CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP015900	Lactococcus lactis subsp. cremoris strain JM2 chromosome, complete genome	1 crisprs	WYL,cas3,DinG,csa3,DEDDh	11
NZ_CP016742	Lactococcus lactis subsp. cremoris strain JM2 plasmid pJM2A, complete sequence	0 crisprs	NA	0
NZ_CP016745	Lactococcus lactis subsp. cremoris strain JM2 plasmid pMPJM2, complete sequence	0 crisprs	RT	2
NZ_CP016743	Lactococcus lactis subsp. cremoris strain JM2 plasmid pJM2B, complete sequence	0 crisprs	NA	0
NZ_CP016744	Lactococcus lactis subsp. cremoris strain JM2 plasmid pJM2C, complete sequence	0 crisprs	NA	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015900_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015900_1

2088913-2089008

Orphan

Consensus_repeat	Method
TCTTCCTCAATCTTCCCAATTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015900_1

>merge|NZ_CP015900|1|2088913-2089008|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTTCCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATATTCTTCCTCAATTTTCCCAATTCTT

>NZ_CP015900|1|1|2088913-2089008|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTT	CCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATAT
TCTTCCTCAATTTTCCCAATTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015900.1\|WP_081196879.1\|2090006_2090897_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP015900.1\|WP_011677119.1\|2102896_2103226_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227933
NZ_CP015900.1\|WP_081196882.1\|2107222_2109514_+\|Xaa-Pro-dipeptidyl-peptidase	unknown	unknown	gnl\|CDD\|235435
NZ_CP015900.1\|WP_011677112.1\|2084922_2085522_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015900.1\|WP_081196881.1\|2098649_2100377_-\|pyruvate-oxidase	unknown	unknown	gnl\|CDD\|213733
NZ_CP015900.1\|WP_152023984.1\|2097047_2098159_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP015900.1\|WP_021165021.1\|2078246_2079311_-\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|179366
NZ_CP015900.1\|WP_004254487.1\|2082772_2083231_+\|arginine-repressor	unknown	unknown	gnl\|CDD\|130592
NZ_CP015900.1\|WP_021165024.1\|2073206_2074337_-\|aminotransferase	unknown	unknown	gnl\|CDD\|235989
NZ_CP015900.1\|WP_011677113.1\|2085738_2088843_-\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|350770
NZ_CP015900.1\|WP_021213427.1\|2076534_2078115_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP015900.1\|WP_021165011.1\|2105363_2106146_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP015900.1\|WP_011677109.1\|2081010_2082705_-\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|183534
NZ_CP015900.1\|WP_081196880.1\|2093555_2095601_+\|MnhB-domain-containing-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP015900.1\|WP_011677122.1\|2106181_2107051_-\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NZ_CP015900.1\|WP_015082898.1\|2100626_2101583_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP015900.1\|WP_011677117.1\|2101655_2102435_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373100
NZ_CP015900.1\|WP_081196878.1\|2074600_2075545_-\|carbamate-kinase	unknown	unknown	gnl\|CDD\|223623
NZ_CP015900.1\|WP_081196877.1\|2071523_2073017_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP015900.1\|WP_021165020.1\|2083390_2084722_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757

Protein	Function_ID	Function_description	E-value
NZ_CP015900.1\|WP_081196879.1\|2090006_2090897_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.45567e-24
NZ_CP015900.1\|WP_011677119.1\|2102896_2103226_-\|hypothetical-protein	gnl\|CDD\|227933	COG5646, COG5646, Uncharacterized conserved protein [Function unknown].	1.81818e-27
NZ_CP015900.1\|WP_081196882.1\|2107222_2109514_+\|Xaa-Pro-dipeptidyl-peptidase	gnl\|CDD\|235435	PRK05371, PRK05371, x-prolyl-dipeptidyl aminopeptidase; Provisional.	0
NZ_CP015900.1\|WP_015082898.1\|2100626_2101583_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	3.4174e-51
NZ_CP015900.1\|WP_081196881.1\|2098649_2100377_-\|pyruvate-oxidase	gnl\|CDD\|213733	TIGR02720, Pyruvate_oxidase, pyruvate oxidase. Members of this family are examples of pyruvate oxidase (EC 1.2.3.3), an enzyme with FAD and TPP as cofactors that catalyzes the reaction pyruvate + phosphate + O2 + H2O = acetyl phosphate + CO2 + H2O2. It should not be confused with pyruvate dehydrogenase [cytochrome] (EC 1.2.2.2) as in E. coli PoxB, although the E. coli enzyme is closely homologous and has pyruvate oxidase as an alternate name. [Energy metabolism, Aerobic].	0
NZ_CP015900.1\|WP_152023984.1\|2097047_2098159_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	4.7831e-65
NZ_CP015900.1\|WP_021165021.1\|2078246_2079311_-\|ornithine-carbamoyltransferase	gnl\|CDD\|179366	PRK02102, PRK02102, ornithine carbamoyltransferase; Validated.	0
NZ_CP015900.1\|WP_004254487.1\|2082772_2083231_+\|arginine-repressor	gnl\|CDD\|130592	TIGR01529, Arginine_repressor., arginine repressor. This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions].	4.3854e-60
NZ_CP015900.1\|WP_021165024.1\|2073206_2074337_-\|aminotransferase	gnl\|CDD\|235989	PRK07324, PRK07324, transaminase; Validated.	0
NZ_CP015900.1\|WP_011677113.1\|2085738_2088843_-\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|350770	cd18012, DEXQc_arch_SWI2_SNF2, DEAQ-box helicase domain of archaeal and bacterial SNF2-related proteins. Proteins belonging to SNF2 family of DNA dependent ATPases are important members of the chromatin remodeling complexes that are implicated in epigenetic control of gene expression. The Snf2 family comprises a large group of ATP-hydrolyzing proteins that are ubiquitous in eukaryotes, but also present in eubacteria and archaea. Archaeal SWI2 and SNF2 are members of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.9716e-94
NZ_CP015900.1\|WP_021213427.1\|2076534_2078115_-\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	3.24315e-157
NZ_CP015900.1\|WP_021165011.1\|2105363_2106146_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.37116e-07
NZ_CP015900.1\|WP_011677109.1\|2081010_2082705_-\|arginine--tRNA-ligase	gnl\|CDD\|183534	PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP015900.1\|WP_081196880.1\|2093555_2095601_+\|MnhB-domain-containing-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	1.06583e-06
NZ_CP015900.1\|WP_011677122.1\|2106181_2107051_-\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	1.01122e-67
NZ_CP015900.1\|WP_011677117.1\|2101655_2102435_-\|hypothetical-protein	gnl\|CDD\|373100	pfam14507, CppA_C, CppA C-terminal. This is the C-terminal domain of the CppA protein found in species of Streptococcus. CppA is a putative C3-glycoprotein degrading proteinase, involved in pathogenicity. It is often found associated with pfam14506.	3.1718e-25
NZ_CP015900.1\|WP_081196878.1\|2074600_2075545_-\|carbamate-kinase	gnl\|CDD\|223623	COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism].	3.52438e-174
NZ_CP015900.1\|WP_081196877.1\|2071523_2073017_-\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	5.76811e-150
NZ_CP015900.1\|WP_021165020.1\|2083390_2084722_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0

>NZ_CP015900.1|WP_011677113.1|2085738_2088843_-|DEAD/DEAH-box-helicase-family-protein
MSRMMPARVRSEGIALYAKGFLNDPIETDFKLTAEIDGEEVSYDLDGAQDSCTCSIFQQNHRYCKHIAAIEEYLKNQDKGSLETKDKETKGAERGLYNENIAFLDAVNGETQLNFSTDQYSIEVQIEDNSQLYDYFSMDYFLYFDLKLKSKNLGRSYVIKDIPYFLRALKNYSQYSLGSLHYIDLFFDNFDEASQEFLSFLLKIDGKSDEALTKSLYIKNGRYLNIPFLFLEEAMDLVSALEVYQLKIIGRTVNYFTFIPLDNDSEIFKFKVESQQDYIELSLFSEDYHNFYDYSLLYDNNVFYKLSQEQRRLLLVLDKQFAQKSKIKFSYSEKDKLAQALQQLSTLGKIEAPEHFVVKPFDAKFTFDLLDEKTLSLAMKFDYGTFSIDSFHDLETLEFSRDLRKEQKIFALMERLQFAKAFNSTLEITEHLSENFFLKILPSFQKLGQIELSPTLRNMRMDEVPEIHIDSQGGLLDISFNIPHVEDGEFANVIAKLQENAEFYISESGKFYHFNEKFDRLKAALHELDDQFVIQGSSLHVNINRSFQISKIFEKISGASFSEKFKSLYQHLTHPEEFPYEKPEHIKASLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFILSNLKKDESVLITAPASLTYNWASEFEKFTDEIDFVVIDGNKADRTKEIQENHQIYITSYGSFLKDFEDYQDKKLNYLLLDEAQVVKNYSSKTNKSLSALNVEHTFALSGTPLENRIEEIWAIFQVVMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIYLAQLELMQKQVLEMDNAALSRSRIEILAGITRLRQICNTPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFSQFTKVFPHIEKLMEEQEMTAYKLTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLTSADVVILVDLWWNPAVEEQAIARAHRMGQKNTVEVIRLITQGTIEEKIMEIQERKKDLIANVLEGDTVDKVLSEAEIREILGV
>NZ_CP015900.1|WP_011677112.1|2084922_2085522_-|hypothetical-protein
MVERRVVFPVIGDDEVLQKDTRVIFTNQQLLTRNPSLQDEASIETSKSKTDAKRPESFKPYKAKTSFSTQHRPLNSNHAGVSSYDKMPKKTSVDESKERAKRAAATLPKPPKQYVSPLERDKEDLTVRRSTSAILNKRPSTNDNPIRDMKKQGMNVSDAVAKNGSGMKKATPHGGAANDTQKGSYFENKRKNIFDRGIV
>NZ_CP015900.1|WP_021165020.1|2083390_2084722_-|UDP-N-acetylmuramate--L-alanine-ligase
MEKTYHFTGIKGSGMSALALMLHQMGKNVQGSDSTDYFFTQRGLEQVGVPLLPFDEKNIKPEFELIVGNAFRDDNNVEIAFAHKNGFPFKRYHEFLGHFMEDFTSIGVAGAHGKTSTTGMLAHVMSNIVDTSYLIGDGTGRGNAGSEYFVFESDEYERHFMPYHPEYTIMTNIDFDHPDYFEGIEDVTSAFQDYANNIKKGIFAYGEDVNLRKLSAKAPIYYYGFEANDDYRAENLIRSTRGSSFDAYFRGEKIGHFVVPTYGKHNVLNALSVVAVCHNLGLDMTDVADHLLTFRGVKRRFTEKKVGETVIIDDFAHHPTEIEATLDAARQKYPDREIVAVFQPHTFTRTIAFADEFAEVLDHADTVYLAQIYGSAREVDHHEITAQDLADKVRKPAKVIELDNVSPLLDHDRGIYVFMGAGNIQKYEIAFEKLLSQTSTNLQ
>NZ_CP015900.1|WP_004254487.1|2082772_2083231_+|arginine-repressor
MKRDKRLEIIKEIVTNNKISTQEELQSLLLERGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNSKINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDSRTDILGTIAGADTLLVICASEKAANILTAEIKYILLG
>NZ_CP015900.1|WP_011677109.1|2081010_2082705_-|arginine--tRNA-ligase
MDEKQLVSQALSAAIDGVLGVEQIAAIIEKPKSSDLGDLAFPAFQLAKTLRKSPQIIAGEIAEKIDTKGFEKVIAVGPYVNFFLDKNATASEVIREVLTEGEHYGDANIGEGGNVPIDMSAPNIAKPFSIGHLRSTVIGDSIAKIYEKLGYQPIKINHLGDWGKQFGLLITAYKKYGDEATITANPIDELLKLYVKINAEAKEDPEVDEEGRQWFLKMEQGDEEALRIWKWFSDVSLIEFNRIYGKLGVTFDHFMGESFYSDKMDAIVEDLENKNLLHESKGALIVDLEKYNLNPALIKKTDGATLYITRDLATAAYRKKTFNFVKSLYVVGGEQTNHFKQLKAVLKEAGYDWSDDMVHVPFGMVTQGGKKFSTRKGHVVKLEMALDEAVDRAEKQIEAKNPNLENKEEVAKQVGVGAVKFYDLKTDRNNGYDFDLDEMVSFEGETGPYVQYAHARIQSILRKANRKVNIDNISLVVSDAEAWEIVKALKEFPNIVKRAADNYEPSIIAKYAISLAQAFNKYYAHVRILEDDAQLDGRLALISATSIVLKEALRLLGVAAPENM
>NZ_CP015900.1|WP_021165021.1|2078246_2079311_-|ornithine-carbamoyltransferase
MTSPLITKAEVNSVFQGRSLLAEKDFTPAEINYLVDFGLHLKALKQQNIPHHYLEGKNIALLFAKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGIKESTEDTARVLGSMFDAIERRGFSQKEVEDLAKYSGVPVWNGLTDDWHPTQMIADFMTVKENFGYLKGLTLVYVGDGRNNMANSLIVTGSMLGVNVHIVAPDSLHPSKEVMDIANKFAEKSGAKPLATSNIEEGVKGANIIYSDVWVSMGESNWEERVKLLTPYRITMDMLKMTGNADNGKLIFMDCLPAFHDTETEYGKEIKEKYGLTEMEVTDEVFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPAVPEDFK
>NZ_CP015900.1|WP_021213427.1|2076534_2078115_-|amino-acid-permease
MDAENKKGIGLAALVAIIVSGAIGGGVFNLSNDLATNASPGGVVISWIVIGFGILMLVLSLNHLVVNKPELSGVSDYARAGFGNMVGFISGWGYWLSAWAGNIAFAVLMMTAVDYFFPGVFQAKNGSLTILSVIVVSIVSWGLTLLVMRGVEGAAAINAIVLVAKLIPLFVFVIAGIVTFKAGVFSAHFWQNFVANTNADGVIKSLTWSNMTGGDLFSQVKGSLMVMIWVFVGIEGAAMMGDRAKRKSDAGKASILGLIALLVIYILLSLLPFGFMSQQELANTGQPGLVHILNAMVGGWGGSLMAIGLVISLLGAWLSWTMLPVEATQQLSEQKLLPSWFGKLNDKGAPKNSLLLTQLIVQIFLIVTYFVADAYNVFVYLCTAVIMICYALVGLYLFKLGIQEKKTSNIIIGFIAAAFQILALYYSGWQFVWLSLILYAVGFILYALGKKEYGTKMSTAELIATFILTVLGILAVFGVYGNWLGLQDALGIDGNTLLVAVVPLIVVTFIVYFVVRSDINKKGIKN
>NZ_CP015900.1|WP_081196878.1|2074600_2075545_-|carbamate-kinase
MVRRMVVALGGNAILTDDPTAKAQERALETTAEQLIPLIRNNDVEMVVTHGNGPQVGNLLLQQLAADSPKNPAMPIDTAVAMTQGQIGFWMGQAFTRALIKNKMERVPVISVVTRTVVDKDDSAFEKPTKPIGPFYDEKGLAEMKAQYPDWTFVEDSGRGYRRVVPSPKPTRIVEAEAIKPLISSSVLVTVSGGGGIPVIETQEGYEGVEAVIDKDFSAAKVSELVEVDNLLILTAVDNVFVNFNKPNQKKLETVTMAEMKAYIKEGQFAAGSMLPKVEAAMEFVTRTGRPATITSLENLEDFLNNDSGTKIIP
>NZ_CP015900.1|WP_021165024.1|2073206_2074337_-|aminotransferase
MELVQFGCEDWLNVWEKSATIDIAQSTIDSLSLEEVLAFEEDKGEAFMSQMMKEKFSYGWIEGSPAFKSEVAKLYKRVSEDNILSTNGATGANFLTILGLIGQGDHVIAQYPSYQQLYDWPKTLGAQVDYWKIKEENHWLPQIEDLRRLVKPNTKLICLNNAAQPTGAIMSPDFLAEVVEIARSVDAYILCDEVYLPLDEETPYAPIADLYEKGISTNSISKTYSVPGIRVGWVATQDRDLCNEFRKIRDYTLICTGVFDDALASLVLKHKDKVLARARDIVKGNLSILKEWVENEPLVSMVYPNAVSVSFVKFEQLDPMKTEDFAIQLLREKGVLIIPGNRFDLPGYARIGYCTDEKTLRQGLQLLSEFLREYKG
>NZ_CP015900.1|WP_081196877.1|2071523_2073017_-|amino-acid-permease
MENKKTKGISLFALLAIIISGAIGGGVFNLANDLARGSTPGGVVISWLFIGFGILMLVLSFNRLITIKPDLSGVSDYARAGFGDFVGFLSGWGYWISAWTGTIGFAVLMMTSADYFFLGKFANSNGSLTILSVIIVSIISWILMLLVDRGVETAAAVNAIVMIAKLIPLVVFSITGIILFKANIFTQHFWQTFTTNFAADGSVKDFVWHAMTASGLLSQIKGSLLVMVWVFVGIEGAAMMGNRAKKKSDTAKATVIGLAVLLVIYVLLSLLPYGYMDQASLANVKAPGLVYILNEMVGGWGGSLMAVGLMISLLGAWLSWTMLPVEATQQLAEQKLLPSWFGKLNKYHAPSNSLLITQLMIQIFIIITYFVANAYNVFIYMATAVIMICYALVGAYLFKIGLKEASVKNILIGFFTFAFQALALYLSGWQYVWLAMILYTIGFLLFIGAKKESHQSISVKEWLGMLVVTVLGVLAIVVLICGAKAGTGFDLRGLLGF
>NZ_CP015900.1|WP_081196879.1|2090006_2090897_+|IS982-family-transposase
MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIIDSFPIPLCQPIRNFRSKVLGDYENVGYNATKGQYFYGCKCHALVSESGYVIDYTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKEIDLITPVRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMAK
>NZ_CP015900.1|WP_081196880.1|2093555_2095601_+|MnhB-domain-containing-protein
MKKRTVLILVALFFCFILLSKVGADTSSGSIPGIDLPDQNTLDDLNSSADDAQNAVDDIKDASDDAINKELGDDSTNYELGDDKTPLYVYTSYLDTDNKIKVTVNMGVQGVFYIAKQEYSFTKWIDNMFSKINVVKDYGKVVLASGKTVYDSLLSPSNPSFWLIATFILYSLLRAFLKGHLAKTVIVIFGLLILNSSFFNLGGKVIDTVQTKSADINTSVIEKIKIGGVSNGKPDLLQTMVITPFERMNFDNDKQYGTKSENVNKLINSGGDAGKVADIRKAKKVSHLRFNEIGDKFSVALGAVINNFVLGCGVLLFKLGALIAGIAFLVFLLVAPIVAFLVFLSVFEQAGKNLVVKTGVTLILSVLLGYATTLFLSLNNFLDTIFGGAGANYLFMSIAKVIVYVILFKFRGFFFSVLGNASSAITNNRAFNAMDTAFSRAKQRTLQPILADGTAGIIAGKTFAKDINYKVGTGAINRHRSENRFKKYGESMKNILDPNSDEKKRNKATKQKERFEKRFEKKNKKAEKKQQNTQTSETKKKRASDKVAPYSDMNKAQPKTETGKNLKYLKQKSEQKVEHDKKLEQLRPATERMVKNTQQNYEKKHQSAESRNQAIVKGVKANQEQKASAQRMAQRFEKNKQRFSPNSNKPTKTSVKQSVKSEDIKRENTQINRPTKIKNEL
>NZ_CP015900.1|WP_152023984.1|2097047_2098159_+|IS3-family-transposase
MQKRYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYSKSNESSVSKADFLELKRQLAKVKEERDNLKKSIDHIRREKEVSAADMAQTIQTLALNVRLSCQLLDVPESSYYERINRHLSKTQLRRQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKPGYSLSDHINRKNLIQAEPTKKNKVWSTDIAYIPTQQGWAYLSTIMDRYTKKVIAWDLGKRMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPYHNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEKVSA
>NZ_CP015900.1|WP_081196881.1|2098649_2100377_-|pyruvate-oxidase
MTKINAADAMLKVIEDWGVKNIYGLPGGSIDSTMNALYNRKDTLNYIQVRHEEVGALAAVGEAKVTGEIGVTFGSAGPGAVHLLNGLYDAQYDHVPVLALVGQVPTSAMNTNYFQELNENPMFADVSVYNRTVMTAEQMPAVVDEAIRQAYAKRGVAVITIPKDLGWQEIEDNYISSANLYQKPLPLEPDSERIQQAWKILKEAKHPLIYIGQGTRGAREEVLALSKMLQAPILSSALAKGIVPDNAPAYMGSAGRVASKPRVEIASNTDAVLFLGSDMPFQSFFIPEDAKYIQVDIDGTKFGRRHQVDLAILADAKLTIKKLMEIGEQLPETAWYRAALADKENWVEWLEKRSLIDSSPLEVEPVFKAINEMATDDAIFQVDVGNVTIDGMRLLDTSKNQRFTTSGWYATMGYALPAAIGAKSQYPNRQVWSISGDGAWAMVMPDILTQVKYHLPIINVVLTNKSLGFIEAEQDDAKQPHSGIDLIGANFGASAAALGAVGFDVNNLSELKEAFAKAKETDRPVVINVNIFDHRPLPVEQLKLDSSIYGEETVEAFEKEYQTQGLIPFSKLIKE
>NZ_CP015900.1|WP_015082898.1|2100626_2101583_-|serine-hydrolase
MKNQQEFLAMIEDYLERDVFPGVNFAILEGEEVSEYLFGKAALIPEPIALTPGKKWDLASLTKVIGTGTAVIDLVLAGKLELDAPLQKYYAKFTDSTVSLRQLLTHTSGIDPYIPNRDKLGFFELTEAINQIRVTDDKSFKYTDINFILLGFLLEEYYDESLDYIFNKNIFKNWEMKQTSFGSVENAVPTSQNIPLGTVHDPKAQVLKNHCGSAGLFSTLSDMILFSQAYFREEKYLELLKNYADGAKERSLAWDLPAENNDWLLHTGYTGTFILINPRIKKAVVFLSNRVHLKDNREKWIEERDRLIKFLINHLSLD
>NZ_CP015900.1|WP_011677117.1|2101655_2102435_-|hypothetical-protein
MSEIINHITAFQPVYRVLHREENLDFYRGVLGFKVLVEEGAMVWLGGHEAKKDRFQLEESPGFHPVEGLKKHGQTVIKANSSEIEQLIVRNLDKIAKIYQGKNGLAFTALSPEAGLFLVSSDSLTDLPALTEINKSEIKLNLDKNFKGLSDFEITAMNLNVADKSIIEFYESVFDLKAIDGKIEFPFVTLTLNVEESEDLTAGTDEVLDLEFLIFMIDKDFDLKAFANQFSEANGTYIDASAKTFSLEVPDHAELWFVK
>NZ_CP015900.1|WP_011677119.1|2102896_2103226_-|hypothetical-protein
MEFEEFFINNQLMKLIRETVLSIFPEAQERISYGMPAWFNGKTVLIYAQPQKHHLGIYPRPNFIEKHLEVLKQQYECSKGTIKVPYGIEHGELRKLVSDVINWNLTHFT
>NZ_CP015900.1|WP_021165011.1|2105363_2106146_+|CPBP-family-intramembrane-metalloprotease
MNIEKLQFLAKYRWIIVLILALIFSGLSVSIFHLPFLMTALVLSVIGLIFAYHKSVWLVLFILSNLPMLVSTIFASQHHFSTLDTIIFFIIFIFTIISSYLIARKAELIPKLSWKYFPPLRIILGFVLLFLVSILTGIFAQIFNQSPTTTNQESLNELQKVIPIAVFATQTLAASFLEELVYRVGIFELIFKNQKYFAFLTTMLLFAFMHGPTDVYSWLTYGLMSLVLTGLYAKYSNFYLNMSVHFLWNLFGLVIALMVK
>NZ_CP015900.1|WP_011677122.1|2106181_2107051_-|aquaporin-family-protein
MDVTWTVKYITEFVGTALLIIMGNGAVANVELKGTKAHAQSWMIIGWGYGLGVMLPAVAFGNITSQINPAFTLGLAASGLFPWAHVAQYIIAQVLGAMFGQLLIVMVYRPYYLKTQNPNAILGTFSTIDNVDDNSEKTRLGATINGFLNEFLGSFVLFFGAVAATNIFFGSQSITWMTNYLKGQGADVSSSDVMNQIWVQASGASASKMIAHLFLGFLVMGLVVALGGPTGPGLNPARDFGPRLVHSLLPKSVLGEAKGSSKWWYAWVPVLAPILASLAAVALFKMIYL
>NZ_CP015900.1|WP_081196882.1|2107222_2109514_+|Xaa-Pro-dipeptidyl-peptidase
MRFNHFSIVDKNFDEQLAELDQLGFRWSVFWDEKKILKDFLIQSPSDMTDLQATAELDVIEFLKSSIELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAEMTTENIISAFYYLLCTRRKNGMILVEHWVSEGLLPLDNHYHFFNDKSLATFDSSLLEREVLWVESPVDSEQRGENDLIKIQIIRPKSTEKLPVVMTASPYHLGINDKANDLALHDMNVELEEKTSHEIHVEQKLPQKLSAKAKELPIVDKAPYRFTHGWTYSLNDYFLTRGFASIYVAGVGTRSSDGFQTSGDYQQIYSMTAVIDWLNGRARAYTSRKKTHEIKASWANGKVAMTGKSYLGTMAYGAATTGVEGLEVILAEAGISSWYNYYRENGLVRSPGGFPGEDLDVLAALTYSRNLDGADFLKGNAEYEKRLAEMTAALDRKSGDYNQFWHDRNYLINTDKVKADVLIVHGLQDWNVTPEQAYNFWKALPEGHAKHAFLHRGAHIYMNSWQSIDFSETINAYFVAKLLDRDLNLNLPPVILQENSKDQVWTMMNDFGANTQIKLPLGKTAVSFAQFDNHYDDETFKKYSKDFNVFKKDLFENKANEAVIDLELPSMLTINGPVELELRLKLNDTKGFLSAQILDFGQKKRLEDKARVKDFKVLDRGRNFMLDDLVELPLVESPYQLITKGFTNLQNQNLLTVSNLKADEWFTIKFELQPTIYHLEKADKLRVILYSTDFEHTVRDNRKVTYEIDLSQSKLIIPIESVKN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13889 : 80293

Bacillus_phage(20.0%)

integrase,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675087.1\|13889_14456_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_081196391.1\|14456_17945_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_162494667.1\|18261_18531_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_021165758.1\|18561_18936_+	septum formation initiator family protein	NA	NA	NA	NA
WP_081196393.1\|18935_19259_+	RNA-binding protein	NA	NA	NA	NA
WP_021165759.1\|19399_20737_+	hypothetical protein	NA	NA	NA	NA
WP_021165760.1\|20733_22002_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_011675094.1\|21982_22534_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.4e-09	29.7
WP_021165762.1\|22739_24827_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	G8DDJ2	Micromonas_pusilla_virus	1.6e-106	49.2
WP_081196394.1\|25893_27717_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_081196395.1\|27776_29711_+	transcription antiterminator	NA	NA	NA	NA
WP_061777958.1\|29757_30189_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_061777957.1\|30337_31504_+	mannitol-1-phosphate 5-dehydrogenase	NA	NA	NA	NA
WP_032940659.1\|32163_32901_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_021165768.1\|33636_34002_+	hypothetical protein	NA	NA	NA	NA
WP_011675105.1\|34934_35288_+	DUF1648 domain-containing protein	NA	NA	NA	NA
WP_011675106.1\|35409_35568_+	hypothetical protein	NA	NA	NA	NA
WP_152023958.1\|35627_36739_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_011675108.1\|37221_37674_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011675109.1\|37758_38001_+	TM2 domain-containing protein	NA	NA	NA	NA
WP_014571770.1\|38094_39717_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_011675112.1\|39926_40448_+	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	1.0e-30	42.1
WP_015081831.1\|40909_42085_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_011675114.1\|42182_42938_+	DNA repair protein RecO	NA	NA	NA	NA
WP_021165938.1\|43089_44508_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.3e-40	27.0
WP_081196396.1\|44726_46292_-	dienelactone hydrolase	NA	NA	NA	NA
WP_011834176.1\|46284_47265_-	alpha-ketoacid dehydrogenase subunit beta	NA	NA	NA	NA
WP_011675118.1\|47267_48392_-	thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha	NA	NA	NA	NA
WP_081196397.1\|48480_49482_-	lipoate--protein ligase	NA	NA	NA	NA
WP_011675120.1\|49674_50529_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	7.8e-12	31.4
WP_081196398.1\|51685_52576_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011834182.1\|52728_53754_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_011675125.1\|54253_54691_+	OsmC family protein	NA	NA	NA	NA
WP_081196399.1\|54852_56166_+	APC family permease	NA	NA	NA	NA
WP_011675127.1\|56244_57240_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
WP_081196400.1\|57342_58155_-	HAD family hydrolase	NA	NA	NA	NA
WP_032950637.1\|58605_60243_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.8e-50	26.1
WP_081196401.1\|60743_60998_+	hypothetical protein	NA	NA	NA	NA
WP_011675131.1\|61116_61941_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011675132.1\|62100_62682_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_081196402.1\|62875_63766_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196403.1\|63876_64359_-	hypothetical protein	NA	NA	NA	NA
WP_021036527.1\|64615_65896_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A2I2L687	Orpheovirus	4.2e-09	26.5
WP_011675135.1\|66148_66982_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_081196398.1\|67330_68221_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011675137.1\|68393_68861_+	universal stress protein	NA	NA	NA	NA
WP_021036528.1\|68987_69185_+	hypothetical protein	NA	NA	NA	NA
WP_081196404.1\|69220_69841_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_081196405.1\|69908_71078_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_011675141.1\|71088_71679_+	flavin reductase family protein	NA	NA	NA	NA
WP_014571790.1\|71887_73153_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.7e-53	35.0
WP_023163579.1\|73240_73492_-	hypothetical protein	NA	NA	NA	NA
WP_081196406.1\|73621_74842_-	hypothetical protein	NA	NA	NA	NA
WP_014571793.1\|75132_75396_-	hypothetical protein	NA	NA	NA	NA
WP_127093928.1\|75492_75744_-	hypothetical protein	NA	NA	NA	NA
WP_014571795.1\|76093_77179_-	cell division protein FtsK	NA	NA	NA	NA
WP_152023959.1\|78267_78975_+	hypothetical protein	NA	NA	NA	NA
WP_152023960.1\|79146_80293_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.9e-46	41.0

DBSCAN-SWA_2

433975 : 446132

uncultured_virus(30.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675460.1\|433975_434293_+	thioredoxin family protein	A0A0K2FIM3	Achromobacter_phage	9.0e-06	31.9
WP_011675461.1\|434398_435025_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_021216210.1\|435186_436527_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_021165898.1\|436617_437007_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	2.0e-23	47.4
WP_011675464.1\|437125_437410_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.3e-13	43.0
WP_021213999.1\|437496_439125_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.7e-156	56.4
WP_011675466.1\|439176_439989_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	1.5e-33	38.1
WP_011675468.1\|440178_441606_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	3.9e-32	32.9
WP_003131580.1\|441598_442300_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_015082045.1\|442477_443113_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.6e-73	66.0
WP_011675470.1\|443245_444106_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.1e-64	44.8
WP_011834464.1\|444155_444938_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_011675472.1\|444930_445257_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_011834466.1\|445256_446132_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.1e-101	66.4

DBSCAN-SWA_3

550850 : 657044

Lactococcus_phage(40.54%)

protease,head,holin,portal,terminase,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130410.1\|550850_551798_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
WP_011675560.1\|552108_552300_+	DNA-directed RNA polymerase subunit beta	NA	NA	NA	NA
WP_011675561.1\|552475_553759_+	trigger factor	NA	NA	NA	NA
WP_081196509.1\|560618_562532_+	DNA primase	A0A1S5REW9	Helicobacter_phage	3.9e-43	33.5
WP_011675564.1\|562608_563952_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	7.2e-36	32.6
WP_081196511.1\|566494_567364_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_032951356.1\|567373_568639_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_021166304.1\|568867_569212_+	hypothetical protein	NA	NA	NA	NA
WP_081196512.1\|569257_571504_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.3e-126	39.9
WP_011675569.1\|571629_572100_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_021166305.1\|572324_573338_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_081196513.1\|573561_574197_-	peptide deformylase	Q6VSW0	Vibrio_phage	3.8e-11	35.7
WP_011675572.1\|574351_574756_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_011675573.1\|574817_576896_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_011675575.1\|579083_579539_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_011675576.1\|579815_580568_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_011675577.1\|580753_581716_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_081196514.1\|581890_582649_-	HAD-IIB family hydrolase	A0A2P1EM96	Moumouvirus	4.7e-08	25.9
WP_063283777.1\|582743_583334_-	ECF transporter S component	NA	NA	NA	NA
WP_014573068.1\|583350_583887_-	phosphopantothenoylcysteine decarboxylase	Q9J5A8	Fowlpox_virus	6.8e-22	34.9
WP_021166323.1\|583879_584575_-	phosphopantothenate--cysteine ligase	Q9HH70	Methanothermobacter_phage	1.0e-17	31.7
WP_011675581.1\|584721_584907_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_011675583.1\|587451_587895_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_152023965.1\|588104_589215_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	3.6e-49	41.4
WP_014573151.1\|589295_589718_+	DUF722 domain-containing protein	Q9AYX5	Lactococcus_phage	5.5e-75	100.0
WP_081196515.1\|590570_591023_+\|terminase	phage terminase small subunit P27 family	Q9AZM7	Lactococcus_phage	4.2e-81	98.7
WP_081196516.1\|591022_592837_+\|terminase	terminase large subunit	Q9AZM6	Lactococcus_phage	0.0e+00	98.5
WP_081196518.1\|593006_594086_+\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	1.9e-196	98.6
WP_021166232.1\|594085_594673_+\|head,protease	HK97 family phage prohead protease	Q9AZM3	Lactococcus_phage	8.4e-106	98.5
WP_021166230.1\|595986_596292_+	hypothetical protein	Q9AZM1	Lactococcus_phage	2.9e-49	97.0
WP_021166229.1\|596278_596614_+\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	1.4e-52	94.6
WP_032950353.1\|596610_597096_+	HK97 gp10 family phage protein	Q9AZL9	Lactococcus_phage	4.8e-83	98.1
WP_010905383.1\|597092_597488_+	DUF806 family protein	Q9AZL8	Lactococcus_phage	1.4e-67	100.0
WP_063283916.1\|597489_598095_+	hypothetical protein	Q9AZL7	Lactococcus_phage	1.4e-103	95.0
WP_021166227.1\|598154_598499_+	hypothetical protein	Q9AZL6	Lactococcus_phage	1.6e-27	98.2
WP_014573136.1\|598546_598687_+	hypothetical protein	NA	NA	NA	NA
WP_081146292.1\|598668_600867_+	tape measure protein	Q9AZL5	Lactococcus_phage	1.3e-289	91.2
WP_021212325.1\|603039_603276_+	hypothetical protein	A0A1P8BKU6	Lactococcus_phage	4.2e-32	93.6
WP_081196519.1\|603288_603516_+\|holin	holin	Q9AZR4	Lactococcus_phage	2.0e-31	95.8
WP_081196520.1\|603528_604596_+\|holin	phage holin	A0A1P8BKR7	Lactococcus_phage	1.5e-124	97.3
WP_081196521.1\|606139_607741_+	hypothetical protein	NA	NA	NA	NA
WP_031286545.1\|607658_608597_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	7.9e-82	50.6
WP_011676899.1\|609112_610387_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_011676898.1\|610509_611286_+	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_081196522.1\|611285_613163_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	9.8e-23	32.4
WP_010906184.1\|613333_613603_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_021165717.1\|613686_614478_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	2.4e-31	33.2
WP_021165716.1\|614695_616072_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	5.5e-31	35.7
WP_011835788.1\|616173_616758_+	NUDIX hydrolase	NA	NA	NA	NA
WP_021165715.1\|616750_617029_+	hypothetical protein	NA	NA	NA	NA
WP_011676892.1\|617056_617737_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_014572089.1\|617873_618377_+	hypothetical protein	NA	NA	NA	NA
WP_011676890.1\|618394_619069_+	HD domain-containing protein	NA	NA	NA	NA
WP_031286544.1\|619197_620508_+	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	6.3e-61	31.3
WP_021165713.1\|621999_623325_+	MFS transporter	NA	NA	NA	NA
WP_081196523.1\|623336_624182_+	aldo/keto reductase	A0A1V0SDE7	Indivirus	6.8e-32	33.3
WP_081196524.1\|624319_625432_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_081196525.1\|625508_626399_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014572097.1\|626591_627320_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	A0A2D1A6G0	Rhodococcus_phage	4.6e-05	27.7
WP_021165708.1\|627436_628306_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	8.5e-14	34.6
WP_011835775.1\|628468_629839_+	cell division protein FtsA	NA	NA	NA	NA
WP_081196526.1\|629868_631122_+	cell division protein FtsZ	NA	NA	NA	NA
WP_021165705.1\|631125_631803_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_081196527.1\|631836_632427_+	cell division protein SepF	NA	NA	NA	NA
WP_011676877.1\|632426_632702_+	YggT family protein	NA	NA	NA	NA
WP_011676876.1\|632698_633490_+	RNA-binding protein	NA	NA	NA	NA
WP_021165703.1\|633546_634482_+	DivIVA domain-containing protein	NA	NA	NA	NA
WP_011676874.1\|634931_637730_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.9e-83	26.1
WP_011835767.1\|637789_637906_-	DUF4044 domain-containing protein	NA	NA	NA	NA
WP_021165701.1\|637964_638147_-	hypothetical protein	NA	NA	NA	NA
WP_003132374.1\|638390_639578_+	elongation factor Tu	A0A076FFS6	Aureococcus_anophage	2.0e-34	29.4
WP_014572106.1\|639666_640011_-	DUF1831 domain-containing protein	NA	NA	NA	NA
WP_031286538.1\|640036_641161_-	cysteine desulfurase	H7BUW1	unidentified_phage	4.0e-32	37.1
WP_011676870.1\|641460_641892_+	universal stress protein	NA	NA	NA	NA
WP_081196528.1\|641996_642962_-	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	1.0e-36	32.8
WP_021165699.1\|643326_644472_+	hypothetical protein	NA	NA	NA	NA
WP_021165698.1\|644752_647062_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_011676866.1\|647330_648101_+	hypothetical protein	NA	NA	NA	NA
WP_081196529.1\|648206_648806_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_021165696.1\|648819_649413_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_021211905.1\|649425_650772_+\|tRNA	cysteine--tRNA ligase	A0A2L2DK39	Acanthamoeba_polyphaga_mimivirus	1.0e-50	30.7
WP_011676862.1\|650764_651166_+	Mini-ribonuclease 3	NA	NA	NA	NA
WP_011835756.1\|651280_651649_+	DUF1033 family protein	NA	NA	NA	NA
WP_011676860.1\|651781_652345_+	hypothetical protein	NA	NA	NA	NA
WP_021165694.1\|652728_654606_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_081196530.1\|656153_657044_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

849904 : 972989

112

Bacillus_phage(20.0%)

integrase,transposase

attL 955602:955620|attR 978797:978815

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015082326.1\|849904_850795_-\|transposase	IS982-like element IS982B family transposase	NA	NA	NA	NA
WP_021166087.1\|850925_851801_+	ROK family protein	NA	NA	NA	NA
WP_021166086.1\|852010_853552_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	7.0e-19	30.3
WP_081196571.1\|853884_854775_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_081196572.1\|854785_855649_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_081196573.1\|855720_857355_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_021166083.1\|857474_858173_+	DUF624 domain-containing protein	NA	NA	NA	NA
WP_081196574.1\|858195_860610_+	hypothetical protein	NA	NA	NA	NA
WP_081196575.1\|860653_862033_-	MATE family efflux transporter	NA	NA	NA	NA
WP_011676436.1\|863213_863633_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_021166080.1\|863893_865693_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
WP_081196494.1\|868084_868975_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032940184.1\|869155_869545_-	transcriptional repressor	NA	NA	NA	NA
WP_081196576.1\|869668_870358_+	VIT family protein	NA	NA	NA	NA
WP_011834953.1\|870357_871038_+	VIT family protein	NA	NA	NA	NA
WP_014572455.1\|871113_871857_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011834955.1\|871966_872386_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_031286704.1\|872397_873036_+	nitroreductase family protein	NA	NA	NA	NA
WP_021166076.1\|873050_873410_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_015082578.1\|873863_875234_+	anthranilate synthase component I	NA	NA	NA	NA
WP_011676425.1\|875285_875867_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	5.5e-33	45.1
WP_021166075.1\|875871_876879_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	8.6e-50	35.9
WP_021212238.1\|877076_877571_+	DUF2806 domain-containing protein	NA	NA	NA	NA
WP_011676422.1\|877624_877879_+	hypothetical protein	NA	NA	NA	NA
WP_116368841.1\|878222_878495_+	DUF3977 family protein	NA	NA	NA	NA
WP_021166281.1\|878487_878856_+	VOC family protein	NA	NA	NA	NA
WP_011676418.1\|878862_879657_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.7e-29	35.5
WP_014572463.1\|879646_880705_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_021166279.1\|880694_881213_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011676415.1\|881311_882517_+	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_021166278.1\|882516_883278_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_162494675.1\|883453_884296_+	PRD domain-containing protein	NA	NA	NA	NA
WP_081196577.1\|884396_886307_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_021166276.1\|886354_887791_+	glycoside hydrolase family 1 protein	NA	NA	NA	NA
WP_011676410.1\|887957_888578_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011676409.1\|888789_890013_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-28	36.9
WP_011676408.1\|890005_891727_+	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_011834970.1\|891917_892088_+	DUF3042 family protein	NA	NA	NA	NA
WP_152023968.1\|892460_893833_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	4.6e-54	43.1
WP_081196578.1\|893884_894487_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	8.3e-93	80.0
WP_014572475.1\|895155_895698_+	ParB-like nuclease domain-containing protein	A0A220GKT8	Streptococcus_phage	5.8e-61	66.1
WP_011676403.1\|895727_896030_+	helix-turn-helix transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	6.0e-07	51.7
WP_021166271.1\|896311_897256_+	cation transporter	NA	NA	NA	NA
WP_011676401.1\|897309_897741_+	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_061778303.1\|897811_898732_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.9e-32	37.7
WP_011834977.1\|898920_899517_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011676397.1\|900845_901034_+	hypothetical protein	NA	NA	NA	NA
WP_011676396.1\|901046_901709_+	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_011676395.1\|901695_902088_+	cytidine deaminase	NA	NA	NA	NA
WP_011676394.1\|902355_903411_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	5.1e-61	41.5
WP_011676393.1\|903597_904305_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_021166266.1\|904312_904753_-	DUF4395 domain-containing protein	NA	NA	NA	NA
WP_011676391.1\|904850_906404_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-33	37.3
WP_011676390.1\|906393_907104_-	response regulator transcription factor	A0A1V0SGR9	Hokovirus	5.3e-06	30.1
WP_011676389.1\|907287_907623_+	putative DNA-binding protein	NA	NA	NA	NA
WP_014572291.1\|908466_909357_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676387.1\|909416_909947_+	hypothetical protein	NA	NA	NA	NA
WP_010890648.1\|910856_911537_-\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5
WP_081196579.1\|912298_913261_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_081196580.1\|913851_914742_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011834991.1\|914966_915521_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_088793343.1\|915974_917085_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_011675801.1\|917189_918020_-	SP_1767 family glycosyltransferase	NA	NA	NA	NA
WP_014572862.1\|918325_919744_+	dipeptidase PepV	NA	NA	NA	NA
WP_011675803.1\|919872_920232_+	holo-ACP synthase	NA	NA	NA	NA
WP_011675804.1\|920275_921379_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.3e-30	28.1
WP_011675805.1\|921539_921968_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_011675806.1\|922106_923414_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011675807.1\|923542_924460_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.0e-22	30.1
WP_081196581.1\|928134_928638_+	hypothetical protein	NA	NA	NA	NA
WP_021165395.1\|928647_929025_+	hypothetical protein	NA	NA	NA	NA
WP_031286442.1\|929315_929600_+	hypothetical protein	NA	NA	NA	NA
WP_081196582.1\|929576_930452_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196583.1\|930640_932581_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.2e-57	29.7
WP_011835499.1\|932769_933627_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.6e-39	39.0
WP_031286477.1\|933797_935051_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.2e-45	32.3
WP_011675817.1\|935053_935293_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_081196584.1\|936468_937620_+	glycerate kinase	W6LM47	Streptococcus_phage	1.1e-45	38.5
WP_081196952.1\|937844_938702_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_021165631.1\|938702_939203_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021165632.1\|939278_940085_+	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_011675823.1\|940081_940528_+	transcriptional regulator	NA	NA	NA	NA
WP_011675824.1\|940707_942375_+	DNA repair protein RecN	NA	NA	NA	NA
WP_015082274.1\|943068_943635_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011835491.1\|943729_944251_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_101944709.1\|944272_945181_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_032940916.1\|945443_946385_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_011675830.1\|946540_946921_+	cell division protein FtsL	NA	NA	NA	NA
WP_021214282.1\|946917_949215_+	penicillin-binding protein	NA	NA	NA	NA
WP_011835486.1\|949289_950279_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_011675833.1\|950477_950762_+	hypothetical protein	NA	NA	NA	NA
WP_081196585.1\|950915_952433_+	ABC transporter permease	NA	NA	NA	NA
WP_081196586.1\|952540_953203_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-22	32.7
WP_011675836.1\|953562_954450_+	LysR family transcriptional regulator	NA	NA	NA	NA
955602:955620	attL	NA	NA	NA	NA
WP_011675837.1\|956912_957587_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
WP_011675838.1\|957746_958091_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_011675839.1\|958266_958683_-	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_011675840.1\|959019_959481_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_081196588.1\|959734_960244_+	cell division protein	NA	NA	NA	NA
WP_014572838.1\|960236_961565_+	glycosyltransferase	NA	NA	NA	NA
WP_011835479.1\|961795_962353_+	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_011675844.1\|962415_962661_-	hypothetical protein	NA	NA	NA	NA
WP_011675845.1\|962933_963659_+	nicotinamide mononucleotide transporter	A0A2P0ZKW0	Lactobacillus_phage	1.4e-14	28.7
WP_014572836.1\|964211_964637_+	universal stress protein	NA	NA	NA	NA
WP_015082285.1\|964804_965167_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_011675849.1\|965228_965762_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_081196589.1\|966433_967324_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196590.1\|967458_969330_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_003131392.1\|969517_969850_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_021165730.1\|969984_970959_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	7.3e-30	28.4
WP_021165731.1\|971583_971826_+	hypothetical protein	NA	NA	NA	NA
WP_152023969.1\|971877_972989_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	2.8e-49	41.4
978797:978815	attR	NA	NA	NA	NA

DBSCAN-SWA_5

978889 : 1053387

Streptococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196525.1\|978889_979780_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196591.1\|979933_981178_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_021165126.1\|983813_985364_+	ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	1.3e-25	23.6
WP_011675866.1\|988876_989776_+	EamA family transporter	NA	NA	NA	NA
WP_011835457.1\|989898_990663_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.5e-27	28.4
WP_081196592.1\|990643_992224_+	ABC transporter permease	NA	NA	NA	NA
WP_014572814.1\|992398_993244_+	VOC family protein	NA	NA	NA	NA
WP_081196593.1\|993309_993957_+	HAD family hydrolase	NA	NA	NA	NA
WP_011675870.1\|994110_996066_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.7e-142	44.7
WP_011675871.1\|996164_996350_+	hypothetical protein	NA	NA	NA	NA
WP_021165134.1\|996573_997311_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.2e-80	58.3
WP_021165135.1\|997483_998125_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_015082299.1\|998282_998747_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_021165138.1\|1000284_1001004_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_081196594.1\|1001282_1002173_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165141.1\|1002336_1003245_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_152023963.1\|1005285_1006396_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_081196595.1\|1006481_1009589_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_081196596.1\|1009689_1010580_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_032949918.1\|1011944_1012865_+	LCP family protein	NA	NA	NA	NA
WP_011675881.1\|1013051_1014287_+	phosphopentomutase	NA	NA	NA	NA
WP_021165163.1\|1014344_1014614_+	hypothetical protein	NA	NA	NA	NA
WP_011675883.1\|1014684_1015389_+	purine-nucleoside phosphorylase	NA	NA	NA	NA
WP_081196597.1\|1016645_1017092_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_011675885.1\|1017175_1017502_+	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_011675886.1\|1017661_1019329_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_081196598.1\|1019437_1020031_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.3e-16	44.7
WP_021165167.1\|1020173_1021022_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011675889.1\|1021290_1022178_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_021165168.1\|1022189_1022942_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-28	39.2
WP_011675891.1\|1022943_1023171_+	DUF4059 family protein	NA	NA	NA	NA
WP_014572788.1\|1023368_1024295_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.0e-85	51.1
WP_081196599.1\|1024435_1024684_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_081196600.1\|1024925_1027379_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.3e-104	44.2
WP_041168338.1\|1027397_1027985_+	isochorismatase family protein	NA	NA	NA	NA
WP_021165171.1\|1028062_1029121_+	endonuclease	NA	NA	NA	NA
WP_081196601.1\|1029144_1030086_-	UbiA family prenyltransferase	NA	NA	NA	NA
WP_011675898.1\|1030239_1030503_+	ACT domain-containing protein	NA	NA	NA	NA
WP_011675899.1\|1030619_1031957_+	PFL family protein	NA	NA	NA	NA
WP_081196525.1\|1032257_1033148_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011675901.1\|1033608_1034304_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_081196602.1\|1034300_1035047_+	D-alanyl-D-alanine carboxypeptidase family protein	NA	NA	NA	NA
WP_011675903.1\|1035061_1035466_+	hypothetical protein	NA	NA	NA	NA
WP_011675904.1\|1035613_1036657_+	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_014572780.1\|1036686_1037226_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_081196603.1\|1037297_1039121_+	molecular chaperone DnaK	A0A167RF67	Powai_lake_megavirus	9.8e-129	44.4
WP_081196604.1\|1039283_1041128_+	hypothetical protein	NA	NA	NA	NA
WP_081196605.1\|1041297_1043061_+	oleate hydratase	NA	NA	NA	NA
WP_032949940.1\|1043127_1044267_+	amidohydrolase	NA	NA	NA	NA
WP_011675960.1\|1044388_1045090_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_081196606.1\|1045172_1046090_+	1-phosphofructokinase	NA	NA	NA	NA
WP_031286338.1\|1046089_1047994_+	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_152023970.1\|1048077_1049447_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.1e-53	43.4
WP_081196953.1\|1049694_1051020_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_011675965.1\|1051483_1051885_+	hypothetical protein	NA	NA	NA	NA
WP_010890648.1\|1052706_1053387_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5

DBSCAN-SWA_6

1065637 : 1187237

Bacillus_phage(17.39%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196612.1\|1065637_1066528_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196613.1\|1066801_1067482_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-108	83.2
WP_081196614.1\|1067996_1068887_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676155.1\|1070614_1071406_+	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_081196615.1\|1073004_1073961_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_081196616.1\|1074740_1076048_+	histidinol dehydrogenase	NA	NA	NA	NA
WP_081196617.1\|1076048_1076657_+	imidazoleglycerol-phosphate dehydratase HisB	NA	NA	NA	NA
WP_162494689.1\|1076758_1077439_+	phosphotransferase	A0A193CJY5	Infectious_laryngotracheitis_virus	3.2e-08	25.6
WP_021165363.1\|1078332_1079112_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_081196619.1\|1079108_1079747_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	NA	NA	NA	NA
WP_031286434.1\|1079747_1080533_+	histidinol-phosphatase HisJ family protein	NA	NA	NA	NA
WP_011835164.1\|1080566_1081526_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_081196620.1\|1081948_1083490_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	3.1e-06	36.5
WP_011676141.1\|1083525_1084011_+	hypothetical protein	NA	NA	NA	NA
WP_081196621.1\|1084037_1084829_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_081196622.1\|1084969_1086001_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
WP_081196623.1\|1086002_1086461_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_021165356.1\|1086503_1086956_+	hypothetical protein	NA	NA	NA	NA
WP_081196624.1\|1087012_1088389_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
WP_015082459.1\|1088388_1088922_+	hypothetical protein	NA	NA	NA	NA
WP_014572613.1\|1088964_1089540_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
WP_081196625.1\|1089553_1090336_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.7e-14	27.5
WP_081196626.1\|1090455_1092168_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_021037263.1\|1093878_1094355_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_021211415.1\|1094400_1095423_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_014572605.1\|1095481_1096732_+	threonine ammonia-lyase IlvA	NA	NA	NA	NA
WP_011676302.1\|1096866_1097577_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_014572603.1\|1097616_1097997_+	RidA family protein	NA	NA	NA	NA
WP_081196627.1\|1098145_1098994_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_015082465.1\|1099259_1101386_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.2e-99	36.4
WP_081196628.1\|1101457_1102804_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_014572599.1\|1102853_1103924_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_021165347.1\|1104550_1105258_-	hypothetical protein	NA	NA	NA	NA
WP_014572597.1\|1105436_1105583_-	hypothetical protein	NA	NA	NA	NA
WP_061777907.1\|1106836_1107754_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_081196629.1\|1108429_1108762_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011676291.1\|1108924_1109992_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	1.2e-54	41.5
WP_152023971.1\|1110394_1111505_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.5e-50	41.8
WP_021214324.1\|1111922_1112780_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_081196630.1\|1112769_1115043_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_014572659.1\|1115202_1115856_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_081196631.1\|1115948_1118681_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.1e-43	23.3
WP_081196632.1\|1119155_1120442_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_011676184.1\|1120431_1120671_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_021165340.1\|1120706_1121930_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	2.4e-22	30.8
WP_015082475.1\|1121929_1123429_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9L3I8	Tupanvirus	1.8e-40	30.0
WP_021212171.1\|1123453_1123585_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_021212172.1\|1125230_1125983_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_081196633.1\|1126975_1129054_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.2e-63	31.4
WP_081196634.1\|1129265_1130156_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011869580.1\|1130159_1130741_-	HAD family hydrolase	NA	NA	NA	NA
WP_011869578.1\|1131201_1132125_-	DMT family transporter	NA	NA	NA	NA
WP_021211028.1\|1133302_1134163_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_081196635.1\|1134329_1134986_-	cytochrome O ubiquinol oxidase	NA	NA	NA	NA
WP_081196634.1\|1135127_1136018_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015082999.1\|1136646_1137843_-	amidohydrolase	NA	NA	NA	NA
WP_081196636.1\|1138508_1139192_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.4e-96	80.9
WP_152023972.1\|1139173_1140545_+\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	2.7e-54	43.1
WP_152023973.1\|1140602_1141750_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.2e-45	40.6
WP_061777887.1\|1142167_1142659_-	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_081196637.1\|1142977_1144981_-	ribonuclease R	Q0GXV6	Lactococcus_phage	3.2e-80	39.6
WP_011676161.1\|1145185_1145518_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081196638.1\|1146097_1146988_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014572641.1\|1147304_1147703_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021165383.1\|1147810_1148956_+	MFS transporter	NA	NA	NA	NA
WP_011835185.1\|1149062_1150727_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_061778299.1\|1150881_1152138_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011676167.1\|1152165_1153338_-	AI-2E family transporter	NA	NA	NA	NA
WP_101913726.1\|1153309_1154023_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_021165386.1\|1154024_1155632_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011676170.1\|1155676_1157047_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	3.8e-141	56.0
WP_021165388.1\|1157109_1157931_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_014572649.1\|1158068_1158773_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_088793343.1\|1159112_1160224_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_081196639.1\|1160260_1162606_-	HAD-IC family P-type ATPase	NA	NA	NA	NA
WP_021037230.1\|1163046_1163292_-	hypothetical protein	NA	NA	NA	NA
WP_088793343.1\|1164057_1165168_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_081196640.1\|1166070_1167252_-	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_081196641.1\|1167548_1168742_+	MFS transporter	NA	NA	NA	NA
WP_011676287.1\|1168741_1169641_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_021212201.1\|1169950_1171018_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_021212202.1\|1171065_1171866_-	ABC transporter permease	NA	NA	NA	NA
WP_021165292.1\|1171867_1172656_-	ABC transporter permease	NA	NA	NA	NA
WP_081196642.1\|1172652_1173933_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.7e-32	39.1
WP_015082419.1\|1174392_1175292_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_162494582.1\|1175334_1176003_-	niacin ECF transporter S component NiaX	NA	NA	NA	NA
WP_011676280.1\|1176186_1177077_-	homoserine kinase	NA	NA	NA	NA
WP_021165288.1\|1177081_1178368_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_032940951.1\|1178548_1179190_-	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	1.3e-48	47.7
WP_081196643.1\|1179315_1180599_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_014572580.1\|1180614_1181115_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_021165285.1\|1181117_1182191_-	dihydropteroate synthase	NA	NA	NA	NA
WP_011676274.1\|1182187_1183237_-	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	8.7e-37	45.1
WP_011676273.1\|1183316_1183667_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_011676272.1\|1183720_1184308_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_011676271.1\|1184304_1185540_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	58.6
WP_081196956.1\|1185788_1186295_-	dihydrofolate reductase	A0A1L7N103	Ralstonia_phage	3.7e-09	29.8
WP_011676268.1\|1186727_1187237_+\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA

DBSCAN-SWA_7

1244719 : 1369023

132

Lactococcus_phage(57.14%)

protease,holin,portal,integrase,transposase,tail,tRNA,capsid

attL 1241596:1241619|attR 1357384:1357407

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1241596:1241619	attL	NA	NA	NA	NA
WP_152023974.1\|1244719_1245831_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-49	41.4
WP_021165252.1\|1245867_1246254_-	hypothetical protein	NA	NA	NA	NA
WP_081196596.1\|1246402_1247293_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196958.1\|1247355_1250412_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_098404858.1\|1250401_1250959_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_021165248.1\|1251169_1252678_-	APC family permease	NA	NA	NA	NA
WP_011676116.1\|1252824_1253460_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011676115.1\|1253526_1255350_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	9.8e-20	38.8
WP_011676114.1\|1255622_1256288_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_032951080.1\|1256386_1257736_+	Mur ligase family protein	NA	NA	NA	NA
WP_021165245.1\|1257736_1258522_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_081196664.1\|1258586_1261193_-	ABC transporter permease	NA	NA	NA	NA
WP_011676110.1\|1261196_1261898_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-36	37.1
WP_081196665.1\|1262099_1262924_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	3.8e-72	55.7
WP_021165243.1\|1262980_1263469_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011676107.1\|1263465_1264938_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	3.6e-97	42.8
WP_063283889.1\|1265520_1266114_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_081196666.1\|1266128_1267340_-	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	3.3e-88	45.6
WP_011676103.1\|1267743_1267986_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_011676102.1\|1268093_1270115_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_021165239.1\|1270114_1271068_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_011676100.1\|1271067_1271715_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_011676099.1\|1271951_1272719_-	5'-nucleotidase	NA	NA	NA	NA
WP_032951092.1\|1272827_1273847_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	2.0e-54	43.1
WP_081196667.1\|1273912_1274413_-	glycopeptide antibiotics resistance protein	NA	NA	NA	NA
WP_011676097.1\|1274454_1275090_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.6e-56	54.5
WP_081196668.1\|1276440_1277091_+	ComF family protein	NA	NA	NA	NA
WP_011676095.1\|1277148_1277727_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_011676094.1\|1277743_1278199_-	diacylglycerol kinase	NA	NA	NA	NA
WP_081196669.1\|1278182_1278671_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_011676092.1\|1278761_1279256_-	NUDIX hydrolase	NA	NA	NA	NA
WP_021165232.1\|1279325_1280294_-	phosphate starvation-inducible protein PhoH	H6X2N1	Pseudomonas_phage	2.0e-48	48.4
WP_081196670.1\|1280367_1281900_-	divalent metal cation transporter	NA	NA	NA	NA
WP_003130646.1\|1282172_1282457_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_011676089.1\|1282458_1282794_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003130644.1\|1282796_1283111_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_081196671.1\|1283280_1284456_-	DUF998 domain-containing protein	NA	NA	NA	NA
WP_011676087.1\|1284448_1284847_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_081196672.1\|1285019_1286363_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.5e-28	32.6
WP_021165230.1\|1286415_1287231_+	sugar-phosphatase	NA	NA	NA	NA
WP_011676084.1\|1287369_1287735_+	hypothetical protein	NA	NA	NA	NA
WP_011676083.1\|1287769_1288543_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_015082362.1\|1288539_1289229_-\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_021165229.1\|1289221_1289878_-	endonuclease III	NA	NA	NA	NA
WP_011676080.1\|1289899_1290568_-	DnaD domain-containing protein	C5J987	Streptococcus_phage	1.1e-05	31.4
WP_081196673.1\|1290832_1293262_-	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_014572507.1\|1293792_1294398_-	hypothetical protein	NA	NA	NA	NA
WP_021165227.1\|1294394_1294991_-	hypothetical protein	NA	NA	NA	NA
WP_081196674.1\|1295317_1296208_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_080513955.1\|1296398_1297421_-	hypothetical protein	NA	NA	NA	NA
WP_061778003.1\|1297722_1298994_-	dihydroorotase	NA	NA	NA	NA
WP_021165209.1\|1299146_1299776_-	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	8.9e-05	26.2
WP_014572500.1\|1299893_1300034_+	hypothetical protein	NA	NA	NA	NA
WP_021212223.1\|1300196_1302104_-	ABC-F type ribosomal protection protein	A0A2K9L3Z8	Tupanvirus	4.0e-48	28.8
WP_081196675.1\|1302276_1302669_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_081196676.1\|1302890_1303541_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_081196677.1\|1303721_1305011_-	LysM peptidoglycan-binding domain-containing protein	A0A1P8BLG2	Lactococcus_phage	9.7e-240	97.4
WP_015974072.1\|1305007_1305274_-\|holin	phage holin	A0A1B1IMU0	Lactococcus_phage	1.6e-40	100.0
WP_011676503.1\|1307593_1307818_-\|holin	holin	A0A1B1IMU8	Lactococcus_phage	6.1e-33	100.0
WP_081196678.1\|1307831_1308863_-	hypothetical protein	Q77MU1	Lactococcus_phage	2.6e-195	99.4
WP_081196679.1\|1308859_1310017_-	hypothetical protein	A0A1B1IMY7	Lactococcus_phage	5.5e-218	99.7
WP_015974099.1\|1310021_1310918_-\|tail	phage tail family protein	Q77MU3	Lactococcus_phage	1.8e-168	100.0
WP_081196680.1\|1310930_1313585_-\|tail	phage tail protein	A0A1B1IMY1	Lactococcus_phage	7.5e-178	67.1
WP_081196681.1\|1313569_1313959_-	DUF5361 domain-containing protein	A0A1P8BMT6	Lactococcus_phage	1.5e-63	99.2
WP_015968441.1\|1313973_1314234_-	hypothetical protein	A0A1B1IMY4	Lactococcus_phage	2.7e-40	100.0
WP_081196682.1\|1314276_1314834_-\|tail	phage tail protein	A0A1P8BMS0	Lactococcus_phage	5.7e-96	96.2
WP_081196683.1\|1314844_1315180_-	hypothetical protein	A0A1B1IMY2	Lactococcus_phage	1.6e-53	99.1
WP_004254320.1\|1315180_1315417_-	hypothetical protein	A0A1P8BMT2	Lactococcus_phage	4.8e-36	100.0
WP_081196684.1\|1315409_1315748_-	hypothetical protein	Q38120	Lactococcus_phage	1.5e-59	98.2
WP_081196685.1\|1315734_1316133_-	hypothetical protein	A0A1B1IMX8	Lactococcus_phage	2.4e-64	97.7
WP_021211847.1\|1316134_1316434_-	hypothetical protein	Q38118	Lactococcus_phage	9.0e-48	98.0
WP_081196686.1\|1316448_1317345_-\|capsid	phage major capsid protein	A0A1B1IMW9	Lactococcus_phage	3.7e-169	99.7
WP_015968434.1\|1317348_1317813_-	DUF4355 domain-containing protein	A0A1B1IMS4	Lactococcus_phage	4.0e-79	100.0
WP_063283936.1\|1317885_1319295_-	hypothetical protein	A0A1B1IMV1	Lactococcus_phage	5.2e-279	100.0
WP_081196687.1\|1319351_1319585_-	hypothetical protein	D2J059	Enterococcus_phage	3.0e-06	37.0
WP_081196688.1\|1319584_1320352_-	hypothetical protein	Q38114	Lactococcus_phage	5.6e-142	98.8
WP_081196959.1\|1320351_1321518_-\|portal	phage portal protein	O64275	Lactococcus_phage	2.8e-222	99.0
WP_031299190.1\|1321727_1322060_-	HNH endonuclease	O64273	Lactococcus_phage	3.9e-60	100.0
WP_081196689.1\|1322185_1322617_-	transcriptional regulator	A0A1P8BMU8	Lactococcus_phage	1.5e-80	99.3
WP_021166237.1\|1322701_1322944_-	hypothetical protein	A6MA87	Lactococcus_virus	8.7e-25	69.6
WP_081196690.1\|1323186_1323873_-	hypothetical protein	Q38108	Lactococcus_phage	4.8e-129	98.2
WP_081196691.1\|1323869_1324175_-	hypothetical protein	A0A1P8BKN7	Lactococcus_phage	5.2e-51	99.0
WP_081196692.1\|1324171_1324597_-	dUTP diphosphatase	A0A1P8BKN6	Lactococcus_phage	8.0e-74	98.6
WP_081196693.1\|1324593_1325166_-	DUF1642 domain-containing protein	A0A1P8BLD2	Lactococcus_phage	9.1e-65	83.8
WP_081196694.1\|1325158_1325554_-	hypothetical protein	Q9XJF2	Lactococcus_phage	9.4e-69	96.2
WP_081196695.1\|1325564_1326158_-	DUF658 family protein	A0A1B1IMX5	Lactococcus_phage	2.1e-96	98.0
WP_081196696.1\|1326150_1326327_-	DUF1497 domain-containing protein	A0A1B1IMW4	Lactococcus_phage	1.0e-22	100.0
WP_015966805.1\|1326438_1326678_-	DUF1031 family protein	Q9XJF0	Lactococcus_phage	5.2e-38	100.0
WP_011676027.1\|1326681_1327071_-	RusA family crossover junction endodeoxyribonuclease	R9QLL1	Lactococcus_phage	9.2e-69	99.2
WP_081196698.1\|1327233_1328124_-	ATP-binding protein	R9QM21	Lactococcus_phage	1.5e-162	99.0
WP_081196699.1\|1328133_1328880_-	DNA replication protein	A0A1P8BK94	Lactococcus_phage	2.4e-126	92.3
WP_011834781.1\|1329012_1329516_-	hypothetical protein	A0A059NT72	Lactococcus_phage	9.1e-93	100.0
WP_081196700.1\|1329515_1330235_-	AAA family ATPase	A0A059NT47	Lactococcus_phage	1.1e-131	98.7
WP_081196701.1\|1330243_1330762_-	hypothetical protein	A0A059NT60	Lactococcus_phage	1.8e-83	95.3
WP_081196702.1\|1330861_1331104_-	hypothetical protein	Q38336	Lactococcus_phage	3.2e-35	96.2
WP_081196703.1\|1331105_1331438_-	DUF771 domain-containing protein	Q8LTN9	Lactococcus_phage	1.5e-56	97.3
WP_081196704.1\|1331450_1332251_-	phage antirepressor	Q38330	Lactococcus_phage	5.1e-146	98.1
WP_015966780.1\|1332262_1332505_-	hypothetical protein	Q77JL3	Lactococcus_phage	5.2e-38	100.0
WP_081196705.1\|1332734_1333571_+	helix-turn-helix domain-containing protein	Q38089	Lactococcus_phage	3.3e-156	98.6
WP_081196706.1\|1333630_1334152_+	hypothetical protein	Q77S00	Lactococcus_phage	7.5e-66	98.8
WP_081196707.1\|1334271_1335396_+\|integrase	site-specific integrase	A0A1B1IME4	Lactococcus_phage	3.4e-212	98.9
WP_021165206.1\|1335695_1336379_-	JAB domain-containing protein	NA	NA	NA	NA
WP_081196708.1\|1336497_1338315_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	1.8e-90	36.0
WP_081196709.1\|1338496_1339153_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_081196710.1\|1339162_1340488_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.6e-24	30.4
WP_081196711.1\|1340491_1341007_-	DUF2127 domain-containing protein	NA	NA	NA	NA
WP_011676007.1\|1341027_1341714_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.5e-32	34.1
WP_021165202.1\|1341841_1342798_-	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	1.8e-49	38.1
WP_081196497.1\|1343274_1343955_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-109	84.1
WP_011676004.1\|1345399_1345843_-	divergent PAP2 family protein	NA	NA	NA	NA
WP_011676003.1\|1346000_1346906_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	6.0e-10	27.8
WP_011676002.1\|1346968_1347421_-	lipoprotein signal peptidase	NA	NA	NA	NA
WP_014572493.1\|1347709_1348090_-	hypothetical protein	NA	NA	NA	NA
WP_021165201.1\|1348189_1349092_+	YafY family transcriptional regulator	NA	NA	NA	NA
WP_088793343.1\|1349124_1350236_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_014572751.1\|1350417_1350882_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-39	55.3
WP_081196713.1\|1350908_1352105_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.1e-110	50.5
WP_021165198.1\|1352116_1352764_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.2e-42	44.7
WP_081196714.1\|1352763_1353852_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.3e-51	38.0
WP_011835375.1\|1354343_1355249_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_081196715.1\|1355274_1357749_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.3e-96	31.8
1357384:1357407	attR	NA	NA	NA	NA
WP_081196716.1\|1358020_1358470_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011675992.1\|1358466_1359300_-	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	5.3e-21	40.0
WP_081196717.1\|1359292_1359829_-	cysteine hydrolase	NA	NA	NA	NA
WP_021165194.1\|1359935_1361870_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.1e-125	43.4
WP_011675988.1\|1362148_1362790_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_011675987.1\|1362963_1363182_+	redoxin NrdH	C3U2K9	Lactococcus_phage	5.8e-12	47.6
WP_011675986.1\|1363183_1363606_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.7e-12	36.4
WP_081196718.1\|1363742_1365911_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.1e-256	60.7
WP_011675984.1\|1366315_1367293_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	6.0e-117	65.7
WP_081196719.1\|1367402_1368338_-	ABC transporter permease	NA	NA	NA	NA
WP_011675982.1\|1368330_1369023_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.6e-31	34.8

DBSCAN-SWA_8

1610085 : 1679059

Bacillus_phage(26.67%)

holin,bacteriocin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021165518.1\|1610085_1611123_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_015082639.1\|1611194_1611797_+	hypothetical protein	NA	NA	NA	NA
WP_011834866.1\|1612043_1613357_-	GTPase ObgE	NA	NA	NA	NA
WP_081196781.1\|1613506_1614673_-	cell division protein FtsQ/DivIB	NA	NA	NA	NA
WP_011676626.1\|1614673_1615747_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_081196782.1\|1615989_1617339_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_011676628.1\|1617507_1617849_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_015082643.1\|1617933_1619175_-	ammonium transporter	NA	NA	NA	NA
WP_081196783.1\|1619360_1620833_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.1e-27	33.1
WP_011676631.1\|1620845_1621538_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	34.1
WP_011834860.1\|1621694_1622225_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_011676633.1\|1622357_1622603_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_021165524.1\|1624529_1625366_-	metallophosphoesterase	NA	NA	NA	NA
WP_021165525.1\|1625477_1625882_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	9.7e-29	47.4
WP_081196784.1\|1626627_1626930_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_152023977.1\|1627485_1628597_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.4e-48	41.1
WP_021165529.1\|1628783_1629434_+	hypothetical protein	NA	NA	NA	NA
WP_081196785.1\|1629541_1630312_+	glycoside hydrolase, family 25	Q38326	Lactococcus_phage	8.0e-64	73.6
WP_152023978.1\|1630454_1631824_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	3.9e-53	43.4
WP_081196786.1\|1631956_1633030_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.5e-60	35.1
WP_011676640.1\|1633117_1634050_-	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-23	30.5
WP_101944708.1\|1634298_1635561_-	uracil permease	Q9KX94	Enterobacteria_phage	6.7e-60	36.7
WP_011676642.1\|1635691_1636213_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_081196787.1\|1636488_1637187_-	M50 family metallopeptidase	NA	NA	NA	NA
WP_011676644.1\|1637291_1637591_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021037569.1\|1637580_1638498_+	cation transporter	NA	NA	NA	NA
WP_061778247.1\|1638735_1639977_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.4e-109	53.3
WP_032950319.1\|1640087_1640894_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.1e-39	41.2
WP_015082654.1\|1642507_1642750_-	DUF1858 domain-containing protein	NA	NA	NA	NA
WP_015082655.1\|1642865_1643192_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_081196788.1\|1643178_1643886_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_021211949.1\|1644080_1644653_+	NADPH-dependent F420 reductase	NA	NA	NA	NA
WP_011834841.1\|1644737_1645280_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011676655.1\|1645313_1646870_-	signal recognition particle protein	NA	NA	NA	NA
WP_081196789.1\|1646948_1649675_-	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_011834838.1\|1649723_1651436_-	ribonuclease J	NA	NA	NA	NA
WP_081196790.1\|1651785_1652457_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	1.4e-19	43.5
WP_011676659.1\|1652496_1653390_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_011676660.1\|1653717_1654173_-	NUDIX domain-containing protein	D0R7J3	Paenibacillus_phage	1.0e-26	38.9
WP_011676661.1\|1654182_1655259_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_015082666.1\|1656565_1656817_-	hypothetical protein	NA	NA	NA	NA
WP_021165544.1\|1656984_1658961_-	transketolase	NA	NA	NA	NA
WP_081196791.1\|1659128_1660529_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_021165546.1\|1660581_1660881_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_032950333.1\|1660882_1662823_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_011676669.1\|1662997_1663639_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_081196792.1\|1664588_1666007_-	glucuronate isomerase	NA	NA	NA	NA
WP_081196793.1\|1666960_1668487_-	MFS transporter	NA	NA	NA	NA
WP_021165547.1\|1668672_1669749_-	mannonate dehydratase	NA	NA	NA	NA
WP_081196794.1\|1671923_1672604_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_021165548.1\|1672668_1674099_-	MFS transporter	NA	NA	NA	NA
WP_011834820.1\|1674457_1674763_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_021165549.1\|1674767_1674992_-\|bacteriocin	garvicin Q family class II bacteriocin	NA	NA	NA	NA
WP_081196795.1\|1675206_1676097_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676499.1\|1676078_1676279_-	hypothetical protein	NA	NA	NA	NA
WP_081196796.1\|1677506_1678796_-	LysM peptidoglycan-binding domain-containing protein	A0A1P8BLG2	Lactococcus_phage	1.1e-240	97.4
WP_015966839.1\|1678792_1679059_-\|holin	phage holin	Q38613	Lactococcus_phage	4.3e-41	100.0

DBSCAN-SWA_9

1817378 : 1887457

Bacillus_phage(17.65%)

integrase,transposase,protease

attL 1877850:1877909|attR 1882820:1882931

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196833.1\|1817378_1818269_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196834.1\|1818269_1820270_-	type VII secretion protein EsaA	NA	NA	NA	NA
WP_031286518.1\|1820332_1820692_-	hypothetical protein	NA	NA	NA	NA
WP_011835707.1\|1820699_1821170_-	type VII secretion protein EssA	NA	NA	NA	NA
WP_011676794.1\|1821277_1821568_-	WXG100 family type VII secretion target	NA	NA	NA	NA
WP_021165659.1\|1821915_1823328_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_011676796.1\|1823423_1823882_-	SUF system NifU family Fe-S cluster assembly protein	A0A218MM29	uncultured_virus	4.5e-06	32.1
WP_031286519.1\|1824015_1824498_-	hypothetical protein	NA	NA	NA	NA
WP_021213770.1\|1824499_1825720_-	cysteine desulfurase	Q2XUY6	environmental_halophage	1.7e-105	44.7
WP_021165660.1\|1825719_1826976_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_011676800.1\|1827115_1827886_-	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	4.7e-08	25.7
WP_081196835.1\|1828061_1829387_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_011676802.1\|1829389_1830091_-	adaptor protein MecA	NA	NA	NA	NA
WP_021165663.1\|1830219_1830954_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-36	41.4
WP_014572148.1\|1830953_1831640_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_014572147.1\|1831785_1832694_-	diacylglycerol kinase family lipid kinase	NA	NA	NA	NA
WP_162494678.1\|1832817_1836441_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.5e-72	24.4
WP_081196836.1\|1836548_1840139_-	DNA-directed RNA polymerase subunit beta	A0A2P0VMZ3	Tetraselmis_virus	8.3e-39	24.5
WP_011676808.1\|1840407_1841007_-	transcriptional regulator	NA	NA	NA	NA
WP_021165666.1\|1841242_1841917_+	helix-turn-helix transcriptional regulator	S4TZZ1	uncultured_phage	3.5e-07	43.1
WP_011676811.1\|1843660_1843966_-	MGMT family protein	NA	NA	NA	NA
WP_011676812.1\|1844035_1845709_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_021165669.1\|1845919_1847371_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_011676814.1\|1847452_1847713_-	hypothetical protein	NA	NA	NA	NA
WP_021165671.1\|1847733_1848756_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	2.2e-29	27.2
WP_011676817.1\|1848975_1850757_+	DNA helicase RecQ	A0A0G2Y8K9	Acanthamoeba_polyphaga_mimivirus	2.8e-72	36.5
WP_011676818.1\|1851136_1851319_-	hypothetical protein	NA	NA	NA	NA
WP_152023974.1\|1851525_1852637_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-49	41.4
WP_011675640.1\|1854079_1855243_+	ABC transporter permease	NA	NA	NA	NA
WP_003129597.1\|1855624_1856023_-	transcriptional regulator Spx	NA	NA	NA	NA
WP_011675638.1\|1856192_1856723_-	hypothetical protein	NA	NA	NA	NA
WP_011834647.1\|1856918_1857518_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	7.1e-52	52.6
WP_081196837.1\|1857557_1858796_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_081196838.1\|1858815_1861362_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_021166367.1\|1862809_1866223_-	pyruvate carboxylase	NA	NA	NA	NA
WP_081196839.1\|1866327_1867590_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_003129585.1\|1867967_1868114_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_021166366.1\|1868110_1869328_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_081196840.1\|1869330_1869990_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_081196841.1\|1870118_1872482_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	4.3e-108	31.9
WP_021216088.1\|1872656_1873574_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_081196842.1\|1873767_1875291_+	acyl-CoA synthetase	NA	NA	NA	NA
WP_014573008.1\|1875477_1876047_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_081146204.1\|1876058_1877132_+	ABC transporter permease	NA	NA	NA	NA
WP_021166361.1\|1877133_1877814_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-29	36.8
1877850:1877909	attL	NA	NA	NA	NA
WP_152023981.1\|1878159_1879271_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_155724258.1\|1880490_1880649_-	hypothetical protein	NA	NA	NA	NA
WP_011675611.1\|1881802_1882738_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	3.0e-25	27.8
WP_010905473.1\|1882825_1884127_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
1882820:1882931	attR	NA	NA	NA	NA
WP_011834629.1\|1884314_1884872_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_011675609.1\|1885006_1887457_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	1.3e-123	34.0

DBSCAN-SWA_10

2046358 : 2106146

Streptococcus_phage(22.22%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196497.1\|2046358_2047039_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-109	84.1
WP_011677073.1\|2047389_2048079_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_011677074.1\|2048465_2048891_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_021165035.1\|2049026_2049791_-	ABC transporter permease	NA	NA	NA	NA
WP_021165034.1\|2049790_2050669_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.5e-05	26.4
WP_011677077.1\|2050735_2050945_-	hypothetical protein	NA	NA	NA	NA
WP_021165033.1\|2050978_2051500_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_011677079.1\|2051674_2052532_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_011677080.1\|2052576_2053035_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011677081.1\|2053119_2053677_-	ribosome recycling factor	NA	NA	NA	NA
WP_021464089.1\|2053832_2054549_-	UMP kinase	NA	NA	NA	NA
WP_021165032.1\|2054633_2055086_-	hypothetical protein	NA	NA	NA	NA
WP_014573258.1\|2055215_2056403_-	acetate kinase	NA	NA	NA	NA
WP_011677084.1\|2056561_2057749_-	acetate kinase	NA	NA	NA	NA
WP_021165031.1\|2057940_2058879_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011677086.1\|2058966_2059218_-	hypothetical protein	NA	NA	NA	NA
WP_031286284.1\|2059318_2061151_-	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	9.2e-18	35.4
WP_152023984.1\|2061667_2062779_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_081196634.1\|2063528_2064419_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165027.1\|2064479_2064938_-	hypothetical protein	NA	NA	NA	NA
WP_081196874.1\|2064952_2065567_-	hypothetical protein	NA	NA	NA	NA
WP_031286281.1\|2065906_2066635_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_011677095.1\|2066827_2067049_+	YqgQ family protein	NA	NA	NA	NA
WP_081196875.1\|2067082_2068054_+	ROK family glucokinase	NA	NA	NA	NA
WP_011677097.1\|2068056_2068443_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_011677098.1\|2068558_2069005_-	DNA starvation/stationary phase protection protein	A0A2K9VCK5	Lactobacillus_phage	2.5e-17	33.6
WP_014573269.1\|2069170_2069836_+	prepilin peptidase	NA	NA	NA	NA
WP_081196876.1\|2069786_2070881_-	DNA polymerase IV	NA	NA	NA	NA
WP_011677102.1\|2070956_2071448_-\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
WP_081196877.1\|2071523_2073017_-	amino acid permease	NA	NA	NA	NA
WP_021165024.1\|2073206_2074337_-	aminotransferase	NA	NA	NA	NA
WP_081196878.1\|2074600_2075545_-	carbamate kinase	NA	NA	NA	NA
WP_021213427.1\|2076534_2078115_-	amino acid permease	NA	NA	NA	NA
WP_021165021.1\|2078246_2079311_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_011677109.1\|2081010_2082705_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.8e-80	34.2
WP_004254487.1\|2082772_2083231_+	arginine repressor	NA	NA	NA	NA
WP_021165020.1\|2083390_2084722_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_011677112.1\|2084922_2085522_-	hypothetical protein	NA	NA	NA	NA
WP_011677113.1\|2085738_2088843_-	DEAD/DEAH box helicase family protein	A0A2L1IWL4	Gordonia_phage	2.4e-42	30.1
WP_081196879.1\|2090006_2090897_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196880.1\|2093555_2095601_+	MnhB domain-containing protein	NA	NA	NA	NA
WP_152023984.1\|2097047_2098158_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_081196881.1\|2098649_2100377_-	pyruvate oxidase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.3e-31	25.9
WP_015082898.1\|2100626_2101583_-	serine hydrolase	NA	NA	NA	NA
WP_011677117.1\|2101655_2102435_-	hypothetical protein	NA	NA	NA	NA
WP_011677119.1\|2102896_2103226_-	hypothetical protein	NA	NA	NA	NA
WP_021165011.1\|2105363_2106146_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_11

2303744 : 2316026

Lactococcus_phage(92.86%)

integrase

attL 2306262:2306287|attR 2316320:2316345

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196909.1\|2303744_2305745_-	ATP-dependent DNA helicase RecG	B2CRJ8	Acidianus_filamentous_virus	2.1e-07	23.7
WP_041931367.1\|2305883_2306210_-	alkylphosphonate utilization protein	NA	NA	NA	NA
2306262:2306287	attL	NA	NA	NA	NA
WP_081196910.1\|2306298_2307477_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	1.8e-91	46.3
WP_162494685.1\|2308953_2309151_+	hypothetical protein	Q9AZJ6	Lactococcus_phage	1.4e-20	81.2
WP_081196911.1\|2309154_2309403_+	hypothetical protein	NA	NA	NA	NA
WP_081196912.1\|2309521_2309719_+	DUF1655 domain-containing protein	Q9AZJ4	Lactococcus_phage	2.9e-26	96.8
WP_081196913.1\|2309715_2310237_+	hypothetical protein	Q9AZJ3	Lactococcus_phage	1.3e-54	64.9
WP_046781189.1\|2310233_2310515_+	hypothetical protein	Q9AZJ1	Lactococcus_phage	3.7e-43	91.4
WP_081196914.1\|2310552_2310792_+	hypothetical protein	Q9AZJ0	Lactococcus_phage	5.9e-34	84.8
WP_081196915.1\|2310788_2311043_+	hypothetical protein	Q9AZE9	Lactococcus_phage	1.3e-34	85.5
WP_081196916.1\|2311039_2311375_+	hypothetical protein	Q9AZI7	Lactococcus_phage	1.9e-54	95.4
WP_081196917.1\|2311371_2312166_+	hypothetical protein	Q9AZI6	Lactococcus_phage	1.3e-149	94.7
WP_081196918.1\|2312176_2313805_+	DNA primase	Q9AZI5	Lactococcus_phage	1.2e-298	93.0
WP_081196919.1\|2314032_2314575_+	hypothetical protein	Q9AZI4	Lactococcus_phage	6.0e-58	70.0
WP_081196920.1\|2314892_2315195_+	hypothetical protein	NA	NA	NA	NA
WP_081196921.1\|2315268_2315679_+	DUF722 domain-containing protein	Q9AZI2	Lactococcus_phage	1.0e-65	94.1
WP_081196978.1\|2315702_2316026_+	sigma-70 family RNA polymerase sigma factor	Q9AZI1	Lactococcus_phage	5.3e-46	86.9
2316320:2316345	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016744

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

45283 : 54973

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032489104.1\|45283_48361_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	1.4e-18	21.9
WP_081196986.1\|48360_49956_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	3.5e-122	49.2
WP_081196987.1\|49945_51106_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	9.0e-27	28.6
WP_003132846.1\|51386_51941_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	3.6e-42	50.6
WP_003132844.1\|52290_52512_-	hypothetical protein	NA	NA	NA	NA
WP_003132842.1\|52546_52843_-	hypothetical protein	A0A1S5SEW3	Streptococcus_phage	4.2e-05	39.3
WP_011669109.1\|53089_54973_-	endopeptidase PepO	E3T4I7	Cafeteria_roenbergensis_virus	1.3e-72	31.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP016745

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4406 : 75425

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196988.1\|4406_5297_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_081196989.1\|5349_6165_+	sugar-phosphatase	NA	NA	NA	NA
WP_021166316.1\|6286_6652_+	hypothetical protein	NA	NA	NA	NA
WP_012898583.1\|8404_8605_-	cold-shock protein	Q9AZD3	Lactococcus_phage	6.9e-28	92.4
WP_021166316.1\|13943_14309_+	hypothetical protein	NA	NA	NA	NA
WP_002360751.1\|14846_15806_-\|transposase	IS30-like element IS1062 family transposase	W5R8L2	Staphylococcus_phage	6.3e-34	35.0
WP_012898583.1\|16059_16260_-	cold-shock protein	Q9AZD3	Lactococcus_phage	6.9e-28	92.4
WP_081196221.1\|16398_17079_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.5e-109	84.1
WP_063282456.1\|17473_18511_+	DUF3883 domain-containing protein	NA	NA	NA	NA
WP_011669063.1\|18591_18843_+	hypothetical protein	NA	NA	NA	NA
WP_014572407.1\|18971_19166_+	hypothetical protein	NA	NA	NA	NA
WP_032951467.1\|19266_19848_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	6.9e-36	41.4
WP_021215358.1\|19852_21778_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	5.7e-34	36.6
WP_010890648.1\|22335_23016_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5
WP_003331352.1\|23375_23672_+	DUF4298 domain-containing protein	NA	NA	NA	NA
WP_155723511.1\|24368_24710_+	cytochrome B	NA	NA	NA	NA
WP_010891372.1\|24900_25581_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.1e-112	85.4
WP_011669037.1\|25680_26370_-	serine/threonine protein phosphatase	A0A0C5JZB3	Enterococcus_phage	3.9e-30	35.8
WP_021213230.1\|26470_26617_+	hypothetical protein	NA	NA	NA	NA
WP_081196222.1\|27196_27565_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_003140158.1\|28515_30315_+	excisionase	A0A0U4J920	Pseudomonas_phage	7.9e-30	30.4
WP_032951462.1\|31898_32411_-	RepB family protein	NA	NA	NA	NA
WP_021164862.1\|33873_34491_+	helix-turn-helix transcriptional regulator	A0A1S5SD15	Streptococcus_phage	8.7e-21	39.4
WP_014573544.1\|35014_36367_+	RepB family plasmid replication initiator protein	NA	NA	NA	NA
WP_081196217.1\|36744_37635_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014573541.1\|37920_38154_+	hypothetical protein	NA	NA	NA	NA
WP_014573540.1\|38163_38922_+	AAA family ATPase	H7BUL8	unidentified_phage	1.6e-16	28.4
WP_014573539.1\|38925_39654_+	ParB N-terminal domain-containing protein	Q4ZC37	Staphylococcus_virus	7.2e-06	27.7
WP_032951460.1\|39683_40034_-	hypothetical protein	A0A182BQ76	Lactococcus_phage	2.3e-10	75.6
WP_021213336.1\|40023_41490_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	3.4e-124	51.5
WP_152023988.1\|42971_44344_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	4.6e-54	43.1
WP_133265005.1\|44401_45549_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	8.6e-46	41.0
WP_021165743.1\|46424_47324_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_081196990.1\|47652_53721_+	S8 family serine peptidase	NA	NA	NA	NA
WP_080683477.1\|53849_54170_-	hypothetical protein	NA	NA	NA	NA
WP_161485966.1\|54186_54654_-\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	5.4e-23	37.1
WP_021215689.1\|54924_55185_-	hypothetical protein	NA	NA	NA	NA
WP_021212881.1\|55699_55870_+	hypothetical protein	NA	NA	NA	NA
WP_081146394.1\|55942_56077_+	hypothetical protein	NA	NA	NA	NA
WP_081196991.1\|56845_57421_-	hypothetical protein	NA	NA	NA	NA
WP_063280555.1\|57633_58212_-	hypothetical protein	NA	NA	NA	NA
WP_063280554.1\|58673_59195_-	hypothetical protein	NA	NA	NA	NA
WP_063280553.1\|59181_59985_-	hypothetical protein	NA	NA	NA	NA
WP_152023989.1\|60003_60825_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
WP_152023990.1\|60998_61244_+	hypothetical protein	NA	NA	NA	NA
WP_063280550.1\|61362_63909_+	type IA DNA topoisomerase	NA	NA	NA	NA
WP_152023991.1\|63991_64888_+	hypothetical protein	NA	NA	NA	NA
WP_116368855.1\|65698_67070_+\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	9.2e-55	43.4
WP_063280548.1\|67418_68489_-	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	1.4e-05	28.9
WP_152023992.1\|69452_70232_+	hypothetical protein	NA	NA	NA	NA
WP_063280545.1\|70472_70784_-	hypothetical protein	NA	NA	NA	NA
WP_063280544.1\|70872_73338_-	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_063280543.1\|73356_74469_-	hypothetical protein	NA	NA	NA	NA
WP_010890648.1\|74744_75425_-\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	8.5e-110	84.5

DBSCAN-SWA_2

86565 : 99747

Lactococcus_phage(30.0%)

transposase,integrase

attL 98029:98053|attR 100929:100953

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081196219.1\|86565_87246_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	6.3e-105	81.4
WP_021164873.1\|88465_88696_-	hypothetical protein	NA	NA	NA	NA
WP_011669083.1\|88745_89042_-	hypothetical protein	NA	NA	NA	NA
WP_152023993.1\|89276_90424_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.2e-45	40.2
WP_011669084.1\|90888_91089_-	cold-shock protein	Q9AZD3	Lactococcus_phage	9.6e-30	97.0
WP_003132324.1\|91365_91566_-	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	1.6e-13	54.7
WP_021213567.1\|91696_91897_-	hypothetical protein	Q9AZK6	Lactococcus_phage	2.8e-05	54.9
WP_081196995.1\|92875_93556_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	83.6
WP_081196204.1\|94221_96024_+	N-6 DNA methylase	J7I0U9	Acinetobacter_phage	2.3e-13	24.2
WP_021722469.1\|96045_97557_+	type I restriction-modification system subunit M	A0A220A2U4	Liberibacter_phage	9.5e-53	30.3
WP_081196996.1\|97501_98686_+	restriction endonuclease subunit S	A0A240FAT6	Liberibacter_phage	3.6e-23	37.1
98029:98053	attL	NA	NA	NA	NA
WP_081196211.1\|98754_99747_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	7.7e-35	29.2
WP_081196211.1\|98754_99747_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	7.7e-35	29.2
100929:100953	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015900

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016744

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP016745

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection