CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP015894	Lactococcus lactis subsp. cremoris strain 158 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,csa3,DinG	12
NZ_CP016690	Lactococcus lactis subsp. cremoris strain 158 plasmid p158F, complete sequence	0 crisprs	NA	0
NZ_CP016685	Lactococcus lactis subsp. cremoris strain 158 plasmid p158A, complete sequence	0 crisprs	NA	1
NZ_CP016689	Lactococcus lactis subsp. cremoris strain 158 plasmid p158E, complete sequence	0 crisprs	NA	0
NZ_CP016686	Lactococcus lactis subsp. cremoris strain 158 plasmid p158B, complete sequence	0 crisprs	WYL	0
NZ_CP016687	Lactococcus lactis subsp. cremoris strain 158 plasmid p158C, complete sequence	0 crisprs	NA	0
NZ_CP016688	Lactococcus lactis subsp. cremoris strain 158 plasmid p158D, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015894_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015894_1

2006257-2006352

Orphan

Consensus_repeat	Method
TCTTCCTCAATCTTCCCAATTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015894_1

>merge|NZ_CP015894|1|2006257-2006352|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTTCCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATATTCTTCCTCAATTTTCCCAATTCTT

>NZ_CP015894|1|1|2006257-2006352|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTT	CCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATAT
TCTTCCTCAATTTTCCCAATTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015894.1\|WP_011677124.1\|2016350_2017193_+\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270428
NZ_CP015894.1\|WP_003137511.1\|2007145_2007406_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|225511
NZ_CP015894.1\|WP_081172510.1\|2012157_2013027_-\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NZ_CP015894.1\|WP_015082903.1\|2017281_2018604_-\|pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|180907
NZ_CP015894.1\|WP_011677102.1\|1988266_1988758_-\|prolyl-tRNA-editing-protein	unknown	unknown	gnl\|CDD\|226283
NZ_CP015894.1\|WP_015082892.1\|1994584_1995649_-\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|179366
NZ_CP015894.1\|WP_015082893.1\|1995814_1997047_-\|arginine-deiminase	unknown	unknown	gnl\|CDD\|234949
NZ_CP015894.1\|WP_011677121.1\|2011339_2012122_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP015894.1\|WP_041931833.1\|2002265_2002865_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015894.1\|WP_015082899.1\|2008858_2009638_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373100
NZ_CP015894.1\|WP_015082897.1\|2003081_2006186_-\|DNA/RNA-helicase-SWF/SNF-family	unknown	unknown	gnl\|CDD\|350770
NZ_CP015894.1\|WP_015082890.1\|1991910_1992855_-\|carbamate-kinase	unknown	unknown	gnl\|CDD\|237071
NZ_CP015894.1\|WP_015082889.1\|1988833_1990327_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP015894.1\|WP_081213195.1\|2015496_2016201_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP015894.1\|WP_015082901.1\|2013198_2015490_+\|Xaa-Pro-dipeptidyl-peptidase	unknown	unknown	gnl\|CDD\|235435
NZ_CP015894.1\|WP_015082895.1\|2000733_2002065_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NZ_CP015894.1\|WP_015082894.1\|2000115_2000574_+\|arginine-repressor	unknown	unknown	gnl\|CDD\|130592
NZ_CP015894.1\|WP_011677109.1\|1998353_2000048_-\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|183534
NZ_CP015894.1\|WP_011677119.1\|2010099_2010429_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227933
NZ_CP015894.1\|WP_015082898.1\|2007829_2008786_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|365903

Protein	Function_ID	Function_description	E-value
NZ_CP015894.1\|WP_011677124.1\|2016350_2017193_+\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270428	cd13710, PBP2_TcyK, Substrate binding domain of an ABC transporter TcyJKLMN; the type 2 periplasmic binding protein fold. This group contains periplasmic cystine-binding domain (TcyK) of an ATP-binding cassette transporter from Bacillus subtilus and its closely related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.80736e-84
NZ_CP015894.1\|WP_003137511.1\|2007145_2007406_+\|IS3-family-transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.24415e-08
NZ_CP015894.1\|WP_081172510.1\|2012157_2013027_-\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	2.51202e-67
NZ_CP015894.1\|WP_015082903.1\|2017281_2018604_-\|pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|180907	PRK07251, PRK07251, FAD-containing oxidoreductase.	1.09567e-150
NZ_CP015894.1\|WP_011677102.1\|1988266_1988758_-\|prolyl-tRNA-editing-protein	gnl\|CDD\|226283	COG3760, COG3760, Uncharacterized conserved protein [Function unknown].	1.74136e-74
NZ_CP015894.1\|WP_015082892.1\|1994584_1995649_-\|ornithine-carbamoyltransferase	gnl\|CDD\|179366	PRK02102, PRK02102, ornithine carbamoyltransferase; Validated.	0
NZ_CP015894.1\|WP_015082893.1\|1995814_1997047_-\|arginine-deiminase	gnl\|CDD\|234949	PRK01388, PRK01388, arginine deiminase; Provisional.	0
NZ_CP015894.1\|WP_011677121.1\|2011339_2012122_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	3.89843e-08
NZ_CP015894.1\|WP_015082899.1\|2008858_2009638_-\|hypothetical-protein	gnl\|CDD\|373100	pfam14507, CppA_C, CppA C-terminal. This is the C-terminal domain of the CppA protein found in species of Streptococcus. CppA is a putative C3-glycoprotein degrading proteinase, involved in pathogenicity. It is often found associated with pfam14506.	1.10613e-24
NZ_CP015894.1\|WP_015082897.1\|2003081_2006186_-\|DNA/RNA-helicase-SWF/SNF-family	gnl\|CDD\|350770	cd18012, DEXQc_arch_SWI2_SNF2, DEAQ-box helicase domain of archaeal and bacterial SNF2-related proteins. Proteins belonging to SNF2 family of DNA dependent ATPases are important members of the chromatin remodeling complexes that are implicated in epigenetic control of gene expression. The Snf2 family comprises a large group of ATP-hydrolyzing proteins that are ubiquitous in eukaryotes, but also present in eubacteria and archaea. Archaeal SWI2 and SNF2 are members of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	6.35985e-94
NZ_CP015894.1\|WP_015082890.1\|1991910_1992855_-\|carbamate-kinase	gnl\|CDD\|237071	PRK12353, PRK12353, putative amino acid kinase; Reviewed.	7.27953e-178
NZ_CP015894.1\|WP_015082889.1\|1988833_1990327_-\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	3.59578e-152
NZ_CP015894.1\|WP_081213195.1\|2015496_2016201_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	6.90169e-101
NZ_CP015894.1\|WP_015082901.1\|2013198_2015490_+\|Xaa-Pro-dipeptidyl-peptidase	gnl\|CDD\|235435	PRK05371, PRK05371, x-prolyl-dipeptidyl aminopeptidase; Provisional.	0
NZ_CP015894.1\|WP_015082895.1\|2000733_2002065_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NZ_CP015894.1\|WP_015082894.1\|2000115_2000574_+\|arginine-repressor	gnl\|CDD\|130592	TIGR01529, Arginine_repressor., arginine repressor. This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions].	8.41328e-60
NZ_CP015894.1\|WP_011677109.1\|1998353_2000048_-\|arginine--tRNA-ligase	gnl\|CDD\|183534	PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP015894.1\|WP_011677119.1\|2010099_2010429_-\|hypothetical-protein	gnl\|CDD\|227933	COG5646, COG5646, Uncharacterized conserved protein [Function unknown].	1.81818e-27
NZ_CP015894.1\|WP_015082898.1\|2007829_2008786_-\|hypothetical-protein	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	3.4174e-51

>NZ_CP015894.1|WP_015082897.1|2003081_2006186_-|DNA/RNA-helicase-SWF/SNF-family
MSRMMPARVRSEGIALYAKGFLNDPIETDLKLTAEIDGEEVSYDLDGAQDSCTCSIFQQNHRYCKHIAAIEEYLKNQDKGSLETKDKETKGAERGLYNENIAFLDAVNGETQLNFSTDQYSIEVQIEDNSQLYDYFSMDYFLYFDLKLKSKNLGRSYVIKDIPYFLRALKNYSQYSLGSLHYIDLFFDNFDEASQEFLSFLLKIDGKSDEALTKSLYIKNGRYLNIPFLFLEEAMDLVSALEVYQLKIIGRTVNYFTFIPLDNDSEIFKFKVESQQDYIELSLFSEDYHNFYDYSLLYDNNVFYKLSQEQRRLLLVLDKQFAQKSKIKFSYSEKDKLAQALQQLSTLGKIEAPEHFVVKPFDAKFTFDLLDEKTLSLAMKFDYGTFSIDSFHDLETLEFSRDLRKEQKIFALMERLQFAKAFNSTLEITEHLSENFFLKILPSFQKLGQIELSPTLRNMRMDEVPEIHIDSQGGLLDISFNIPHVEDGEFANVIAKLQENAEFYISESGKFYHFNEKFDRLKAALHELDDQFVIQGSSLHVNINRSFQISKIFEKISGASFSEKFKSLYQHLTHPEEFPYEKPEHIKASLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFILSNLKKDESVLITAPASLTYNWASEFEKFTDEIDFVVIDGNKADRTKEIQENHQIYITSYGSFLKDFEDYQDKKLNYLLLDEAQVVKNYSSKTNKSLSALNVEHTFALSGTPLENRIEEIWAIFQVVMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIYLAQLELMQKQVLEMDNAALSRSRIEILAGITRLRQICNTPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFSQFTKVFPHIEKLMEEQEMTAYKLTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLTSADVVILVDLWWNPAVEEQAIARAHRMGQKNTVEVIRLITQGTIEEKIMEIQERKKDLIANVLEGDTVDKVLSEAEIREILGV
>NZ_CP015894.1|WP_041931833.1|2002265_2002865_-|hypothetical-protein
MVERRVVFPVIGDDEVLQKDTRVIFTNQQLLTRNPSLQDEASIETSKSKTDAKRPESFKPYKAKTSFSTQHRPLNSNHAGVSSYDKMPKKTSVDESKERAKRAAATLPKPPKQYVSPLERDKEDLTVRRSTSAILNKRPSTNDNPIRVMKKQGMNVSDAVAKNGSGMKKATPHGGAANDTQKGSYFENKRKNIFDRGIV
>NZ_CP015894.1|WP_015082895.1|2000733_2002065_-|UDP-N-acetylmuramate--L-alanine-ligase
MEKTYHFTGIKGSGMSALALMLHQMGKNVQGSDSTDYFFTQRGLEQVGVPLLPFDEKNIKPEFELIVGNAFRDDNNVEIAFAHKKGFPFKRYHEFLGHFMEDFTSIGVAGAHGKTSTTGMLAHVMSNIVDTSYLIGDGTGRGNAGSEYFVFESDEYERHFMPYHPEYTIMTNIDFDHPDYFEGIEDVTSAFQDYANNIKKGIFAYGEDVNLRKLSAKAPIYYYGFEANDDYRAENLIRSTRGSSFDAYFRGEKIGHFVVPTYGKHNVLNALSVVAVCHNLGLDMTDVADHLLTFRGVKRRFTEKKVGETVIIDDFAHHPTEIEATLDAARQKYPDREIVAVFQPHTFTRTIAFADEFAEVLDHADTVYLAQIYGSAREVDHHEITAQDLADKVRKPAKVIELDNVSPLLDHDRGVYVFMGAGNIQKYEIAFEKLLSQTSTNLQ
>NZ_CP015894.1|WP_015082894.1|2000115_2000574_+|arginine-repressor
MKRDKRLEIIKEIVTNNKISTQEELQSLLLERGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNSKINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDIRTDILGTIAGADTLLVICASEKAANILTAEIKYILLG
>NZ_CP015894.1|WP_011677109.1|1998353_2000048_-|arginine--tRNA-ligase
MDEKQLVSQALSAAIDGVLGVEQIAAIIEKPKSSDLGDLAFPAFQLAKTLRKSPQIIAGEIAEKIDTKGFEKVIAVGPYVNFFLDKNATASEVIREVLTEGEHYGDANIGEGGNVPIDMSAPNIAKPFSIGHLRSTVIGDSIAKIYEKLGYQPIKINHLGDWGKQFGLLITAYKKYGDEATITANPIDELLKLYVKINAEAKEDPEVDEEGRQWFLKMEQGDEEALRIWKWFSDVSLIEFNRIYGKLGVTFDHFMGESFYSDKMDAIVEDLENKNLLHESKGALIVDLEKYNLNPALIKKTDGATLYITRDLATAAYRKKTFNFVKSLYVVGGEQTNHFKQLKAVLKEAGYDWSDDMVHVPFGMVTQGGKKFSTRKGHVVKLEMALDEAVDRAEKQIEAKNPNLENKEEVAKQVGVGAVKFYDLKTDRNNGYDFDLDEMVSFEGETGPYVQYAHARIQSILRKANRKVNIDNISLVVSDAEAWEIVKALKEFPNIVKRAADNYEPSIIAKYAISLAQAFNKYYAHVRILEDDAQLDGRLALISATSIVLKEALRLLGVAAPENM
>NZ_CP015894.1|WP_015082893.1|1995814_1997047_-|arginine-deiminase
MNNGINVNSEIGKLKSVLLHRPGAEVENITSDTMKQLLFDDIPYLKIAQKEHDFFAQTLRDNGAETVYIENLATEVFEKSSETKEEFLSHLLHEAGYRPGRTYDGLTEYLTSMPTKDMVEKVYAGVRKNELDIKRTALSDMAGSDAENYFYLNPLPNAYFTRDPQASMGVGMTINKMTFPARQPESLITEYVMANHPRFKDTPIWRDRNHTTRIEGGDELILNKTTVAIGVSERTSSKTIQNLAKELFANPLSTFDTVLAVEIPHNHAMMHLDTVFTMINHDQFTVFPGIMDGAGNINVFILRPGQDGEVEIEHLTDLKAALKKVLNLSELDLIECGAGDPIAAPREQWNDGSNTLAIAPGEIVTYDRNYVTVELLKEHGIKVHEILSSELGRGRGGARCMSQPLWREDL
>NZ_CP015894.1|WP_015082892.1|1994584_1995649_-|ornithine-carbamoyltransferase
MTSPLITKAEVNSVFQGRSLLAEKDFTPDEINYLVDFGLHLKALKQQNIPHHYLEGKNIALLFAKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGIKESTEDTARVLGSMFDAIERRGFSQKEVEDLAKYSGVPVWNGLTDDWHPTQMIADFMTVKENFGYLKGLTLVYVGDGRNNMANSLIVTGSMLGVNVHIVAPDSLHPSKEVMDIANKFAEKSGAKPLATSNIEEGVKGANIIYSDVWVSMGESNWEERVKLLTPYRITMDMLKMTGNADNGKLIFMHCLPSFHDTETEYGKEIKEKYGLTEMEVTDEVFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPAVPEDFK
>NZ_CP015894.1|WP_015082890.1|1991910_1992855_-|carbamate-kinase
MVSRIVVALGGNAILTKDPSAAAQKKALEVTAEQLMPLIKDNDRQMVVTHGNGPQVGNLLLQQLGSDSEKNPAMPLDTVGAMTQGEIGFWTVQAFTRAMANNGLERYPVISAVTQTLVDENDPAFKNASKPIGPFYTEEQLPEIKKQFPDWELMEDAGRGYRRVVPSPKPLEIIEAKAFGPILESGSLLIASGGGGIPVIKDGNGYKGVEAVIDKDFSAAKLAEMVGADELLILTAVDNVFVNFNKPNQKKLETVTMAEMKAYIKEGQFAAGSMLPKVEAAMEFVTRTGRPATITSLENLEDFLNNDSGTKIIP
>NZ_CP015894.1|WP_015082889.1|1988833_1990327_-|amino-acid-permease
MENKKTKGISLFALLAIIISGAIGGGVFNLANDLARGSTPGGVVISWLFIGFGILMLVLSFNRLITIKPDLSGVSDYARAGFGDFVGFLSGWGYWISAWTGTIGFAVLMMTSADYFFPGKFANSNGSLTILSVIIVSIISWILMLLVDRGVETAAAVNAIVMIAKLIPLVVFSITGIILFKANIFTQHFWQTFTTNFAADGSVKDFVWHAMTASGLLSQIKGSLLVMVWVFVGIEGAAMMGNRAKKKSDTAKATVIGLAVLLVIYVLLSLLPYGYMDQASLANVKAPGLVYILNEMVGGWGGSLMAVGLMISLLGAWLSWTMLPVEATQQLAEQKLLPSWFGKLNKYHAPSNSLLITQLMIQIFIIITYFVANAYNVFIYMATAVIMICYALVGAYLFKIGLKEASVKNILIGFFTFAFQALALYLSGWQYVWLAMILYTIGFLLFIGAKKESHQSISVKEWLGMIVVTVLGVLAIVVLICGAKAGTGFDLRGLLGF
>NZ_CP015894.1|WP_011677102.1|1988266_1988758_-|prolyl-tRNA-editing-protein
MRTFAEVEKLLTELSIPYKIVEHPASHSTEESDNYIKDYEGCRSKTLILANKKSTQFYMIIMDDAKQVDMNRLSEILEVKRLHFISEDRLEEMLGLNSGIVSLFGLVGTNYENMNIYFDQQMLDDYQIQTFHPNDNTKTIFFKMEACFTILKSQGYDYQIIDL
>NZ_CP015894.1|WP_003137511.1|2007145_2007406_+|IS3-family-transposase
MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYSKSNESSVSKADFLELKRQLAKVKEERDILKKVLTIFAEKKK
>NZ_CP015894.1|WP_015082898.1|2007829_2008786_-|hypothetical-protein
MKNQQEFLAMIEDYLERDVFPGVNFAILEGEEVSEYLFGKAALIPEPIALTPGKKWDLASLTKVIGTGTAVIDLVLAGKLELDAPLQKYYAKFTDSTVSLRQLLTHTSGIDPYIPNRDKLGFFELTEAINQIRVTDDKSFKYTDINFILLGFLLEEYYDESLDYIFNKNIFKNWEMKQTSFGSVENAVPTSQNIPLGTVHDPKAQVLKNHCGSAGLFSTLSDMILFSQAYFREEKYLELLKNYADGAKERSLAWDLPAENNDWLLHTGYTGTFILINPRIKKAVVFLSNRVHLKDNREKWIEERDRLIKFLINHLSLD
>NZ_CP015894.1|WP_015082899.1|2008858_2009638_-|hypothetical-protein
MSEIINHITAFQPVYRVLHREENLDFYRGVLGFKVLVEEGAMVWLGGHEAKKDRFQLEESPGFHPVEGLKKHGQTVIKANSSEIEQLIVRNLDKIAKIYQGKNGLAFTALSPEAGLFLVSSDSLTDLPALTEINKSEIKLNLDKNFKGLSDFEITAMNLNVADKSIIEFYESVFDLKAIDGKIEFPFVTLTLNVEESEDLTAGTDEVLDLEFLIFMIDKDFDLKAFANQFSEANGTYIDASAKTFFLEVPDHAELWFVK
>NZ_CP015894.1|WP_011677119.1|2010099_2010429_-|hypothetical-protein
MEFEEFFINNQLMKLIRETVLSIFPEAQERISYGMPAWFNGKTVLIYAQPQKHHLGIYPRPNFIEKHLEVLKQQYECSKGTIKVPYGIEHGELRKLVSDVINWNLTHFT
>NZ_CP015894.1|WP_011677121.1|2011339_2012122_+|CPBP-family-intramembrane-metalloprotease
MNIEKLQFLAKYRWIIVLILALIFSGLSVSIFHLPFLMTALVLSVIGLIFAYHKSVWLVLFILSNLPMLVSTIFASQHHFSTLDTIIFFIIFIFTIISSYLIARKAELIPKLSWKYFPPLRIILGFVLLFLVSILTGIFAQIFNQSPTTTNQESLNELQKVIPIAVFATQTLAASFLEELVYRVGIFELIFKNQKYFAFLTTMLLFAFMHGPTDVYSWLTYGLMSLVLTGLYAKYRNFYLNMSVHFLWNLFGLVIALMVK
>NZ_CP015894.1|WP_081172510.1|2012157_2013027_-|aquaporin-family-protein
MDVTWTVKYITEFVGTALLIIMGNGAVANVELKGTKAHAQSWLIIGWGYGLGVMLPAVAFGNITSQINPAFTLGLAASGLFPWAHVAQYIIAQVLGAMFGQLLIVMVYRPYYLKTQNPNAILGTFSTIDNVDDNSEKTRLGATINGFLNEFLGSFVLFFGAVAATNIFFGSQSITWMTNYLKGQGADVSSSDVMNQIWVQASGASASKMIAHLFLGFLVLGLVVALGGPTGPGLNPARDFGPRLVHSLLPKSVLGEAKGSSKWWYAWVPVLAPILASLAAVALFKMIYL
>NZ_CP015894.1|WP_015082901.1|2013198_2015490_+|Xaa-Pro-dipeptidyl-peptidase
MRFNHFSIVDKNFDEQLAELDQLGFRWSVFWDEKKILKDFLIQSPSDMTDLQATAELDVIEFLKSSIELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAEMTTENIISAFYYLLCTRRKNGMILVEHWVSEGLLPLDNHYHFFNDKSLATFDSSLLEREVLWVESPVDSEQRGENDLIKIQIIRPKSTEKLPVVMTASPYHLGINDKANDLALHDMNVELEEKTSHEIHVEQKLPQKLSAKAKELPIVDKAPYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVIDWLNGRARAYTSRKKTHEIKASWANGKVAMTGKSYLGTMAYGAATTGVEGLEVILAEAGISSWYNYYRENGLVRSPGGFPGEDLDVLAALTYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQDWNVTPEQAYNFWKALPEGHAKHAFLHRGAHIYMNSWQSIDFSETINAYFVAKLLDRDLNLNLPPVILQENSKDQVWTMMNDFGANTQIKLPLGKTAVSFAQFDNHYDDETFKKYSKDFNVFKKDLFENKANEAVIDLELPSMLTINGPVELELRLKLNDTKGFLSAQILDFGQKKRLEDKARVKDFKVLDRGRNFMLDDLVELSLVESPYQLITKGFTNLQNQNLLTVSDLKADEWFTIKFELQPTIYHLEKADKLRVILYSTDFEHTVRDNRKVTYEIDLSQSKLIIPIESVKN
>NZ_CP015894.1|WP_081213195.1|2015496_2016201_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MIGILGTPYNTVERSPFWWNKVSYTRQSFIDVFQELGHTVIVLPVDKTENIKNYLPLVDKIVLTGGADVSPYLYGEEPHAQLGTTDPIRDRFELAAIKAALEANKPILGVCRGLQLLNVYFGGTLYQDLSLTSSQIKHLQSPTPQEVPTHHISVEKESSLGFLPENYMVNSFHHQVIKDLGQGLQAIAHGNDGLVEAIENKEKHVLAVQWHPECTWETENFDKKIFEIFANGDI
>NZ_CP015894.1|WP_011677124.1|2016350_2017193_+|amino-acid-ABC-transporter-substrate-binding-protein
MKKIKLLTLATLGIASIGLLAACSSKDNSSSKSTDKVTTVTVATSAASVPYEYSENGKMTGFEYDILKAADKDMKDYKFEFKVYEDSAILAALDGGRAQIAANNFGKTKARSEKYLFSYPVRQGIDAIFSTSKENITKISQLAGKTTEIPAGTNYGDMFESWNKNHPDKKIDVKYSQRPLADRLSAIASGQIDFLFASKAPAENLIRQHAITGLVDTVPTDLNKQSEFKTYDYFILDNSQTKLQKDLNAELKKLYENGTLKELSEKYFHDSHIPAADQFK
>NZ_CP015894.1|WP_015082903.1|2017281_2018604_-|pyridine-nucleotide-disulfide-oxidoreductase
METRHFKNIIIGFGKAGRALAKSLSKNGEEALIIERDQAMYGGTCPNVGCAPSKTLIVAGQKNMNFSEAMTTKYKVREILHNAAYHGAADEALVYVMDGLARFINSKTVEVVNGENVTQVIGERIFINTGATPIIPEIEGIHEAKNVVTSEGAMELSELPKKLVIIGAGYIGLEFAGMFNKFGSEVTILEPHATFLPKEDEDISNEIYKDLVAAGVEIQLGVEIERITDSEVFAGGKIYPADKILIATGRRPNIKDLDLEKADVELSENGYIKVDDDLKTTAQNIWALGDVRGGGQFYYLSTDDFRIVNNQLFGDHSRKLSDRKLVPYSVFISPTLSRIGLDEKQAKEAGVNYRLFKMAAAPIVKAKVVQDTRGLLKALVDPNTDEILGATLYHEDSHEVINLVSLAMKMHTPYQVLRDQIFTHPTMGEGLNDLFQNEVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20731 : 83480

Bacillus_phage(20.0%)

transposase,tRNA,protease,integrase

attL 64110:64128|attR 82569:82587

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015081823.1\|20731_22000_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_011675094.1\|21980_22532_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.4e-09	29.7
WP_015081824.1\|22737_24828_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	1.6e-106	49.2
WP_041931722.1\|25895_27719_+	PTS mannitol transporter subunit IIB	NA	NA	NA	NA
WP_015082454.1\|29712_30471_-\|transposase	transposase	A0A059NT77	Lactococcus_phage	4.5e-136	99.6
WP_015081829.1\|31918_32350_+	PTS mannitol IIA component	NA	NA	NA	NA
WP_015081830.1\|32498_33665_+	mannitol-1-phosphate 5-dehydrogenase	NA	NA	NA	NA
WP_021165766.1\|33770_33995_+	hypothetical protein	NA	NA	NA	NA
WP_011675101.1\|34083_34353_-	hypothetical protein	NA	NA	NA	NA
WP_011675109.1\|34477_34720_+	NINE protein	NA	NA	NA	NA
WP_014571770.1\|34813_36436_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_011675112.1\|36645_37167_+	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	1.0e-30	42.1
WP_015081831.1\|37628_38804_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_015081832.1\|38901_39657_+	DNA repair protein RecO	NA	NA	NA	NA
WP_010905074.1\|39808_41227_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.0e-40	27.0
WP_015081833.1\|41445_43032_-	pyruvate dehydrogenase complex E2 component	NA	NA	NA	NA
WP_011834176.1\|43024_44005_-	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_011675118.1\|44007_45132_-	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
WP_011675119.1\|45220_46222_-	lipoate--protein ligase A	NA	NA	NA	NA
WP_015081834.1\|46414_47269_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	7.8e-12	31.4
WP_015081835.1\|47347_47998_-	HD domain-containing protein	A0A1S5XYU7	Kurlavirus	1.2e-15	33.3
WP_015081836.1\|48047_48374_-	hypothetical protein	NA	NA	NA	NA
WP_015081837.1\|48430_49321_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011834182.1\|49473_50499_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_015081838.1\|50997_51435_+	OsmC family peroxiredoxin	NA	NA	NA	NA
WP_015081839.1\|51596_52910_+	APC family permease	NA	NA	NA	NA
WP_015081840.1\|52988_53984_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_015081841.1\|54086_54899_-	HAD family hydrolase	NA	NA	NA	NA
WP_011675129.1\|55426_57064_-	ABC-F family ATPase	A0A2K9L3Z8	Tupanvirus	4.8e-50	25.9
WP_011675130.1\|57564_57819_+	hypothetical protein	NA	NA	NA	NA
WP_015081842.1\|57937_58762_-	KR domain-containing protein	NA	NA	NA	NA
WP_011675132.1\|58921_59503_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_041931846.1\|59690_60173_-	hypothetical protein	NA	NA	NA	NA
WP_015081844.1\|60429_61710_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A2I2L687	Orpheovirus	2.5e-09	26.5
WP_011675135.1\|61962_62796_-	KR domain-containing protein	NA	NA	NA	NA
WP_015081863.1\|63144_64035_-\|transposase	IS982 family transposase	NA	NA	NA	NA
64110:64128	attL	NA	NA	NA	NA
WP_015081846.1\|64940_66203_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	1.6e-53	34.5
WP_015081847.1\|66285_66546_-	hypothetical protein	NA	NA	NA	NA
WP_015081848.1\|66538_67141_-	Plasmid replication protein repB	NA	NA	NA	NA
WP_015081849.1\|67291_67900_-	hypothetical protein	NA	NA	NA	NA
WP_015081850.1\|67896_68973_-	cell division protein FtsK	NA	NA	NA	NA
WP_015081851.1\|68972_69293_-	hypothetical protein	NA	NA	NA	NA
WP_015081852.1\|69442_69874_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_015081853.1\|69989_71462_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_080600815.1\|71458_71809_+	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_015081855.1\|71774_72395_+	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_041931724.1\|72412_73582_-	restriction endonuclease subunit M	Q6DMX0	Streptococcus_phage	1.1e-152	70.2
WP_015081857.1\|73746_74562_-	type-2 restriction enzyme ScrFI	NA	NA	NA	NA
WP_015081858.1\|74580_75663_-	DNA cytosine methyltransferase	A0A0E3DF50	Bacillus_phage	7.0e-50	36.3
WP_041931725.1\|75666_76134_-	hypothetical protein	NA	NA	NA	NA
WP_003132258.1\|76331_76481_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_010905107.1\|76510_76684_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_015081860.1\|77045_78827_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.7e-64	29.6
WP_015081861.1\|79870_80656_-	chromosome partitioning protein ParA	NA	NA	NA	NA
WP_015081862.1\|80710_81970_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	2.5e-91	45.3
WP_011675147.1\|82013_82502_-	N-acetyltransferase	A0A1B2ICF0	Erwinia_phage	1.1e-05	50.9
WP_015081863.1\|82589_83480_-\|transposase	IS982 family transposase	NA	NA	NA	NA
82569:82587	attR	NA	NA	NA	NA

DBSCAN-SWA_2

410607 : 422764

uncultured_virus(30.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675460.1\|410607_410925_+	thioredoxin	A0A0K2FIM3	Achromobacter_phage	9.0e-06	31.9
WP_015082041.1\|411030_411657_+	DUF4479 domain-containing protein	NA	NA	NA	NA
WP_015082042.1\|411818_413159_+	NADH oxidase (H(2)O-forming)	NA	NA	NA	NA
WP_015082043.1\|413249_413639_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	1.3e-22	48.6
WP_011675464.1\|413757_414042_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.3e-13	43.0
WP_011675465.1\|414128_415757_+	molecular chaperone GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_011675466.1\|415808_416621_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	1.5e-33	38.1
WP_021165900.1\|416589_416799_+	hypothetical protein	NA	NA	NA	NA
WP_011675468.1\|416810_418238_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	3.9e-32	32.9
WP_003131580.1\|418230_418932_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_015082045.1\|419109_419745_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.6e-73	66.0
WP_011675470.1\|419877_420738_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.1e-64	44.8
WP_015082046.1\|420787_421570_+	phosphorelay inhibitor	NA	NA	NA	NA
WP_011675472.1\|421562_421889_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_041931741.1\|421888_422764_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.4e-101	66.3

DBSCAN-SWA_3

602210 : 665092

Bacillus_phage(18.75%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082137.1\|602210_603101_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_041931749.1\|603144_603876_+	hypothetical protein	NA	NA	NA	NA
WP_011675755.1\|603907_604183_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_011675756.1\|604285_604462_+	hypothetical protein	NA	NA	NA	NA
WP_011834603.1\|604594_605527_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_015082139.1\|605588_606374_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_011675759.1\|606540_606960_+	DUF948 domain-containing protein	NA	NA	NA	NA
WP_015082140.1\|606989_607550_+	YtxH domain-containing protein	NA	NA	NA	NA
WP_015082141.1\|607683_609102_+	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	E3SJC4	Synechococcus_phage	8.4e-35	33.0
WP_041931750.1\|609283_611305_+	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	4.2e-64	33.9
WP_015082143.1\|611519_613535_+	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	3.8e-57	31.6
WP_080600823.1\|613587_613758_-	DUF3042 domain-containing protein	NA	NA	NA	NA
WP_011675765.1\|613952_614618_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.3e-19	29.8
WP_011675766.1\|614749_615634_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_015082144.1\|615779_616448_+	hypothetical protein	NA	NA	NA	NA
WP_075070707.1\|616618_617515_+	SPFH domain-containing protein	A0A1V0SL90	Klosneuvirus	1.8e-35	35.2
WP_080600854.1\|617763_618408_-	glycoside hydrolase, family 25	A0A1P8BMN5	Lactococcus_phage	2.4e-13	56.9
WP_015082146.1\|618887_619235_-	XRE family transcriptional regulator	A0A182BQC8	Lactococcus_phage	2.0e-43	74.6
WP_015082147.1\|619999_620923_+	ribonuclease Z	NA	NA	NA	NA
WP_011675772.1\|620915_621617_+	oxidoreductase	NA	NA	NA	NA
WP_015082148.1\|621789_624018_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	6.7e-79	30.9
WP_011834623.1\|624141_624654_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.3e-32	44.0
WP_015082149.1\|624869_625433_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_015082150.1\|625568_627209_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_014573028.1\|627269_627740_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_011834627.1\|630570_631026_+	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_015082152.1\|631015_633466_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	2.2e-123	34.0
WP_015082153.1\|633600_634158_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_010905473.1\|634345_635647_+	enolase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
WP_014573010.1\|635750_636422_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-29	36.8
WP_015082154.1\|636423_637497_-	ABC transporter permease	NA	NA	NA	NA
WP_014573008.1\|637508_638078_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015082155.1\|638264_639788_-	long-chain acyl-CoA synthetase	NA	NA	NA	NA
WP_080600855.1\|640035_640899_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_015082157.1\|641158_643522_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.6e-107	31.8
WP_011675632.1\|643650_644310_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_021036849.1\|644312_645530_+	MFS transporter	NA	NA	NA	NA
WP_003129585.1\|645526_645673_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_041931753.1\|646050_647313_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_014573002.1\|647417_650831_+	pyruvate carboxylase	NA	NA	NA	NA
WP_015082159.1\|652278_654825_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_015082160.1\|654844_656083_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_011834647.1\|656122_656722_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	7.1e-52	52.6
WP_075070705.1\|656940_657447_+	hypothetical protein	NA	NA	NA	NA
WP_003129597.1\|657616_658015_+	arsenate reductase	NA	NA	NA	NA
WP_080513983.1\|658396_659365_-	ABC transporter permease	NA	NA	NA	NA
WP_015082163.1\|662625_662859_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	2.1e-07	35.1
WP_010905103.1\|662896_663736_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	9.3e-50	41.4
WP_081172393.1\|664201_665092_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

788767 : 914694

106

Bacillus_phage(19.23%)

transposase,tRNA,integrase

attL 895338:895354|attR 920335:920351

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082226.1\|788767_790768_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	4.9e-89	36.3
WP_011675925.1\|791344_791584_+	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_011675926.1\|791605_792337_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_011675928.1\|792742_793252_+	queuosine transporter QueT	E7DN70	Pneumococcus_phage	2.0e-10	33.1
WP_004234939.1\|794095_794386_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_010905146.1\|794481_795243_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.3e-44	42.6
WP_015082229.1\|798109_799132_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_015082230.1\|799143_800331_+	bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ	NA	NA	NA	NA
WP_015082231.1\|800348_801482_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	3.1e-24	28.0
WP_015082232.1\|801478_802330_+	acetylglutamate kinase	NA	NA	NA	NA
WP_081172400.1\|802368_803370_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_011675937.1\|803393_803966_+	hypothetical protein	NA	NA	NA	NA
WP_015082234.1\|804144_804840_+	ribonuclease 3	M4QMG4	Micromonas_pusilla_virus	3.4e-21	32.6
WP_015082235.1\|804829_808354_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_041931762.1\|808596_810765_+	LTA synthase family protein	W6LM83	Streptococcus_phage	1.0e-140	43.2
WP_041931763.1\|810859_811270_+	hypothetical protein	NA	NA	NA	NA
WP_051013164.1\|811362_812481_+	hypothetical protein	NA	NA	NA	NA
WP_015082239.1\|812477_813239_+	hypothetical protein	NA	NA	NA	NA
WP_041931876.1\|814156_814966_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011675947.1\|814975_815527_+	hypothetical protein	NA	NA	NA	NA
WP_015082242.1\|815588_816983_+	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	1.9e-15	36.3
WP_014572881.1\|817163_818138_+	ribose-phosphate pyrophosphokinase 1	A0A2K9L2G2	Tupanvirus	2.2e-42	36.6
WP_015082243.1\|818261_818933_+	hypothetical protein	NA	NA	NA	NA
WP_011675950.1\|819003_821493_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	65.1
WP_015082244.1\|822890_824309_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_015082245.1\|824420_825734_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_011675953.1\|825880_826684_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_015082247.1\|826820_827183_+	hypothetical protein	NA	NA	NA	NA
WP_004234939.1\|827297_827588_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_010905146.1\|827683_828445_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.3e-44	42.6
WP_011675781.1\|828605_829865_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_015082248.1\|830005_832012_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_081172402.1\|832124_832796_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit beta	NA	NA	NA	NA
WP_011675784.1\|832815_833679_+	L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha	NA	NA	NA	NA
WP_011835521.1\|833799_834255_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_011675786.1\|834273_834474_+	copper chaperone	NA	NA	NA	NA
WP_011675787.1\|834660_836823_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.3e-99	36.0
WP_015082250.1\|837024_839676_-	ABC transporter permease	NA	NA	NA	NA
WP_011675790.1\|839746_840532_-	DUF4931 domain-containing protein	NA	NA	NA	NA
WP_031286465.1\|840846_841977_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_015082251.1\|842230_843457_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_015082252.1\|843651_845103_+	hypothetical protein	NA	NA	NA	NA
WP_015082253.1\|845221_845890_+	DNA-binding response regulator	Q6XLV6	Feldmannia_irregularis_virus	5.0e-06	31.2
WP_014572868.1\|846038_847187_+	sensor histidine kinase	W8CYF6	Bacillus_phage	5.8e-18	26.4
WP_015082254.1\|847325_848042_+	uridine phosphorylase	NA	NA	NA	NA
WP_015082255.1\|848059_848773_+	nicotinamide mononucleotide transporter	A0A1S6UAV8	Serratia_phage	5.5e-11	23.6
WP_015082256.1\|848868_850878_+	excinuclease ABC subunit C	NA	NA	NA	NA
WP_015082257.1\|850975_852136_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_011675799.1\|853111_853447_+	XRE family transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	7.8e-08	48.4
WP_015082259.1\|853557_855927_+	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_051013166.1\|856971_857526_+	hypothetical protein	NA	NA	NA	NA
WP_015082260.1\|857598_858489_+\|transposase	IS4/IS5 family transposase	NA	NA	NA	NA
WP_021212525.1\|858554_858992_+	hypothetical protein	NA	NA	NA	NA
WP_041931764.1\|859075_859336_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	6.5e-10	40.0
WP_041931765.1\|859349_860177_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.7e-49	41.4
WP_015082262.1\|860228_861053_-	putative glycosyltransferase	NA	NA	NA	NA
WP_015082263.1\|861358_862777_+	dipeptidase PepV	NA	NA	NA	NA
WP_011675803.1\|862905_863265_+	holo-ACP synthase	NA	NA	NA	NA
WP_011675804.1\|863308_864412_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.3e-30	28.1
WP_011675805.1\|864572_865001_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_015082264.1\|865139_866447_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011675807.1\|866575_867493_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.0e-22	30.1
WP_015082265.1\|867489_868992_+	glycine/betaine ABC transporter permease	NA	NA	NA	NA
WP_015082266.1\|869253_871788_+	hypothetical protein	NA	NA	NA	NA
WP_081213176.1\|871774_872314_+	hypothetical protein	NA	NA	NA	NA
WP_041931766.1\|872323_872701_+	hypothetical protein	NA	NA	NA	NA
WP_015082268.1\|872716_873295_+	hypothetical protein	NA	NA	NA	NA
WP_015082269.1\|873276_874167_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011675815.1\|876556_877444_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-39	39.0
WP_031286477.1\|877614_878868_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.2e-45	32.3
WP_011675817.1\|878870_879110_+	exodeoxyribonuclease 7 small subunit	NA	NA	NA	NA
WP_015082270.1\|879336_880227_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011675819.1\|880285_881431_+	glycerate kinase	W6LM47	Streptococcus_phage	4.5e-47	38.8
WP_015082271.1\|881655_882513_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_015082272.1\|882513_883014_+	N-acetyltransferase	NA	NA	NA	NA
WP_014572851.1\|883089_883896_+	TlyA family rRNA (cytidine-2'-O)-methyltransferase	NA	NA	NA	NA
WP_011675823.1\|883892_884339_+	transcriptional regulator	NA	NA	NA	NA
WP_015082273.1\|884518_886186_+	DNA repair protein RecN	NA	NA	NA	NA
WP_015082274.1\|886885_887452_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011835491.1\|887546_888068_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_011835489.1\|889246_890200_+	16S rRNA methyltransferase	NA	NA	NA	NA
WP_015082275.1\|890355_890736_+	Cell division protein FtsL, DivIC superfamily	NA	NA	NA	NA
WP_015082276.1\|890732_893030_+	PASTA domain-containing protein	NA	NA	NA	NA
WP_015082277.1\|893104_894094_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_011675833.1\|894292_894577_+	hypothetical protein	NA	NA	NA	NA
895338:895354	attL	NA	NA	NA	NA
WP_011835483.1\|896352_897015_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-21	32.7
WP_041931767.1\|897374_898262_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_015082279.1\|898520_899411_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011675837.1\|899497_900172_+	(p)ppGpp synthetase	NA	NA	NA	NA
WP_011675838.1\|900331_900676_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_011675840.1\|901605_902067_-	N-acetyltransferase	NA	NA	NA	NA
WP_081172525.1\|902589_902832_+	hypothetical protein	NA	NA	NA	NA
WP_015082281.1\|902824_904153_+	glycosyltransferase family 2 cellulose synthase (CESA) superfamily	NA	NA	NA	NA
WP_011835479.1\|904383_904941_+	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_015082283.1\|905003_905249_-	hypothetical protein	NA	NA	NA	NA
WP_041931768.1\|905521_906247_+	nicotinamide mononucleotide transporter	A0A2P0ZKW0	Lactobacillus_phage	1.1e-14	28.7
WP_014572836.1\|906799_907225_+	universal stress protein	NA	NA	NA	NA
WP_081213177.1\|907392_907755_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_011675849.1\|907816_908350_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_080600829.1\|908508_909021_+	DUF3533 domain-containing protein	NA	NA	NA	NA
WP_015082286.1\|909021_909912_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_041931770.1\|910046_911918_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_003131392.1\|912106_912439_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_015082287.1\|912574_913549_+\|integrase	integrase	A0A142F1N9	Bacillus_phage	1.9e-30	28.3
WP_041931880.1\|913736_914075_-	hypothetical protein	NA	NA	NA	NA
WP_003137511.1\|914433_914694_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6
920335:920351	attR	NA	NA	NA	NA

DBSCAN-SWA_5

946144 : 994952

Bacillus_phage(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082304.1\|946144_946405_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	6.5e-10	40.0
WP_041931775.1\|946432_949519_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_015082306.1\|949619_950510_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082307.1\|950748_951864_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_031286330.1\|951957_952794_+	LytR family transcriptional regulator	NA	NA	NA	NA
WP_011675881.1\|952980_954216_+	phosphopentomutase	NA	NA	NA	NA
WP_015082308.1\|954273_954543_+	hypothetical protein	NA	NA	NA	NA
WP_011675883.1\|954613_955318_+	purine-nucleoside phosphorylase	NA	NA	NA	NA
WP_011675884.1\|956573_957020_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_015082309.1\|957103_957430_+	hypothetical protein	NA	NA	NA	NA
WP_011675886.1\|957590_959258_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_041931776.1\|959366_959960_+	hydrolase	A0A1V0DZX6	Clostridioides_phage	2.4e-15	43.5
WP_015082310.1\|959985_960876_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082311.1\|961111_961960_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011675889.1\|962228_963116_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_011675890.1\|963127_963880_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-28	39.2
WP_075070694.1\|963884_964109_+	DUF4059 domain-containing protein	NA	NA	NA	NA
WP_014572788.1\|964306_965233_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.0e-85	51.1
WP_011675893.1\|965373_965622_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_041931884.1\|965863_968317_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.3e-104	44.2
WP_041168338.1\|968335_968923_+	isochorismatase	NA	NA	NA	NA
WP_015082314.1\|969000_970017_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_015082315.1\|969998_970889_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082316.1\|971090_972032_-	prenyltransferase	NA	NA	NA	NA
WP_015081738.1\|972146_972827_-\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-108	84.1
WP_011675898.1\|973001_973265_+	ACT domain-containing protein	NA	NA	NA	NA
WP_011675899.1\|973381_974719_+	PFL family protein	NA	NA	NA	NA
WP_015082317.1\|974814_975294_+	hypothetical protein	NA	NA	NA	NA
WP_011675901.1\|975364_976060_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_011675902.1\|976056_976803_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_011675903.1\|976817_977222_+	hypothetical protein	NA	NA	NA	NA
WP_011675904.1\|977382_978426_+	HrcA family transcriptional regulator	NA	NA	NA	NA
WP_014572780.1\|978455_978995_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_015082318.1\|979066_980890_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.4e-129	45.8
WP_015082319.1\|981052_982897_+	hypothetical protein	NA	NA	NA	NA
WP_015082320.1\|983066_984830_+	oleate hydratase	NA	NA	NA	NA
WP_015082321.1\|984896_986036_+	amidohydrolase	NA	NA	NA	NA
WP_011675960.1\|986157_986859_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_015082322.1\|986941_987859_+	1-phosphofructokinase	NA	NA	NA	NA
WP_015082323.1\|987858_989763_+	PTS fructose IIABC component	NA	NA	NA	NA
WP_041931777.1\|991311_992637_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_041167445.1\|992633_993017_+	hypothetical protein	NA	NA	NA	NA
WP_015082325.1\|993100_993502_+	hypothetical protein	NA	NA	NA	NA
WP_051013168.1\|993633_993948_+	hypothetical protein	NA	NA	NA	NA
WP_015082326.1\|994061_994952_+\|transposase	IS982-like element IS982B family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1011648 : 1035346

Bacillus_phage(18.75%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082336.1\|1011648_1012341_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	4.2e-32	35.3
WP_015082337.1\|1012333_1013269_+	ABC transporter permease	NA	NA	NA	NA
WP_011675984.1\|1013378_1014356_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	6.0e-117	65.7
WP_081213180.1\|1014739_1016908_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.3e-256	60.7
WP_015082339.1\|1017044_1017467_-	protein NrdI	A0A142F1R4	Bacillus_phage	1.7e-12	36.4
WP_011675987.1\|1017468_1017687_-	NrdH-redoxin	C3U2K9	Lactococcus_phage	5.8e-12	47.6
WP_011675988.1\|1017860_1018502_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_015082340.1\|1018780_1020715_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	4.1e-125	42.9
WP_015082341.1\|1020821_1021358_+	cysteine hydrolase	NA	NA	NA	NA
WP_015082342.1\|1021350_1022184_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	1.5e-20	38.7
WP_041931779.1\|1022781_1025256_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.0e-96	31.9
WP_010890648.1\|1026073_1026754_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5
WP_041931780.1\|1026766_1027003_-	hypothetical protein	NA	NA	NA	NA
WP_015082345.1\|1027494_1028583_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.4e-51	37.8
WP_011675996.1\|1028582_1029230_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.5e-42	44.7
WP_015082346.1\|1029241_1030438_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.4e-109	50.3
WP_014572751.1\|1030464_1030929_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-39	55.3
WP_011669038.1\|1031110_1031371_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	1.1e-09	36.5
WP_081172527.1\|1031382_1032222_+	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	6.0e-49	41.1
WP_080600831.1\|1032254_1033190_-	YafY family transcriptional regulator	NA	NA	NA	NA
WP_014572493.1\|1033255_1033636_+	hypothetical protein	NA	NA	NA	NA
WP_011676002.1\|1033925_1034378_+	signal peptidase II	NA	NA	NA	NA
WP_015082348.1\|1034440_1035346_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	3.5e-10	27.8

DBSCAN-SWA_7

1150476 : 1215660

Lactococcus_phage(23.08%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011676271.1\|1150476_1151712_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	58.6
WP_015082414.1\|1151708_1152296_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_011676273.1\|1152349_1152700_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_011676274.1\|1152779_1153829_+	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	8.7e-37	45.1
WP_015082415.1\|1153825_1154899_+	dihydropteroate synthase	NA	NA	NA	NA
WP_014572580.1\|1154901_1155402_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_015082416.1\|1155417_1156701_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_081172421.1\|1156829_1157468_+	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	5.4e-50	47.9
WP_015082417.1\|1157647_1158934_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_011676280.1\|1158938_1159829_+	homoserine kinase	NA	NA	NA	NA
WP_015082418.1\|1160082_1160682_+	hypothetical protein	NA	NA	NA	NA
WP_015082419.1\|1160724_1161624_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_015082420.1\|1162083_1163364_+	spermidine/putrescine import ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	6.0e-32	38.4
WP_081213182.1\|1163360_1164149_+	ABC transporter permease	NA	NA	NA	NA
WP_021212202.1\|1164150_1164951_+	ABC transporter permease	NA	NA	NA	NA
WP_015082423.1\|1164998_1166066_+	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041931789.1\|1166081_1166267_-	hypothetical protein	NA	NA	NA	NA
WP_015082424.1\|1167274_1168468_-	MFS transporter	NA	NA	NA	NA
WP_015082425.1\|1168764_1169946_+	hypothetical protein	NA	NA	NA	NA
WP_015082426.1\|1169978_1171640_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_015082427.1\|1172581_1172926_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015082428.1\|1173154_1173913_+	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_081172427.1\|1174002_1174893_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021037225.1\|1175105_1175420_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015082430.1\|1176177_1176594_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_011676176.1\|1176958_1177369_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_015082431.1\|1177540_1178398_+	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	2.4e-29	30.4
WP_015082432.1\|1178435_1179326_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081172527.1\|1179743_1180583_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	6.0e-49	41.1
WP_015082433.1\|1180594_1180855_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	2.5e-09	36.5
WP_015082434.1\|1181198_1181903_-	putative N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_011676170.1\|1182924_1184295_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	3.8e-141	56.0
WP_015082435.1\|1184339_1185947_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_015082436.1\|1185948_1186569_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_080600858.1\|1186742_1187807_+	AI-2E family transporter	NA	NA	NA	NA
WP_015082438.1\|1187834_1189091_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_015082439.1\|1189245_1190910_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_015082440.1\|1191016_1192162_-	MFS transporter	NA	NA	NA	NA
WP_014572641.1\|1192269_1192668_+	transcriptional regulator	NA	NA	NA	NA
WP_015082441.1\|1192984_1193875_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676161.1\|1194455_1194788_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015082442.1\|1194992_1196996_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.2e-80	39.6
WP_011676158.1\|1197314_1197794_+	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_021165370.1\|1201052_1201277_+	hypothetical protein	NA	NA	NA	NA
WP_015082445.1\|1201388_1202459_+	histidinol-phosphate transaminase	NA	NA	NA	NA
WP_015082446.1\|1202458_1203415_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_081213183.1\|1204194_1205502_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_015082448.1\|1205502_1206111_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_041931790.1\|1206122_1206893_+	aminoglycoside 3'-phosphotransferase	A0A193CJY5	Infectious_laryngotracheitis_virus	5.6e-09	26.1
WP_015082449.1\|1206937_1207546_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
WP_015082450.1\|1207545_1208286_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_015082451.1\|1208254_1209034_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_011676145.1\|1209030_1209669_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_015082452.1\|1209669_1210455_+	PHP domain-containing protein	NA	NA	NA	NA
WP_011835164.1\|1210487_1211447_-	rhodanese domain-containing protein	NA	NA	NA	NA
WP_015082453.1\|1211869_1213411_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	8.9e-06	36.5
WP_041931791.1\|1213446_1213626_+	hypothetical protein	NA	NA	NA	NA
WP_003331414.1\|1213666_1214425_-	ATPase AAA	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_015082455.1\|1214436_1215660_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	6.4e-233	99.8

DBSCAN-SWA_8

1233585 : 1374573

119

Bacillus_phage(37.5%)

transposase,tRNA,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014572600.1\|1233585_1234932_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_015082466.1\|1234981_1236052_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_015082467.1\|1236698_1237400_-	hypothetical protein	NA	NA	NA	NA
WP_021165346.1\|1237578_1237809_-	hypothetical protein	NA	NA	NA	NA
WP_015082468.1\|1238657_1239725_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	2.7e-54	40.9
WP_004234939.1\|1240238_1240529_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_080600835.1\|1240546_1240888_+	hypothetical protein	NA	NA	NA	NA
WP_041931793.1\|1240923_1241187_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	2.7e-08	36.0
WP_080600859.1\|1241198_1242038_+	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	1.8e-48	41.1
WP_015082470.1\|1243057_1243915_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_015082471.1\|1243904_1246178_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_014572659.1\|1246337_1246991_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_015082472.1\|1247083_1249816_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.9e-43	23.3
WP_015082473.1\|1250290_1251577_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_011676184.1\|1251566_1251806_-	D-alanine--poly(phosphoribitol) ligase subunit 2	NA	NA	NA	NA
WP_041931794.1\|1251841_1253065_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	2.4e-22	30.8
WP_015082475.1\|1253064_1254564_-	D-alanine--poly(phosphoribitol) ligase subunit 1	A0A2K9L3I8	Tupanvirus	1.8e-40	30.0
WP_021212171.1\|1254588_1254720_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_015082476.1\|1254902_1255559_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_015082477.1\|1255551_1256352_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_015082478.1\|1256364_1257117_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_015082479.1\|1258456_1259347_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081172432.1\|1259403_1260144_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	4.0e-20	29.5
WP_015082481.1\|1260654_1261491_-	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_011676192.1\|1261487_1263047_-	MFS transporter	NA	NA	NA	NA
WP_015082163.1\|1263185_1263419_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	2.1e-07	35.1
WP_010905103.1\|1263456_1264296_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	9.3e-50	41.4
WP_015082482.1\|1265106_1265472_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_011676195.1\|1265541_1266057_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_015082483.1\|1266310_1266736_-	hypothetical protein	NA	NA	NA	NA
WP_011676197.1\|1266983_1267172_-	hypothetical protein	NA	NA	NA	NA
WP_011676198.1\|1267185_1267944_-	XRE family transcriptional regulator	R9TNM0	Vibrio_phage	3.7e-05	26.6
WP_015082484.1\|1268062_1269847_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.5e-44	28.0
WP_015082485.1\|1269830_1271648_-	multidrug resistance ABC transporter ATP-binding and permease	W8CYL7	Bacillus_phage	1.1e-44	27.4
WP_015082486.1\|1271785_1273036_-	glycoside hydrolase family 25	A0A2H4PQN5	Staphylococcus_phage	2.1e-05	26.3
WP_015082487.1\|1273049_1273640_-	hypothetical protein	NA	NA	NA	NA
WP_015082488.1\|1273693_1274281_-	hypothetical protein	NA	NA	NA	NA
WP_011835093.1\|1274591_1275212_-	riboflavin transporter RibU	NA	NA	NA	NA
WP_011676202.1\|1275560_1276280_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_011676203.1\|1276266_1276833_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	9.5e-14	34.4
WP_015082490.1\|1276825_1277554_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.5e-08	35.5
WP_015082491.1\|1277584_1278301_-	XerD-like tyrosine recombinase	NA	NA	NA	NA
WP_011676206.1\|1278278_1278740_-	CBS domain-containing protein	NA	NA	NA	NA
WP_015082492.1\|1278770_1279274_-	metallophosphoesterase	NA	NA	NA	NA
WP_014572683.1\|1279312_1279918_-	nucleoside-triphosphate diphosphatase	NA	NA	NA	NA
WP_015082493.1\|1279918_1280734_-	glutamate racemase	NA	NA	NA	NA
WP_003130191.1\|1280909_1281149_-	hypothetical protein	NA	NA	NA	NA
WP_015082494.1\|1281299_1282559_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_014572686.1\|1282673_1284113_-	glutamate synthase subunit beta	NA	NA	NA	NA
WP_015082495.1\|1284112_1288582_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_015082496.1\|1288750_1289362_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_015082497.1\|1289394_1290417_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_011676215.1\|1290576_1291332_+	potassium transporter KefA	NA	NA	NA	NA
WP_015082498.1\|1292817_1294329_-	glutamate:gamma-aminobutyrate antiporter	NA	NA	NA	NA
WP_041931795.1\|1294371_1295262_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015082500.1\|1295740_1296631_-\|transposase	IS982-like element IS982B family transposase	NA	NA	NA	NA
WP_015082501.1\|1296864_1297641_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	1.9e-25	41.9
WP_015082502.1\|1297753_1298602_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_041931796.1\|1298831_1299344_-	N-acetyltransferase	NA	NA	NA	NA
WP_015082454.1\|1299419_1300178_-\|transposase	transposase	A0A059NT77	Lactococcus_phage	4.5e-136	99.6
WP_015082455.1\|1300189_1301413_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	6.4e-233	99.8
WP_080506533.1\|1301644_1301725_-	hypothetical protein	NA	NA	NA	NA
WP_041931797.1\|1301706_1302528_-	hypothetical protein	NA	NA	NA	NA
WP_015082504.1\|1302873_1303635_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_015082505.1\|1303627_1305013_+	PepP/PepQ-like peptidase M24 family	NA	NA	NA	NA
WP_015082506.1\|1305081_1306809_-	metallophosphoesterase	NA	NA	NA	NA
WP_015082507.1\|1308984_1309608_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_015082508.1\|1309623_1310757_-	endoglucanase	NA	NA	NA	NA
WP_011676308.1\|1310758_1311613_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_015082509.1\|1312705_1314013_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015082511.1\|1314744_1315635_-\|transposase	IS982-like element IS982B family transposase	NA	NA	NA	NA
WP_015082512.1\|1315836_1316784_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081172436.1\|1316783_1317623_-	metal ABC transporter permease	NA	NA	NA	NA
WP_015082515.1\|1319123_1319354_-	DUF4176 domain-containing protein	NA	NA	NA	NA
WP_081172438.1\|1319605_1322746_-	SMC family ATPase	NA	NA	NA	NA
WP_015082517.1\|1322748_1323921_-	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_011676318.1\|1324066_1325005_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_015082518.1\|1325202_1325577_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_081213184.1\|1326217_1327108_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_041931798.1\|1330467_1330911_-	hypothetical protein	NA	NA	NA	NA
WP_011676323.1\|1331215_1332838_+	DUF814 domain-containing protein	Q84500	Paramecium_bursaria_Chlorella_virus	5.5e-06	32.1
WP_015082522.1\|1332879_1333695_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_015082523.1\|1333876_1335397_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-19	32.1
WP_015082524.1\|1335389_1336484_+	ABC transporter permease	NA	NA	NA	NA
WP_011676327.1\|1336480_1337434_+	ABC transporter permease	NA	NA	NA	NA
WP_015082525.1\|1337550_1338528_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_015082526.1\|1338645_1340154_-	pyruvate kinase	NA	NA	NA	NA
WP_003131080.1\|1340241_1341264_-	ATP-dependent 6-phosphofructokinase	NA	NA	NA	NA
WP_011676329.1\|1341651_1342800_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_015082527.1\|1342970_1344149_-	toxic anion resistance protein	A0A291I9K4	Lactobacillus_phage	1.5e-37	28.8
WP_015082528.1\|1344290_1344917_-\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis protein	NA	NA	NA	NA
WP_015082529.1\|1345107_1346136_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_015082530.1\|1346177_1347119_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	2.8e-79	52.2
WP_041931799.1\|1347189_1347597_+	transporter	NA	NA	NA	NA
WP_011676335.1\|1347593_1348124_+	heptaprenyl diphosphate synthase subunit I	NA	NA	NA	NA
WP_015082532.1\|1348114_1349074_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_014572720.1\|1349070_1349787_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_014572721.1\|1349795_1350254_-	hypothetical protein	NA	NA	NA	NA
WP_011676339.1\|1350255_1350969_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_015082533.1\|1351098_1352034_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_014572723.1\|1352264_1353053_-	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_015082534.1\|1353302_1354667_-	MFS transporter	NA	NA	NA	NA
WP_011676343.1\|1354864_1355581_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015082535.1\|1355651_1357079_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_015082536.1\|1357088_1357829_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_015082537.1\|1357829_1358375_-	hypothetical protein	NA	NA	NA	NA
WP_015082538.1\|1358371_1359208_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_051013173.1\|1359207_1360161_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_015082540.1\|1360198_1361518_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_081213185.1\|1363764_1364976_+	virion core protein	NA	NA	NA	NA
WP_015082543.1\|1365189_1366341_+	ATP/GTP-binding protein	NA	NA	NA	NA
WP_011676353.1\|1366337_1367123_+	hypothetical protein	NA	NA	NA	NA
WP_011676354.1\|1367157_1367691_-	rRNA large subunit pseudouridine synthase E	NA	NA	NA	NA
WP_015082544.1\|1367990_1369508_+	glycerol kinase	NA	NA	NA	NA
WP_015082545.1\|1369560_1371138_+	glycerol-3-phosphate dehydrogenase/oxidase	NA	NA	NA	NA
WP_015082547.1\|1372017_1372830_-	WxL domain-containing protein	NA	NA	NA	NA
WP_011676361.1\|1372810_1373146_-	hypothetical protein	NA	NA	NA	NA
WP_080600860.1\|1373461_1374301_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_015082549.1\|1374312_1374573_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6

DBSCAN-SWA_9

1517777 : 1580697

Bacillus_phage(18.18%)

transposase,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082638.1\|1517777_1518815_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_015082639.1\|1518886_1519489_+	hypothetical protein	NA	NA	NA	NA
WP_011676623.1\|1519537_1519708_-	hypothetical protein	NA	NA	NA	NA
WP_011834866.1\|1519735_1521049_-	GTPase ObgE	NA	NA	NA	NA
WP_015082640.1\|1521198_1522365_-	cell division protein FtsQ	NA	NA	NA	NA
WP_015082641.1\|1522365_1523439_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_015082642.1\|1523681_1525031_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_011676628.1\|1525199_1525541_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_015082643.1\|1525625_1526867_-	ammonium transporter	NA	NA	NA	NA
WP_021211938.1\|1527052_1528525_-	sensor histidine kinase	W8CYF6	Bacillus_phage	5.1e-27	33.1
WP_081213187.1\|1528537_1529230_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	9.1e-35	33.6
WP_011834860.1\|1529385_1529916_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_011676633.1\|1530048_1530294_-	50S ribosomal protein L31 type B	NA	NA	NA	NA
WP_051013198.1\|1531082_1531679_+	hypothetical protein	NA	NA	NA	NA
WP_015082647.1\|1531786_1532557_+	hypothetical protein	Q38326	Lactococcus_phage	1.9e-65	74.0
WP_011676639.1\|1532717_1533791_-	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.5e-60	35.1
WP_011676640.1\|1533878_1534811_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-23	30.5
WP_011834850.1\|1535059_1536352_-	uracil transporter	Q9KX94	Enterobacteria_phage	3.6e-61	36.2
WP_011676642.1\|1536451_1536973_-	phosphoribosyltransferase	NA	NA	NA	NA
WP_015082648.1\|1537264_1537963_-	hypothetical protein	NA	NA	NA	NA
WP_011676644.1\|1538067_1538367_+	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_021037569.1\|1538356_1539274_+	cation transporter	NA	NA	NA	NA
WP_015082651.1\|1540862_1541675_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.5e-41	42.0
WP_081213188.1\|1541911_1542802_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082654.1\|1544290_1544533_-	DUF1858 domain-containing protein	NA	NA	NA	NA
WP_015082655.1\|1544648_1544975_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_015082656.1\|1544961_1545669_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_015082657.1\|1545863_1546436_+	NADP oxidoreductase coenzyme F420-dependent	NA	NA	NA	NA
WP_015082658.1\|1546505_1547048_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015082659.1\|1547072_1548629_-	signal recognition particle protein	NA	NA	NA	NA
WP_015082660.1\|1548873_1549764_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082662.1\|1551787_1553500_-	RNase J family beta-CASP ribonuclease	NA	NA	NA	NA
WP_015082663.1\|1553849_1554521_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.8e-20	44.3
WP_011676659.1\|1554560_1555454_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_011676660.1\|1555782_1556238_-	NUDIX domain-containing protein	D0R7J3	Paenibacillus_phage	1.0e-26	38.9
WP_015082664.1\|1556247_1557324_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_015082665.1\|1557419_1558283_-	aquaporin family protein	NA	NA	NA	NA
WP_015082666.1\|1558631_1558883_-	hypothetical protein	NA	NA	NA	NA
WP_015082667.1\|1559050_1561027_-	transketolase	NA	NA	NA	NA
WP_015082668.1\|1561194_1562595_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_011676666.1\|1562647_1562947_-	PTS lactose transporter subunit IIB	NA	NA	NA	NA
WP_015082669.1\|1565063_1565705_-	bifunctional 2-keto-4-hydroxyglutarate aldolase/2-keto-3-deoxy-6-phosphogluconate aldolase	NA	NA	NA	NA
WP_015082670.1\|1566654_1568073_-	glucuronate isomerase	NA	NA	NA	NA
WP_011676673.1\|1569026_1570553_-	MFS transporter	NA	NA	NA	NA
WP_081172455.1\|1570738_1571815_-	mannonate dehydratase	NA	NA	NA	NA
WP_011676494.1\|1573989_1574670_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015082673.1\|1574734_1576165_-	MFS transporter	NA	NA	NA	NA
WP_011834820.1\|1576523_1576829_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_011676497.1\|1576833_1577058_-	hypothetical protein	NA	NA	NA	NA
WP_014572291.1\|1577272_1578163_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014572290.1\|1578144_1578345_-	hypothetical protein	NA	NA	NA	NA
WP_015081738.1\|1579108_1579789_-\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-108	84.1
WP_081172459.1\|1579839_1580697_-\|transposase	transposase	A0A059NT83	Lactococcus_phage	3.6e-158	99.6

DBSCAN-SWA_10

1605059 : 1654096

Bacillus_phage(45.45%)

transposase,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082687.1\|1605059_1605950_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082688.1\|1606179_1607160_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_011676566.1\|1607425_1608025_-	transglycosylase	E0YIP1	Lactococcus_phage	1.0e-26	53.9
WP_014572273.1\|1608695_1609655_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_015082689.1\|1609679_1611218_-	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_041931810.1\|1611385_1611619_-	hypothetical protein	NA	NA	NA	NA
WP_011676570.1\|1611688_1611910_-	hypothetical protein	NA	NA	NA	NA
WP_015082690.1\|1611990_1612305_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_011676572.1\|1612322_1612652_-	hypothetical protein	NA	NA	NA	NA
WP_011676573.1\|1612837_1613671_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011676574.1\|1613707_1614448_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_015082692.1\|1614546_1617252_-	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_015082693.1\|1617512_1618946_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_011676678.1\|1619064_1619337_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.5e-17	55.1
WP_015082694.1\|1619457_1621200_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_081172462.1\|1621348_1622719_-	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	4.6e-06	32.8
WP_011676681.1\|1622934_1623612_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.3e-30	35.9
WP_011676682.1\|1623780_1624755_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_015082696.1\|1624906_1627162_-	maltose phosphorylase	NA	NA	NA	NA
WP_029344224.1\|1630416_1631028_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_080600841.1\|1631048_1632674_-	alpha-glucosidase	NA	NA	NA	NA
WP_015082699.1\|1632940_1634695_-	alpha-glycosidase	NA	NA	NA	NA
WP_011676689.1\|1635067_1636297_+	maltose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_041931811.1\|1637729_1638587_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_041931812.1\|1638759_1638972_+	hypothetical protein	NA	NA	NA	NA
WP_081172531.1\|1638982_1639822_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	7.1e-50	41.8
WP_011669038.1\|1639833_1640094_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	1.1e-09	36.5
WP_041931814.1\|1640946_1641567_-	hydrolase	NA	NA	NA	NA
WP_014572252.1\|1641806_1643198_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_014572251.1\|1643277_1643940_-	(d)CMP kinase	NA	NA	NA	NA
WP_015082704.1\|1644059_1644572_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_011676698.1\|1644618_1644822_+	ferredoxin	NA	NA	NA	NA
WP_011676699.1\|1645091_1646081_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_011834717.1\|1646159_1646972_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_015082705.1\|1646990_1647914_+	mannose-specific PTS system component IID	NA	NA	NA	NA
WP_081172464.1\|1648056_1648440_+	DUF956 domain-containing protein	NA	NA	NA	NA
WP_015082707.1\|1648468_1649164_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.2e-21	30.4
WP_041931815.1\|1649302_1649674_+	DUF956 domain-containing protein	NA	NA	NA	NA
WP_081213189.1\|1650072_1651344_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.7e-95	46.2
WP_041931816.1\|1651336_1651516_-	hypothetical protein	NA	NA	NA	NA
WP_041168249.1\|1651618_1652446_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_003137511.1\|1652459_1652720_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6
WP_041931817.1\|1653415_1654096_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-110	84.5

DBSCAN-SWA_11

1846966 : 1857263

Lactococcus_phage(62.5%)

transposase,integrase

attL 1846563:1846585|attR 1857283:1857305

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1846563:1846585	attL	NA	NA	NA	NA
WP_015082809.1\|1846966_1847905_-	glycosyltransferase	V9QJB1	Oenococcus_phage	1.0e-81	50.6
WP_011676902.1\|1847822_1849424_-	membrane protein	NA	NA	NA	NA
WP_081172533.1\|1849513_1850353_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	3.5e-49	41.1
WP_003137511.1\|1850364_1850625_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6
WP_021212698.1\|1850736_1851132_-	hypothetical protein	NA	NA	NA	NA
WP_015082812.1\|1851134_1851554_-	deoxyuridine 5-triphosphate nucleotidohydrolase	A5GYP0	Lactococcus_phage	9.0e-70	95.7
WP_003331414.1\|1851785_1852544_-	ATPase AAA	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_015082455.1\|1852555_1853779_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	6.4e-233	99.8
WP_015082813.1\|1853854_1854379_-	hypothetical protein	NA	NA	NA	NA
WP_080600863.1\|1854659_1855226_+	helix-turn-helix domain-containing protein	A5GYQ3	Lactococcus_phage	5.1e-60	72.2
WP_015082815.1\|1855231_1855666_+	hypothetical protein	NA	NA	NA	NA
WP_014573177.1\|1855679_1856015_+	hypothetical protein	NA	NA	NA	NA
WP_021212288.1\|1856081_1857263_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.0e-90	47.5
1857283:1857305	attR	NA	NA	NA	NA

DBSCAN-SWA_12

1948965 : 2007406

Bacillus_phage(35.71%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081172505.1\|1948965_1949856_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082866.1\|1951108_1952248_-	nicotinamide-nucleotide adenylyltransferase	A0A2K9VDE3	Lactobacillus_phage	1.5e-119	55.4
WP_015082867.1\|1952234_1953212_-	D-2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_015082868.1\|1953409_1954702_-\|protease	collagenase-like protease	Q6DW11	Phage_TP	1.0e-39	33.7
WP_041931920.1\|1954986_1955910_-	U32 family peptidase	NA	NA	NA	NA
WP_015082870.1\|1956129_1956411_+	DUF3270 domain-containing protein	NA	NA	NA	NA
WP_081213194.1\|1956440_1957262_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_011677066.1\|1957380_1958007_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_015082871.1\|1958039_1959059_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_011677068.1\|1959051_1959822_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.9e-29	32.8
WP_051013186.1\|1959840_1960731_-	hypothetical protein	A0A076G4Q2	Staphylococcus_phage	6.5e-09	26.6
WP_051013188.1\|1960832_1961156_-	hypothetical protein	NA	NA	NA	NA
WP_080600867.1\|1961244_1962084_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	4.6e-49	41.4
WP_011669038.1\|1962095_1962356_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	1.1e-09	36.5
WP_011677070.1\|1962624_1963023_+	HIT family protein	NA	NA	NA	NA
WP_011677071.1\|1963037_1963259_+	hypothetical protein	NA	NA	NA	NA
WP_014573252.1\|1963270_1963615_-	hypothetical protein	NA	NA	NA	NA
WP_011677073.1\|1963692_1964382_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_011677074.1\|1964768_1965194_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_015082873.1\|1965329_1966094_-	hypothetical protein	NA	NA	NA	NA
WP_015082874.1\|1966093_1966972_-	bacitracin transport ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.9e-05	26.4
WP_011677077.1\|1967038_1967248_-	hypothetical protein	NA	NA	NA	NA
WP_011677078.1\|1967281_1967803_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
WP_015082876.1\|1967977_1968835_-	RNA-binding domain protein	NA	NA	NA	NA
WP_011677080.1\|1968879_1969338_-	N-acetyltransferase	NA	NA	NA	NA
WP_011677081.1\|1969422_1969980_-	ribosome-recycling factor	NA	NA	NA	NA
WP_004254608.1\|1970135_1970852_-	UMP kinase	NA	NA	NA	NA
WP_011677082.1\|1970936_1971389_-	hypothetical protein	NA	NA	NA	NA
WP_015082877.1\|1971518_1972706_-	acetate kinase	NA	NA	NA	NA
WP_011677084.1\|1972864_1974052_-	acetate kinase	NA	NA	NA	NA
WP_081172507.1\|1974243_1975182_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011677086.1\|1975269_1975521_-	hypothetical protein	NA	NA	NA	NA
WP_011677087.1\|1975621_1977463_-	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	1.2e-17	35.4
WP_015082879.1\|1977630_1978104_-	hypothetical protein	NA	NA	NA	NA
WP_080600868.1\|1978226_1979066_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	4.6e-49	41.4
WP_003137511.1\|1979077_1979338_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6
WP_041931832.1\|1979374_1979749_-	hypothetical protein	NA	NA	NA	NA
WP_015082881.1\|1979831_1980722_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082882.1\|1980782_1981241_-	hypothetical protein	NA	NA	NA	NA
WP_015082883.1\|1981255_1981870_-	hypothetical protein	NA	NA	NA	NA
WP_015082884.1\|1982209_1982938_-	transcriptional regulator	NA	NA	NA	NA
WP_011677095.1\|1983130_1983352_+	DUF910 domain-containing protein	NA	NA	NA	NA
WP_011677096.1\|1983385_1984357_+	glucokinase	NA	NA	NA	NA
WP_011677097.1\|1984359_1984746_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_015082885.1\|1984861_1985308_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.6e-16	32.6
WP_015082886.1\|1985473_1986061_+	prepilin peptidase	NA	NA	NA	NA
WP_011677101.1\|1987096_1988191_-	DNA polymerase IV	NA	NA	NA	NA
WP_011677102.1\|1988266_1988758_-\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
WP_015082889.1\|1988833_1990327_-	amino acid permease	NA	NA	NA	NA
WP_015082890.1\|1991910_1992855_-	carbamate kinase	NA	NA	NA	NA
WP_015082892.1\|1994584_1995649_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_015082893.1\|1995814_1997047_-	arginine deiminase	NA	NA	NA	NA
WP_011677109.1\|1998353_2000048_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.8e-80	34.2
WP_015082894.1\|2000115_2000574_+	arginine repressor	NA	NA	NA	NA
WP_015082895.1\|2000733_2002065_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_041931833.1\|2002265_2002865_-	hypothetical protein	NA	NA	NA	NA
WP_015082897.1\|2003081_2006186_-	DNA/RNA helicase SWF/SNF family	A0A2L1IWL4	Gordonia_phage	2.4e-42	30.1
WP_003137511.1\|2007145_2007406_+\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016685

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1729 : 60612

Lactococcus_phage(39.13%)

bacteriocin,protease,transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015081769.1\|1729_2620_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014573541.1\|2905_3139_+	hypothetical protein	NA	NA	NA	NA
WP_014573540.1\|3148_3907_+	chromosome partitioning protein ParA	H7BUL8	unidentified_phage	1.6e-16	28.4
WP_014573539.1\|3910_4639_+	chromosome partitioning protein ParB	Q4ZC37	Staphylococcus_virus	7.2e-06	27.7
WP_021164865.1\|4668_5049_-	hypothetical protein	A0A182BQ76	Lactococcus_phage	3.3e-10	75.6
WP_015081770.1\|5008_6475_-	DNA polymerase V subunit UmuC	Q6DMX4	Streptococcus_phage	1.3e-123	51.3
WP_080600870.1\|6736_6925_+	hypothetical protein	NA	NA	NA	NA
WP_041931939.1\|7114_7447_+	hypothetical protein	NA	NA	NA	NA
WP_080600871.1\|7478_7841_-	hypothetical protein	NA	NA	NA	NA
WP_081213204.1\|7844_8498_-	DDE domain-containing protein	A0A1X9I6C6	Streptococcus_phage	1.6e-97	80.7
WP_003331414.1\|8565_9324_-	ATPase AAA	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_003331415.1\|9335_10559_-\|transposase	IS21 family transposase IS712	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
WP_014573531.1\|11673_11874_+	hypothetical protein	Q9AZK6	Lactococcus_phage	2.8e-05	51.9
WP_003132324.1\|12004_12205_+	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	1.6e-13	54.7
WP_011669084.1\|12481_12682_+	cold-shock protein	Q9AZD3	Lactococcus_phage	9.6e-30	97.0
WP_011669083.1\|15848_16145_+	hypothetical protein	NA	NA	NA	NA
WP_021164873.1\|16194_16425_+	hypothetical protein	NA	NA	NA	NA
WP_014573656.1\|17114_17453_-	hypothetical protein	NA	NA	NA	NA
WP_041931947.1\|17644_18325_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.4e-106	81.9
WP_014573523.1\|18437_18725_+\|bacteriocin	ComC/BlpC family peptide pheromone/bacteriocin	NA	NA	NA	NA
WP_011669076.1\|18734_19097_+	hypothetical protein	NA	NA	NA	NA
WP_011669075.1\|19283_19553_+	hypothetical protein	NA	NA	NA	NA
WP_011669074.1\|19697_20273_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011669073.1\|21300_22650_+	dihydrolipoamide dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	5.4e-116	50.7
WP_081172582.1\|24998_25889_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_061778283.1\|25941_26757_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_021166316.1\|26878_27244_+	hypothetical protein	NA	NA	NA	NA
WP_012898583.1\|27929_28130_-	cold-shock protein	Q9AZD3	Lactococcus_phage	6.9e-28	92.4
WP_041931732.1\|28281_28962_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.1
WP_080600872.1\|28961_29162_+	hypothetical protein	NA	NA	NA	NA
WP_015081772.1\|29262_29844_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.4e-36	41.4
WP_011669047.1\|29848_31774_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	5.7e-34	36.6
WP_080600873.1\|32663_33155_+\|integrase	site-specific integrase	A0A0A8WF08	Clostridium_phage	9.7e-15	35.9
WP_021214628.1\|33151_33574_-	hypothetical protein	NA	NA	NA	NA
WP_081172581.1\|33903_35064_-	MFS transporter	NA	NA	NA	NA
WP_015081777.1\|37957_38716_-\|transposase	transposase	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
WP_003331415.1\|38727_39951_-\|transposase	IS21 family transposase IS712	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
WP_010890679.1\|40176_40443_-	hypothetical protein	NA	NA	NA	NA
WP_015081778.1\|40456_41254_-	plasmid partition protein	A0A1V0DZZ0	Clostridioides_phage	1.1e-20	32.6
WP_015081779.1\|41397_41955_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	2.9e-31	43.1
WP_032940538.1\|42161_42344_-	hypothetical protein	NA	NA	NA	NA
WP_015081780.1\|42500_43967_-	UmuC protein	Q6DMX4	Streptococcus_phage	6.5e-123	51.3
WP_015081781.1\|44215_44851_+	hypothetical protein	NA	NA	NA	NA
WP_015081782.1\|45285_46797_+	hypothetical protein	NA	NA	NA	NA
WP_015081783.1\|47065_47314_+	hypothetical protein	NA	NA	NA	NA
WP_041931940.1\|47729_49877_+	lactococcin-A transport/processing ATP-binding protein LcnC	W8CYL7	Bacillus_phage	3.5e-40	27.1
WP_015081785.1\|49891_51316_+	Lactococcin A secretion protein LcnD	NA	NA	NA	NA
WP_015081786.1\|51389_51617_+\|bacteriocin	bacteriocin lactococcin-A	NA	NA	NA	NA
WP_015081787.1\|51631_51928_+	Lactococcin-A immunity protein	NA	NA	NA	NA
WP_015081788.1\|52202_52409_+\|bacteriocin	bacteriocin lactococcin-B	NA	NA	NA	NA
WP_021166195.1\|53490_53655_+	hypothetical protein	NA	NA	NA	NA
WP_015081789.1\|53857_54310_+	hypothetical protein	NA	NA	NA	NA
WP_021166196.1\|54348_55005_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_021166197.1\|55104_55386_-	hypothetical protein	NA	NA	NA	NA
WP_021166198.1\|55387_55615_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_011834695.1\|55968_57288_+\|transposase	IS4 family transposase IS1675	NA	NA	NA	NA
WP_011834695.1\|57582_58902_+\|transposase	IS4 family transposase IS1675	NA	NA	NA	NA
WP_021211273.1\|59409_59634_-	hypothetical protein	NA	NA	NA	NA
WP_021166201.1\|59718_60612_-\|transposase	IS982-like element ISLgar3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015894

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016685

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection