPISTYTNISGEPYFETVKEAIDFMKQENADLVIGIGGGSALDVAKASAALVNKDEQVVQSILQGETAPSHRGIYCILVPTTSGTGSEVTMNAIFGDKKNSVKRGIVSPYYLPDIAIIDPALTVGCPSFVSAASGVDAFTHAIESYVSKKATPLTKIYAQDAMKRFSRNIAKVVFDGTNIEAREEMCWVSLLAGVSLANAGVGAVHALAYPLGGRYHVPHGVANALLLPYVFNVIGKTCINEMVEIADFLELGNFTTKPLEAQQAVVNYLFRLLDELDLPKNLKELEVTEESLKEMAFEASKVSRLLDNTPYKLTEESILQIYQHAYAGY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015027_1	1.1\|1821438\|31\|NZ_CP015027\|PILER-CR	1821438-1821468	31	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	164463-164493	6	0.806

1. spacer 1.1|1821438|31|NZ_CP015027|PILER-CR matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 6, identity: 0.806

ttagttaccaatgctcttaaatatgtatggg-	CRISPR spacer
ttattaaccaatgctcttaaatata-ataagt	Protospacer
*** * ******************. **..*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

255892 : 266902

Tupanvirus(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081244711.1\|255892_257662_-\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	7.0e-23	29.0
WP_081242057.1\|257783_259046_-\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	3.9e-15	22.2
WP_081242058.1\|259461_259908_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_081242059.1\|259926_262125_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	1.3e-10	34.8
WP_081242060.1\|262272_262785_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.0e-30	45.3
WP_081242061.1\|262775_264824_-	single-stranded-DNA-specific exonuclease RecJ	A0A1G5SBU4	Enterococcus_phage	1.2e-10	23.2
WP_081242062.1\|265012_266902_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.8e-33	27.4

DBSCAN-SWA_2

816448 : 932239

113

Bacillus_phage(29.41%)

plate,terminase,transposase,portal,tail,holin,protease,integrase,capsid

attL 819192:819213|attR 933387:933402

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099662801.1\|816448_817614_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.2e-36	37.1
WP_155961302.1\|818030_818195_+	hypothetical protein	NA	NA	NA	NA
WP_081242547.1\|818280_818922_-	hypothetical protein	NA	NA	NA	NA
819192:819213	attL	NA	NA	NA	NA
WP_081242549.1\|820336_821179_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	8.2e-30	33.3
819192:819213	attL	NA	NA	NA	NA
WP_081242550.1\|821331_821514_-	hypothetical protein	NA	NA	NA	NA
WP_081242551.1\|821661_822075_-	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_081242552.1\|822478_822907_+	HEAT repeat domain-containing protein	NA	NA	NA	NA
WP_155961303.1\|822965_823586_-	endonuclease V	NA	NA	NA	NA
WP_081242554.1\|824170_824911_-	hypothetical protein	NA	NA	NA	NA
823780:823801	attR	NA	NA	NA	NA
WP_081242555.1\|824894_825389_-	RNA polymerase sigma factor	NA	NA	NA	NA
823780:823801	attR	NA	NA	NA	NA
WP_081244743.1\|826177_826486_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081242556.1\|826501_827695_+	chromate efflux transporter	NA	NA	NA	NA
WP_081242557.1\|828308_829622_-	short-chain fatty acid transporter	NA	NA	NA	NA
WP_081242558.1\|829990_830764_+	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_081242559.1\|830890_831553_-	hypothetical protein	NA	NA	NA	NA
WP_081242560.1\|832237_833161_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_081242561.1\|833393_833657_-	hypothetical protein	NA	NA	NA	NA
WP_081242562.1\|834093_835164_+	hypothetical protein	NA	NA	NA	NA
WP_081242563.1\|835720_836998_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_081242564.1\|837385_838522_+\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-25	34.1
WP_081242565.1\|838514_839168_+	ABC transporter permease	NA	NA	NA	NA
WP_081244744.1\|839167_840061_+	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081242566.1\|840189_840465_-	DUF2564 family protein	NA	NA	NA	NA
WP_081244745.1\|840642_841608_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_081242567.1\|841671_842760_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_081242568.1\|843172_844342_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_081242569.1\|844681_845842_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_081242570.1\|846106_846958_+	DegV family protein	NA	NA	NA	NA
WP_081242571.1\|847084_847399_-	hypothetical protein	NA	NA	NA	NA
WP_081242572.1\|847915_848179_+	N-6 DNA methylase	NA	NA	NA	NA
WP_081242573.1\|848181_849531_+	N-6 DNA methylase	A0A076FHE5	Aureococcus_anophage	5.2e-10	34.4
WP_081242574.1\|849536_850625_+	DNA cytosine methyltransferase	M1PSQ0	Streptococcus_phage	2.8e-46	34.9
WP_081242575.1\|850849_853465_+	N-6 DNA methylase	NA	NA	NA	NA
WP_081242576.1\|853602_855663_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_081242577.1\|855959_856721_-	AIM24 family protein	NA	NA	NA	NA
WP_081242578.1\|856967_857162_-	hypothetical protein	NA	NA	NA	NA
WP_081242579.1\|857218_858151_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_081242580.1\|858147_859347_-	TniQ family protein	NA	NA	NA	NA
WP_081242581.1\|859706_860270_-	YdhK family protein	NA	NA	NA	NA
WP_081242582.1\|860372_860699_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_081242583.1\|860818_861892_-	stage II sporulation protein P	NA	NA	NA	NA
WP_081242584.1\|862012_863515_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_081242585.1\|863801_864614_-	hypothetical protein	NA	NA	NA	NA
WP_155961304.1\|865037_866176_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.4e-101	65.3
WP_081242586.1\|866255_867227_+	adhesin	NA	NA	NA	NA
WP_081242587.1\|867443_867848_+	hypothetical protein	NA	NA	NA	NA
WP_155961305.1\|867987_869529_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_081242588.1\|869762_872180_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	6.5e-128	40.1
WP_081242589.1\|872332_872536_-	copper chaperone CopZ	NA	NA	NA	NA
WP_081242590.1\|872627_872915_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_081244747.1\|872934_873345_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_081242591.1\|874608_875655_-	hypothetical protein	S5MM68	Bacillus_phage	7.9e-14	35.6
WP_081242592.1\|875970_877329_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	2.8e-120	51.3
WP_081242593.1\|878319_878595_-	glutaredoxin family protein	NA	NA	NA	NA
WP_081242563.1\|878985_880263_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_081242594.1\|880411_881089_-	hypothetical protein	NA	NA	NA	NA
WP_155961395.1\|881355_882762_-	MATE family efflux transporter	NA	NA	NA	NA
WP_081242595.1\|883471_884095_+	nitrite reductase	NA	NA	NA	NA
WP_155961396.1\|884523_885084_-	redoxin domain-containing protein	NA	NA	NA	NA
WP_081242597.1\|885125_886022_-	copper-binding protein	NA	NA	NA	NA
WP_081242598.1\|886225_888289_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.4e-78	34.2
WP_081242599.1\|888443_888827_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_081242600.1\|888909_889716_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_081242601.1\|889754_890939_-	c-type cytochrome biogenesis protein CcsB	NA	NA	NA	NA
WP_081242602.1\|890938_892588_-	cytochrome c biogenesis protein ResB	NA	NA	NA	NA
WP_081242603.1\|892623_893334_-	cytochrome C biogenesis protein CcdA	NA	NA	NA	NA
WP_081242604.1\|893369_894104_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_081244749.1\|894124_895039_-	sialidase	NA	NA	NA	NA
WP_081242605.1\|895053_895731_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-38	40.5
WP_081242606.1\|895751_897113_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.9e-40	33.3
WP_155961306.1\|897252_897858_+	thiol-disulfide oxidoreductase ResA	NA	NA	NA	NA
WP_081242609.1\|898134_898707_-	hypothetical protein	A0A288WFY4	Bacillus_phage	3.4e-27	38.8
WP_081242610.1\|898850_900047_-	hypothetical protein	NA	NA	NA	NA
WP_081242611.1\|900158_901052_-	hypothetical protein	NA	NA	NA	NA
WP_155961307.1\|901636_901801_+	hypothetical protein	NA	NA	NA	NA
WP_081242612.1\|902023_903358_+	cell division protein FtsK	U5PWN3	Bacillus_virus	1.3e-143	62.0
WP_081242613.1\|903308_903902_+	hypothetical protein	A0A1S5QTS6	Bacillus_phage	4.6e-51	52.6
WP_081242614.1\|903915_904452_+	hypothetical protein	A0A2H4JA12	uncultured_Caudovirales_phage	4.7e-23	66.7
WP_081242615.1\|904632_905538_-	hypothetical protein	A0A2H4J4U2	uncultured_Caudovirales_phage	1.1e-43	42.9
WP_081242616.1\|905537_905831_-\|holin	phage holin	A0A142F1N6	Bacillus_phage	7.8e-20	49.5
WP_081242617.1\|905844_906252_-	hypothetical protein	NA	NA	NA	NA
WP_081242618.1\|906344_906527_-	hypothetical protein	NA	NA	NA	NA
WP_081242619.1\|906546_906777_-	XkdX family protein	NA	NA	NA	NA
WP_081242620.1\|906773_906986_-	hypothetical protein	NA	NA	NA	NA
WP_081242621.1\|906999_909444_-	hypothetical protein	A0A172JII4	Bacillus_phage	3.7e-54	42.5
WP_081244750.1\|909448_910477_-	hypothetical protein	H7BWD2	unidentified_phage	9.9e-94	50.9
WP_155961308.1\|910752_911121_-	hypothetical protein	NA	NA	NA	NA
WP_081242623.1\|911162_911534_-	hypothetical protein	NA	NA	NA	NA
WP_081242624.1\|911526_911856_-	hypothetical protein	NA	NA	NA	NA
WP_081242625.1\|911855_912731_-	hypothetical protein	NA	NA	NA	NA
WP_081242626.1\|912723_913836_-\|plate	baseplate J/gp47 family protein	A0A0C5AEG2	Bacteriophage	1.5e-84	43.6
WP_081242627.1\|913832_914162_-	hypothetical protein	A0A067ZJ13	Vibrio_phage	1.5e-16	50.5
WP_081242628.1\|914158_914548_-\|tail	phage tail protein	NA	NA	NA	NA
WP_081242629.1\|914560_915052_-	hypothetical protein	NA	NA	NA	NA
WP_081242630.1\|915048_916071_-	hypothetical protein	A0A0C5AJ59	Bacteriophage	6.2e-64	40.2
WP_081242631.1\|916055_916262_-	hypothetical protein	A0A067ZJB1	Vibrio_phage	2.3e-10	43.1
WP_081242632.1\|916258_919774_-\|tail	phage tail tape measure protein	A0A0U4IIN6	Exiguobacterium_phage	1.4e-94	62.2
WP_081242633.1\|919922_920312_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_081242634.1\|920313_920835_-\|tail	phage major tail tube protein	A0A067ZJA9	Vibrio_phage	2.4e-40	45.7
WP_081242635.1\|920853_922275_-\|tail	phage tail protein	A0A059WKP9	Vibrio_phage	3.9e-141	53.4
WP_081242636.1\|922277_922646_-	hypothetical protein	NA	NA	NA	NA
WP_081242637.1\|922635_923136_-	hypothetical protein	NA	NA	NA	NA
WP_081242638.1\|923132_923729_-	hypothetical protein	A0A067ZG41	Vibrio_phage	3.4e-22	35.4
WP_081242639.1\|923725_924058_-	hypothetical protein	NA	NA	NA	NA
WP_081242640.1\|924054_924453_-	hypothetical protein	NA	NA	NA	NA
WP_081244751.1\|924466_925489_-\|capsid	major capsid protein	A0A0C5ABI0	Bacteriophage	2.5e-65	37.8
WP_081242641.1\|925516_925876_-	hypothetical protein	NA	NA	NA	NA
WP_081242642.1\|925872_927027_-\|protease	Clp protease ClpP	A0A0A7RWX3	Clostridium_phage	9.5e-53	52.4
WP_081242643.1\|927023_928595_-\|portal	phage portal protein	A0A0C5AJ48	Bacteriophage	1.0e-158	54.8
WP_081244753.1\|928608_928839_-	hypothetical protein	A0A067ZJ01	Vibrio_phage	3.0e-11	47.1
WP_081244752.1\|928847_930647_-\|terminase	phage terminase large subunit family protein	A0A0C5ABH4	Bacteriophage	3.3e-185	54.7
WP_081242644.1\|930603_931158_-	hypothetical protein	NA	NA	NA	NA
WP_081242645.1\|931669_932239_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	6.5e-39	48.9
933387:933402	attR	NA	NA	NA	NA

DBSCAN-SWA_3

935408 : 947432

Bacillus_phage(20.0%)

integrase

attL 931050:931064|attR 946136:946150

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
931050:931064	attL	NA	NA	NA	NA
WP_081242654.1\|935408_935969_-	hypothetical protein	R9TQ23	Paenibacillus_phage	1.0e-44	55.4
WP_081242655.1\|936123_936969_-	SANT/Myb domain-containing protein	NA	NA	NA	NA
WP_081242656.1\|936991_937456_-	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	5.2e-42	74.1
WP_081242657.1\|937597_937822_-	hypothetical protein	NA	NA	NA	NA
WP_155961309.1\|937836_938007_-	hypothetical protein	NA	NA	NA	NA
WP_081242658.1\|938019_938886_-	AAA family ATPase	U5PWH5	Bacillus_phage	2.5e-50	41.2
WP_081242659.1\|938809_939652_-	replication protein	V5UQV4	Oenococcus_phage	2.6e-44	40.6
WP_081242660.1\|939761_940040_-	hypothetical protein	NA	NA	NA	NA
WP_081242661.1\|940040_940322_-	hypothetical protein	NA	NA	NA	NA
WP_081242662.1\|940430_940763_-	hypothetical protein	NA	NA	NA	NA
WP_081242663.1\|940759_941506_-	hypothetical protein	A0A1W6JPM7	Staphylococcus_phage	1.8e-41	42.6
WP_081242664.1\|941502_941703_-	helix-turn-helix domain-containing protein	A0A0S2GLE9	Bacillus_phage	1.0e-10	55.0
WP_081242665.1\|941660_941930_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081242666.1\|942075_942480_+	helix-turn-helix transcriptional regulator	A0A2H4JDE4	uncultured_Caudovirales_phage	1.7e-17	58.4
WP_081242667.1\|942604_942829_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081242668.1\|942990_944061_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	1.8e-90	52.3
WP_081242669.1\|944561_945029_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.5e-44	62.5
WP_081242670.1\|945074_947432_-	ribonuclease R	Q0GXV6	Lactococcus_phage	3.5e-86	36.6
946136:946150	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015027

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection