CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP016729	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4A, complete sequence	0 crisprs	RT	0	1
NZ_CP016730	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4B, complete sequence	0 crisprs	NA	0	0
NZ_CP016731	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4C, complete sequence	0 crisprs	NA	0	0
NZ_CP016732	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4D, complete sequence	0 crisprs	NA	0	0
NZ_CP015909	Lactococcus lactis subsp. cremoris strain JM4 chromosome, complete genome	2 crisprs	WYL,cas3,DEDDh,csa3,DinG	1	10
NZ_CP016733	Lactococcus lactis subsp. cremoris strain JM4 plasmid pJM4E, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3149 : 14295

Lactococcus_phage(60.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014573540.1\|3149_3908_+	AAA family ATPase	H7BUL8	unidentified_phage	1.6e-16	28.4
WP_014573539.1\|3911_4640_+	ParB N-terminal domain-containing protein	Q4ZC37	Staphylococcus_virus	7.2e-06	27.7
WP_014011586.1\|4669_5020_-	hypothetical protein	A0A182BQ76	Lactococcus_phage	2.3e-10	75.6
WP_021214063.1\|5009_6476_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	7.7e-124	51.3
WP_064305107.1\|8545_9304_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
WP_064305106.1\|9315_10539_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
WP_011669085.1\|11674_11875_+	hypothetical protein	Q9AZK6	Lactococcus_phage	2.2e-05	53.8
WP_003132324.1\|12005_12206_+	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	1.6e-13	54.7
WP_011669084.1\|12482_12683_+	cold-shock protein	Q9AZD3	Lactococcus_phage	9.6e-30	97.0
WP_095559415.1\|13148_14295_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP015909

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015909_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015909_1

885363-885454

Orphan

Consensus_repeat	Method
AAAGCTAATCAAACGGATTTAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015909_1

>merge|NZ_CP015909|1|885363-885454|CRISPRCasFinder
AAAGCTAATCAAACGGATTTAGAAAGTTTACAGCATACTGTTAATAATCAATCAGCAACTGTTTCAACAAAAGCTAATCAAACGGATTTGGA

>NZ_CP015909|1|1|885363-885454|CRISPRCasFinder
AAAGCTAATCAAACGGATTTAGA	AAGTTTACAGCATACTGTTAATAATCAATCAGCAACTGTTTCAACA
AAAGCTAATCAAACGGATTTGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015909.1\|WP_021165309.1\|883888_884380_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176481
NZ_CP015909.1\|WP_064305184.1\|896047_896467_+\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	unknown	unknown	gnl\|CDD\|239330
NZ_CP015909.1\|WP_116368845.1\|890482_891594_+\|IS3-like-element-IS981-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP015909.1\|WP_021165306.1\|878584_879346_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|188159
NZ_CP015909.1\|WP_021165391.1\|894380_894740_+\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NZ_CP015909.1\|WP_021213901.1\|879345_882102_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|227263
NZ_CP015909.1\|WP_003331414.1\|874954_875713_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP015909.1\|WP_003331415.1\|875724_876948_-\|IS21-like-element-IS712-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP015909.1\|WP_011675806.1\|896614_897922_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP015909.1\|WP_064305186.1\|887281_888571_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119377
NZ_CP015909.1\|WP_021165308.1\|883084_883870_+\|fibronectin-type-III-domain-containing-protein	unknown	unknown	gnl\|CDD\|238020
NZ_CP015909.1\|WP_021165223.1\|873496_873766_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015909.1\|WP_011675801.1\|891697_892528_-\|SP_1767-family-glycosyltransferase	unknown	unknown	gnl\|CDD\|163440
NZ_CP015909.1\|WP_021165307.1\|882114_883095_+\|phage-baseplate-upper-protein	unknown	unknown	gnl\|CDD\|371181
NZ_CP015909.1\|WP_015974072.1\|887018_887285_+\|phage-holin	unknown	unknown	gnl\|CDD\|130659
NZ_CP015909.1\|WP_014572189.1\|873062_873413_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372073
NZ_CP015909.1\|WP_021165392.1\|894783_895887_+\|alanine-racemase	unknown	unknown	gnl\|CDD\|234600
NZ_CP015909.1\|WP_064305183.1\|898050_898968_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP015909.1\|WP_011676503.1\|884393_884618_+\|holin	unknown	unknown	gnl\|CDD\|371241
NZ_CP015909.1\|WP_014572862.1\|892833_894252_+\|dipeptidase-PepV	unknown	unknown	gnl\|CDD\|130941

Protein	Function_ID	Function_description	E-value
NZ_CP015909.1\|WP_021165309.1\|883888_884380_+\|hypothetical-protein	gnl\|CDD\|176481	cd07964, RBP-H, Head domain of virus receptor-binding proteins (RBP). Virus receptor-binding proteins (RBPs) are found in lactococcal bacteriophages, as well as in adenoviruses and reoviruses, which invade mammalian cells. Lactococcus lactis is widely used in dairy fermentations and infection of L. lactis by phages greatly impairs the fermentation process. Adenovirus typically infects respiratory tracts with symptoms ranging from the common cold to pneumonia. Onset of viral infections begin with the recognition of host cells through the receptor-binding protein complex located at the distal part of the virion. The RBP has three domains: the N- terminal shoulders domain, the interlaced neck domain, and the C-terminal head domain. Phages recognize their host through an interaction between the RBP head (RBP-H) domain and saccharidic receptors at the host cell surface. Adenovirus recognizes the membrane cofactor protein, CD46, as a cellular receptor.	2.89303e-27
NZ_CP015909.1\|WP_064305184.1\|896047_896467_+\|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein	gnl\|CDD\|239330	cd03032, ArsC_Spx, Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes. It inhibits transcription by binding to the C-terminal domain of the alpha subunit of RNAP, disrupting complex formation between RNAP and certain transcriptional activator proteins like ResD and ComA. In response to oxidative stress, Spx can also activate transcription, making it a general regulator that exerts both positive and negative control over transcription initiation. Spx has been shown to exert redox-sensitive transcriptional control over genes like trxA (TRX) and trxB (TRX reductase), genes that function in thiol homeostasis. This redox-sensitive activity is dependent on the presence of a CXXC motif, present in some members of the Spx subfamily, that acts as a thiol/disulfide switch. Spx has also been shown to repress genes in a sulfate-dependent manner independent of the presence of the CXXC motif.	5.75053e-55
NZ_CP015909.1\|WP_021165306.1\|878584_879346_+\|hypothetical-protein	gnl\|CDD\|188159	TIGR01633, unnamed_protein_product, putative phage tail component, N-terminal domain. This model represents the best-conserved region of about 125 amino acids, toward the N-terminus, of a family of proteins from temperate phage of a number of Gram-positive bacteria. These phage proteins range in length from 230 to 525 amino acids. [Mobile and extrachromosomal element functions, Prophage functions].	4.31479e-40
NZ_CP015909.1\|WP_021165391.1\|894380_894740_+\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	3.27596e-50
NZ_CP015909.1\|WP_021213901.1\|879345_882102_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|227263	COG4926, PblB, Phage-related protein [Function unknown].	1.84856e-90
NZ_CP015909.1\|WP_003331414.1\|874954_875713_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	3.89255e-62
NZ_CP015909.1\|WP_003331415.1\|875724_876948_-\|IS21-like-element-IS712-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.63091e-43
NZ_CP015909.1\|WP_011675806.1\|896614_897922_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	1.06165e-126
NZ_CP015909.1\|WP_064305186.1\|887281_888571_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119377	cd06415, GH25_Cpl1-like, Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.	1.25392e-73
NZ_CP015909.1\|WP_021165308.1\|883084_883870_+\|fibronectin-type-III-domain-containing-protein	gnl\|CDD\|238020	cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.	0.00140008
NZ_CP015909.1\|WP_116368845.1\|890482_891594_+\|IS3-like-element-IS981-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.18077e-66
NZ_CP015909.1\|WP_011675801.1\|891697_892528_-\|SP_1767-family-glycosyltransferase	gnl\|CDD\|163440	TIGR03728, glyco_access_1, glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.	3.79265e-161
NZ_CP015909.1\|WP_021165307.1\|882114_883095_+\|phage-baseplate-upper-protein	gnl\|CDD\|371181	pfam10651, DUF2479, Domain of unknown function (DUF2479). This domain is found in phage from a number of different bacteria. It is purported to be a putative long tail fibre (Bacteriophage A118) protein, but this could not be confirmed.	3.00281e-38
NZ_CP015909.1\|WP_015974072.1\|887018_887285_+\|phage-holin	gnl\|CDD\|130659	TIGR01598, holin_phiLC3, holin, phage phi LC3 family. Phage proteins for bacterial lysis typically include a membrane-disrupting protein, or holin, and one or more cell wall degrading enzymes that reach the cell wall because of holin action. Holins are found in a large number of mutually non-homologous families. [Mobile and extrachromosomal element functions, Prophage functions].	3.11802e-32
NZ_CP015909.1\|WP_014572189.1\|873062_873413_+\|hypothetical-protein	gnl\|CDD\|372073	pfam12363, Phage_TAC_12, Phage tail assembly chaperone protein, TAC. This is a family of phage tail assembly chaperone proteins from Siphoviridae phages.	2.06242e-20
NZ_CP015909.1\|WP_021165392.1\|894783_895887_+\|alanine-racemase	gnl\|CDD\|234600	PRK00053, alr, alanine racemase; Reviewed.	3.93567e-156
NZ_CP015909.1\|WP_064305183.1\|898050_898968_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.93166e-149
NZ_CP015909.1\|WP_011676503.1\|884393_884618_+\|holin	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	2.47826e-11
NZ_CP015909.1\|WP_014572862.1\|892833_894252_+\|dipeptidase-PepV	gnl\|CDD\|130941	TIGR01886, Beta-Ala-Xaa_dipeptidase, dipeptidase PepV. This model represents a small clade of dipeptidase enzymes which are members of the larger M25 subfamily of metalloproteases. Two characterized enzymes are included in the seed. One, from Lactococcus lactis has been shown to act on a wide range of dipeptides, but not larger peptides. The enzyme from Lactobacillus delbrueckii was originally characterized as a Xaa-His dipeptidase, specifically a carnosinase (beta-Ala-His) by complementation of an E. coli mutant. Further study, including the crystallization of the enzyme, has shown it to also be a non-specific dipeptidase. This group also includes enzymes from Streptococcus and Enterococcus. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	0

>NZ_CP015909.1|WP_011676503.1|884393_884618_+|holin
MEEQAWREVLERLARIETKLDNYETVRDKAERALLIAQSNAKLIEKMEANNKWAWGFMLTLAVTIIGYIITKIL
>NZ_CP015909.1|WP_021165309.1|883888_884380_+|hypothetical-protein
MASIKKVYRGMQNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLILPTKSWHGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNLSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID
>NZ_CP015909.1|WP_021165308.1|883084_883870_+|fibronectin-type-III-domain-containing-protein
MADKNYLHTAYANSADGTDGFTTTFPNLNLLEGTKDFSGDWLNLGTWYKNGTYRGLTVMSFNTGWNGGLTKGFTIPSDGIYSMSMLVKVKAGSIGKFVIETTGMDSIIRDVNPTDEQFVTQSYTGKFTAGQKILMYFRFNDDKNIIKDGLSVAGHKIEQGSTVTPWMPSSSEVTTADWPKYVGTYVDTNPVSSTNSSKYDWDEMKYRVYLDGVPVGGSKLLSFDLENLKAGTSYNVQVSQINGNVESDKSESVAFKTTLTK
>NZ_CP015909.1|WP_021165307.1|882114_883095_+|phage-baseplate-upper-protein
MTEHFITLSTTEPNNNIGIVKLRHADVNSQAIVAQIVENGQPKSFEGLQPFFCLMAQETTGQGVAEEAVISFDAKNGTLKYVASDNALQMVGRNEAYFSFRKQEGSQWIEQFSTRTFHYIVEKSIYSQPFKDSNYWWTFKELYRIFNKYIEDGKNSWVQFVEANREILESIDPGGRLLAEVLDLNKIIYRKVPSGFNVVIEHDSEYQPNVKVTYYKNSIGIEANGFDTGPVFGGERIYNLASSLSYIRNKVNVELPSVYAMAGEVVNNGNELLLINGTEVMRFVIEGATITKGYVEKVKPPTNLIVSDITSSSAKISWENGGQYGR
>NZ_CP015909.1|WP_021213901.1|879345_882102_+|peptidoglycan-DD-metalloendopeptidase-family-protein
MSNILFLDKMQQVIKSYDSDEFIECVQTKEITTNASELMNDTLSVSLPFDETIKDASYIAVNDTKEQEFSLYRILTAKDEDDLLSFEAKNFAVDELDNFIIKDIRPKNRSFSYVINKLLYDSDCDWVLGVCEPIKTVSSTFYYTSIREALKALQELGAEFTFSIEITGNKITKKIIHCYNQIGKITNKRFEYGEEVLKIVHQQDRTNIVTALIGRGKGEEVGDGYGRRIEFSDVEWKKSNGKPLDKPKGQNWIEYPEMTKEYGIPSNGKMLPRKTVVVFDDVEDASELLQKTYDQLAYYCRPLVQFSTEILGSDSIGNTVSIHRGDRNYHYQTRVFKVVTDHVNGRVQASLGDNLSGNSINRQLSQVQSNISDLDNNKMTFYDSTEIGKYQSDIIRGAKGGSIMMMNPSDLGKGESREPFQMVWMNGPSIEESDHFLVANSEGIGFIDGNFNLDNFKTAWTIDGIFNADFINAGTLQGVKIRSVDNDFIIELDQGKIRFIKKDGSSEKEMFAFAPTYAGGQLQGINAIQNHGYSFALSSKGNNGALLNVLEIPKDSTAENRKLNLYGEVKVDGNLTISGKTNTKELYVNGTKIDTNGGGNSGGGDNGWNGQYPPEVISDRDKRYWQIWAMAIGAGFSKQAAAALLGNAQGESDANPTADEGGGRPGFGRGVWQWTDSSGASSGRVYMINLMTRAGVTDNPDTITAQFKLLMWHAQNGQWIAKSSYPYSWTQFMTLTNINTATQAFVSNFERPLNGHPERSTWAQEWYNKFVNLGIPSGGGGYIAPISSPITVTSEMGWRTSPITGAQEFHNAMDLVNGNPTTPILASNDGQVVQAGSNYYNWYGNYTVIKHADGLYTGYAHQSRIDVSVGQNVKKGQQIGLMGSTGPVTGPHLHFQFMDQYWPSSHAHFKNPRDYIKF
>NZ_CP015909.1|WP_021165306.1|878584_879346_+|hypothetical-protein
MYKFRDTTKQNHYRNLPFIPTSAMSYDGTWLEELIEGYQTLTVEGREMYSLSFESQEMQVGGVITNVKYPPRELTIKYKLEDRDPRALQEKFDTLKAFLIRQEDVPIIFNDDLEYTFYGRFKTADNVAGDTNSIISSFTVLCSNPFKHGKTQSVKNKVIEVLPYPVKPDRLSFKLLTGGLLATDGNYRLKSSQAKKGDLLEFDFQAGNTFLNGKVNNNLLDLDSDFKNIRLTTGTDFSSSNYELTIQYRKAVL
>NZ_CP015909.1|WP_003331415.1|875724_876948_-|IS21-like-element-IS712-family-transposase
MRKDILESITEHLMTGIKPNFADIARRYNCDYRTVKRYYDLGKEKTLEEASKRRVPPSLIENYKSIIEDKLKLGCSVRSIYYFIQLKGYQGSYTTVKRYARLIRESCKHKATIRIETTPGLSAQVDWKENLKLISRNGEVFTINIFLYILGYSRMKYLQLTVDRLQPTLFECLNHAFEKFGGVPEEIWFDNMKTVVDHSKSQFSNVVFNERFRQYAKDAGFKPIACRPFRPQTKGKVEALARTVDRLLVFNNEFEDLEELQALVQQLMEDLNHKEISQAIGTSPSERLDQEALNLKAFDLELLKVYSQLSVPLTRKVSKEALVIFEGRKYSVPVKYIGQTVTCEKEQEDLKVYCDQRLIARHPLSDRPFNYRREDYVEILKSDVFKHLEEDELEAYVDENLQAYDLL
>NZ_CP015909.1|WP_003331414.1|874954_875713_-|ATP-binding-protein
MTTYHQLLNQLDHLKLDRVRQLLPEFLDEHADISLVEGLHELLSEELREREALLQERRLKKAHLPYEKRVMDFDFQFQPKINKAEILDLHTLRFLDKHENLLFIGNSGVGKTHLAISITLEALEKGYSSYFCMSTELVDRLLRANQKGTLERVLKQYANYDVLVIDEVGYLPFSRDGASLLFQLINMRYEKKSTLITTNIPLSQWSEFLQDKKLTNALLDRLVHHSKVISITGKSYRMKDYSEKKTKTPKSK
>NZ_CP015909.1|WP_021165223.1|873496_873766_+|hypothetical-protein
MTISEYELRLKAYRLKRLDEQEFIYQQAWANWQVQSTKQQGKKQVPVYSTFKKFFDKEKFENDILGIETSDSAFKKDNKLINLMKKANK
>NZ_CP015909.1|WP_014572189.1|873062_873413_+|hypothetical-protein
MELTINDKQYVFIFGYRFIKELNKKNEVTERGMTLKAGLDNALMNFFSGDIETLVEMLKTANATENPRVSEKGIVEWIEENGIDALFDLVLEELKKSEFTKKKTLNFEKEVSKNLQ
>NZ_CP015909.1|WP_015974072.1|887018_887285_+|phage-holin
MNQINWKLRLKSKAFWLALLPALFLLIQAIGASFGYKWNFVILNQQLAAVVNAAFALLAIVGVVADPTTSGLGDSDRVLNKDKSEENK
>NZ_CP015909.1|WP_064305186.1|887281_888571_+|LysM-peptidoglycan-binding-domain-containing-protein
MKKLIKKAAIGMVAFFVVAASGPVFAAVGDQGVDWSVYNGDYGNFGYGHDKFAFSQVGGTYGGSFVDQATYETQVASAIAQGKRAHTYIWYQVGGSQEVAKAALDRYLPRIQTPKNSIVALDYEGGASGDKQANTDAILYGMRRVKAAGYTPMYYSDKPYTLAHVNYKQITKEFPNSLWIAAYPNYEVTPVPNYSFFPSMDGISVFQFTSTYVAGGLDGNVDLTGITDNGYGKQKGQEVKPNTATPAIENGKEANEVKGNDVEVGMTVKVNFGAKNYATGETIPQWVKGQPHKIIQKNGDAVLLDGIMSWLSVHDVETIDASTSQPTTPAKSYIVKQGDTLSGIASNLGTNWQELARQNSLSNPNMIYSGQVIRFTGGQYGATARTYTVRSGDNLSSIASRLGTTVQSLVSMNGISNPNLIYAGQNIVY
>NZ_CP015909.1|WP_116368845.1|890482_891594_+|IS3-like-element-IS981-family-transposase
MQKGYSKEFKETLIAFYHSGQSVTQLSKEYDVAPATIYKWIDLYSKSNESSVSKADFLELKRQLAKVKEERDNLKKSIDHIRREKEVSAADMAQTIQTLALNVRLSCQLLDVPESSYYERINRHPSKTQLRRQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKPGYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYTKKVIAWDLGKRMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYWMTHSFSRRGYPYHNASLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSLGYLTPNQFEKVSA
>NZ_CP015909.1|WP_011675801.1|891697_892528_-|SP_1767-family-glycosyltransferase
MNIVENNIPDIKIRSIIETADFIKKNKSSLVRFGDGEIDIINHSSIPYQPYSPELAKQLKNILETQSDEKCLVALPDVFQNLERYNNSAQNFWKGHFERYHNFYQELHKSDWYANTFISRPYIDLEDKSSAAESFEAVRSLWEAKDILIVEGTSSRSGVGNTLFQNAKSISRIICPSHNAYQKYNDILESIKTFGMEKLILLMLGPTAKVLGFQLSREGYQAIDIGHIDSEYEWYQMGASYKVKLQHKHTAEHNYDTDIIFLQDNDYENSIIGRIE
>NZ_CP015909.1|WP_014572862.1|892833_894252_+|dipeptidase-PepV
MTTIDFKAEVEKRKDALMEDLFSLLRIDSAMDMEHADAENPFGPGPRKALDAFLKIAERDGYTTKNYDNYVGHFEYENGANADAEVLGIIGHLDVVPAGSGWDSNPFEPEIRNGNLYARGASDDKGPTVACYYALKILKELNLPLSKKIRFIVGTNEETGWADMDYYFEHCELPLPDFGFSPDAEFPIINGEKGNITEYLHFSGKNAGQVVLHSFKAGLAENMVPESATAVISGAKDLEAALEKFVAEHASKNLRFDLEEADGKATITLYGKSAHGAMPEKGINGATYLTLFLNQFDFADGAAAFIKVGAEKLLEDHEGEKLGTAFVDELMGNTSMNAGVWSFDENGEGKIALNFRFPQGNSPERMQEILAKLDGVVEVELSKHLHTPHYVPMSDPLVSTLIDVYEKHTGLKGYETIIGGGTFGRLLERGVAYGAMFEGEPDSMHQANEMKPVENIYKAAVIYAEAIYELAK
>NZ_CP015909.1|WP_021165391.1|894380_894740_+|holo-ACP-synthase
MVFGTGIDNVELSRIQKALTRSERFVEQVLTTMELEKYNNFQSTARKTEFLAGRWAAKEAFSKAYGTGFGKALGMHDLEIKNDELGKPYFSKHPFEGQVHLSISHSNLEAVAFVVLEKN
>NZ_CP015909.1|WP_021165392.1|894783_895887_+|alanine-racemase
MKTSPHRNTSAIVDLKAIRNNIEKFKKHINSNAEIWPAVKADAYGHGSVEVSKAVSDLVGGFCVSNLDEAIELRNHLVTKPILVLSGIVPEDVDIAAALNISLTAPSLEWLKLVVQEEAELSDLKIHIGVDSGMGRIGIRDVEEANQMIELADKYAINFEGIFTHFATADMADETKFKNQQARFNKIMAGLSRQPKFIHSTNTAAALWHKEQVQAIERLGISMYGLNPSGKTLELPFEIEPALSLVSELTHIKKIAAGETVGYGATYETSEETWIGTVPIGYADGWTRQMQGFKVLVDGKFCEIVGRVCMDQMMIKLDKSYPLGTKVTLIGRDKANEITTTDVADWRGTINYEVLCLLSDRIKRIYK
>NZ_CP015909.1|WP_064305184.1|896047_896467_+|Spx/MgsR-family-RNA-polymerase-binding-regulatory-protein
MIKIYTVASCSSCKKAKEWLEKHQLAYQEINLVTNHIGREDLLEILSLTECGTVDIISKRSQAYERLNIDFESIKLNDLVELIEMNPTILRRPLIIDNKRLQVGYNDDEIRKFLPRKMRKIQIEAATERLYQFDLEEQF
>NZ_CP015909.1|WP_011675806.1|896614_897922_+|NAD(P)/FAD-dependent-oxidoreductase
MFDYIIIGAGPGGLGLAYRLKTKDNKIAMIENDKWGGTCPNYGCDPTKMMMAVIEAKSHVEHLKGQGISGDLKIDWKGLRSRKLNITDPYEKSTFEGLKNADIETIYGSASFTEQGELQVAGEIYQAKTYIIATGSRPRRLELDGDEFLKTSNDFLALEELPAKISFMGSGPISLELAQIAKAAGSDVTIISRKKSNVAHFDEEMGQEFINYLKNQGINFIENISVSKVEKFTDGFLLTDGAGFEHKTDLVIAGVGRQPNSDQLNLDKVGVETDHKGIKVNDYLQTSNPKIYAMGDVLSKAEPHLTPVSSFEGNYLGQNLPNANKVPIHYPQIPTIIFGTAKLAEVGILTGTGIRTKSLNLKSWYTYKRINDPLAKLKVAINENQEIVGASTVSSVADEVINLISILIQQKMTLADVEKMIFTYPTVASDLEYFY
>NZ_CP015909.1|WP_064305183.1|898050_898968_+|ABC-transporter-ATP-binding-protein
MIEFQNVSKAFASKKILDHANFTIKDQEFFVLVGPSGSGKTTTLKMINKLVTHSEGKILINNEEVSTTNLRKLRLSVGYVLQQIALFPNLTVSENIALIPEMKGWDKTKITDRTNELLDLVGLDAKDYAHRQPSELSGGEQQRVGILRAIAANPKIVLMDEPFSALDPISRRQLQIFIKDLQKKMNLTIVFVTHDLDEALYLADRVAVMNDGLIQQIAEPADIYQHPANDFVKTFFKEYHQNLSTVSVENLLLTELSVNPEAQEVAENTTISEIINRLSEKEVLKYRGKSITSDDIICYIAGGEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015909_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015909_2

2132466-2132561

Orphan

Consensus_repeat	Method
TCTTCCTCAATCTTCCCAATTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015909_2

>merge|NZ_CP015909|2|2132466-2132561|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTTCCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATATTCTTCCTCAATTTTCCCAATTCTT

>NZ_CP015909|2|2|2132466-2132561|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTT	CCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATAT
TCTTCCTCAATTTTCCCAATTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015909.1\|WP_003331415.1\|2135007_2136231_-\|IS21-like-element-IS712-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP015909.1\|WP_116368894.1\|2140580_2141692_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP015909.1\|WP_021037905.1\|2118152_2119097_-\|carbamate-kinase	unknown	unknown	gnl\|CDD\|223623
NZ_CP015909.1\|WP_021165018.1\|2132591_2133212_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP015909.1\|WP_021165019.1\|2128474_2129074_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015909.1\|WP_003331414.1\|2134237_2134996_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP015909.1\|WP_021165011.1\|2142322_2143105_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP015909.1\|WP_011677119.1\|2139856_2140186_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227933
NZ_CP015909.1\|WP_081146305.1\|2133294_2133975_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP015909.1\|WP_021165020.1\|2126942_2128274_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
NZ_CP015909.1\|WP_021165024.1\|2116758_2117889_-\|aminotransferase	unknown	unknown	gnl\|CDD\|235989
NZ_CP015909.1\|WP_061778278.1\|2136543_2137434_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP015909.1\|WP_004254487.1\|2126324_2126783_+\|arginine-repressor	unknown	unknown	gnl\|CDD\|130592
NZ_CP015909.1\|WP_011677103.1\|2115075_2116569_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP015909.1\|WP_011677109.1\|2124562_2126257_-\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|183534
NZ_CP015909.1\|WP_021165021.1\|2121798_2122863_-\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|179366
NZ_CP015909.1\|WP_011677113.1\|2129290_2132395_-\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|350770
NZ_CP015909.1\|WP_011677117.1\|2138615_2139395_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373100
NZ_CP015909.1\|WP_015082898.1\|2137586_2138543_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP015909.1\|WP_011677102.1\|2114508_2115000_-\|prolyl-tRNA-editing-protein	unknown	unknown	gnl\|CDD\|226283

Protein	Function_ID	Function_description	E-value
NZ_CP015909.1\|WP_003331415.1\|2135007_2136231_-\|IS21-like-element-IS712-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.63091e-43
NZ_CP015909.1\|WP_116368894.1\|2140580_2141692_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.17671e-66
NZ_CP015909.1\|WP_021037905.1\|2118152_2119097_-\|carbamate-kinase	gnl\|CDD\|223623	COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism].	6.8032e-176
NZ_CP015909.1\|WP_021165018.1\|2132591_2133212_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.33692e-09
NZ_CP015909.1\|WP_011677109.1\|2124562_2126257_-\|arginine--tRNA-ligase	gnl\|CDD\|183534	PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP015909.1\|WP_003331414.1\|2134237_2134996_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	3.89255e-62
NZ_CP015909.1\|WP_061778278.1\|2136543_2137434_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.24582e-26
NZ_CP015909.1\|WP_021165011.1\|2142322_2143105_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.37116e-07
NZ_CP015909.1\|WP_011677119.1\|2139856_2140186_-\|hypothetical-protein	gnl\|CDD\|227933	COG5646, COG5646, Uncharacterized conserved protein [Function unknown].	1.81818e-27
NZ_CP015909.1\|WP_021165020.1\|2126942_2128274_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
NZ_CP015909.1\|WP_021165024.1\|2116758_2117889_-\|aminotransferase	gnl\|CDD\|235989	PRK07324, PRK07324, transaminase; Validated.	0
NZ_CP015909.1\|WP_011677113.1\|2129290_2132395_-\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|350770	cd18012, DEXQc_arch_SWI2_SNF2, DEAQ-box helicase domain of archaeal and bacterial SNF2-related proteins. Proteins belonging to SNF2 family of DNA dependent ATPases are important members of the chromatin remodeling complexes that are implicated in epigenetic control of gene expression. The Snf2 family comprises a large group of ATP-hydrolyzing proteins that are ubiquitous in eukaryotes, but also present in eubacteria and archaea. Archaeal SWI2 and SNF2 are members of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.9716e-94
NZ_CP015909.1\|WP_004254487.1\|2126324_2126783_+\|arginine-repressor	gnl\|CDD\|130592	TIGR01529, Arginine_repressor., arginine repressor. This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions].	4.3854e-60
NZ_CP015909.1\|WP_011677103.1\|2115075_2116569_-\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	8.34857e-152
NZ_CP015909.1\|WP_015082898.1\|2137586_2138543_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	3.4174e-51
NZ_CP015909.1\|WP_021165021.1\|2121798_2122863_-\|ornithine-carbamoyltransferase	gnl\|CDD\|179366	PRK02102, PRK02102, ornithine carbamoyltransferase; Validated.	0
NZ_CP015909.1\|WP_011677102.1\|2114508_2115000_-\|prolyl-tRNA-editing-protein	gnl\|CDD\|226283	COG3760, COG3760, Uncharacterized conserved protein [Function unknown].	1.74136e-74
NZ_CP015909.1\|WP_011677117.1\|2138615_2139395_-\|hypothetical-protein	gnl\|CDD\|373100	pfam14507, CppA_C, CppA C-terminal. This is the C-terminal domain of the CppA protein found in species of Streptococcus. CppA is a putative C3-glycoprotein degrading proteinase, involved in pathogenicity. It is often found associated with pfam14506.	3.1718e-25
NZ_CP015909.1\|WP_081146305.1\|2133294_2133975_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.50015e-87

>NZ_CP015909.1|WP_011677113.1|2129290_2132395_-|DEAD/DEAH-box-helicase-family-protein
MSRMMPARVRSEGIALYAKGFLNDPIETDFKLTAEIDGEEVSYDLDGAQDSCTCSIFQQNHRYCKHIAAIEEYLKNQDKGSLETKDKETKGAERGLYNENIAFLDAVNGETQLNFSTDQYSIEVQIEDNSQLYDYFSMDYFLYFDLKLKSKNLGRSYVIKDIPYFLRALKNYSQYSLGSLHYIDLFFDNFDEASQEFLSFLLKIDGKSDEALTKSLYIKNGRYLNIPFLFLEEAMDLVSALEVYQLKIIGRTVNYFTFIPLDNDSEIFKFKVESQQDYIELSLFSEDYHNFYDYSLLYDNNVFYKLSQEQRRLLLVLDKQFAQKSKIKFSYSEKDKLAQALQQLSTLGKIEAPEHFVVKPFDAKFTFDLLDEKTLSLAMKFDYGTFSIDSFHDLETLEFSRDLRKEQKIFALMERLQFAKAFNSTLEITEHLSENFFLKILPSFQKLGQIELSPTLRNMRMDEVPEIHIDSQGGLLDISFNIPHVEDGEFANVIAKLQENAEFYISESGKFYHFNEKFDRLKAALHELDDQFVIQGSSLHVNINRSFQISKIFEKISGASFSEKFKSLYQHLTHPEEFPYEKPEHIKASLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFILSNLKKDESVLITAPASLTYNWASEFEKFTDEIDFVVIDGNKADRTKEIQENHQIYITSYGSFLKDFEDYQDKKLNYLLLDEAQVVKNYSSKTNKSLSALNVEHTFALSGTPLENRIEEIWAIFQVVMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIYLAQLELMQKQVLEMDNAALSRSRIEILAGITRLRQICNTPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFSQFTKVFPHIEKLMEEQEMTAYKLTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLTSADVVILVDLWWNPAVEEQAIARAHRMGQKNTVEVIRLITQGTIEEKIMEIQERKKDLIANVLEGDTVDKVLSEAEIREILGV
>NZ_CP015909.1|WP_021165019.1|2128474_2129074_-|hypothetical-protein
MVERRVVFPVIGDDEVLQKDTRVIFTNQQLLTRNPSLQDEASIETSKSKTDAKRPESFKPYKAKTSFSTQHRPLNSNHAGVSSYDKMPKKTSVDESKERAKRAAATLPKPPKQYVSPLERDKEDLTVRRSTSAILNKRPSTNDNPIRDMKKQGMNVSDAVAKNGSGMKKATPHGGAANDTQKASYFENKRKNIFDRGIV
>NZ_CP015909.1|WP_021165020.1|2126942_2128274_-|UDP-N-acetylmuramate--L-alanine-ligase
MEKTYHFTGIKGSGMSALALMLHQMGKNVQGSDSTDYFFTQRGLEQVGVPLLPFDEKNIKPEFELIVGNAFRDDNNVEIAFAHKNGFPFKRYHEFLGHFMEDFTSIGVAGAHGKTSTTGMLAHVMSNIVDTSYLIGDGTGRGNAGSEYFVFESDEYERHFMPYHPEYTIMTNIDFDHPDYFEGIEDVTSAFQDYANNIKKGIFAYGEDVNLRKLSAKAPIYYYGFEANDDYRAENLIRSTRGSSFDAYFRGEKIGHFVVPTYGKHNVLNALSVVAVCHNLGLDMTDVADHLLTFRGVKRRFTEKKVGETVIIDDFAHHPTEIEATLDAARQKYPDREIVAVFQPHTFTRTIAFADEFAEVLDHADTVYLAQIYGSAREVDHHEITAQDLADKVRKPAKVIELDNVSPLLDHDRGIYVFMGAGNIQKYEIAFEKLLSQTSTNLQ
>NZ_CP015909.1|WP_004254487.1|2126324_2126783_+|arginine-repressor
MKRDKRLEIIKEIVTNNKISTQEELQSLLLERGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNSKINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDSRTDILGTIAGADTLLVICASEKAANILTAEIKYILLG
>NZ_CP015909.1|WP_011677109.1|2124562_2126257_-|arginine--tRNA-ligase
MDEKQLVSQALSAAIDGVLGVEQIAAIIEKPKSSDLGDLAFPAFQLAKTLRKSPQIIAGEIAEKIDTKGFEKVIAVGPYVNFFLDKNATASEVIREVLTEGEHYGDANIGEGGNVPIDMSAPNIAKPFSIGHLRSTVIGDSIAKIYEKLGYQPIKINHLGDWGKQFGLLITAYKKYGDEATITANPIDELLKLYVKINAEAKEDPEVDEEGRQWFLKMEQGDEEALRIWKWFSDVSLIEFNRIYGKLGVTFDHFMGESFYSDKMDAIVEDLENKNLLHESKGALIVDLEKYNLNPALIKKTDGATLYITRDLATAAYRKKTFNFVKSLYVVGGEQTNHFKQLKAVLKEAGYDWSDDMVHVPFGMVTQGGKKFSTRKGHVVKLEMALDEAVDRAEKQIEAKNPNLENKEEVAKQVGVGAVKFYDLKTDRNNGYDFDLDEMVSFEGETGPYVQYAHARIQSILRKANRKVNIDNISLVVSDAEAWEIVKALKEFPNIVKRAADNYEPSIIAKYAISLAQAFNKYYAHVRILEDDAQLDGRLALISATSIVLKEALRLLGVAAPENM
>NZ_CP015909.1|WP_021165021.1|2121798_2122863_-|ornithine-carbamoyltransferase
MTSPLITKAEVNSVFQGRSLLAEKDFTPAEINYLVDFGLHLKALKQQNIPHHYLEGKNIALLFAKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGIKESTEDTARVLGSMFDAIERRGFSQKEVEDLAKYSGVPVWNGLTDDWHPTQMIADFMTVKENFGYLKGLTLVYVGDGRNNMANSLIVTGSMLGVNVHIVAPDSLHPSKEVMDIANKFAEKSGAKPLATSNIEEGVKGANIIYSDVWVSMGESNWEERVKLLTPYRITMDMLKMTGNADNGKLIFMDCLPAFHDTETEYGKEIKEKYGLTEMEVTDEVFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPAVPEDFK
>NZ_CP015909.1|WP_021037905.1|2118152_2119097_-|carbamate-kinase
MVRRMVVALGGNAILTDDPTAKAQERALETTAEQLIPLIRNNDVEMVVTHGNGPQVGNLLLQQLAADSPKNPAMPIDTAVAMTQGQIGFWMGQAFTRALIKNKMERVPVISVVTRTVVDKDDSAFEKPTKPIGPFYDEKGLAEMKAQYPDWTFVEDSGRGYRRVVPSPKPTRIVEAEAIKPLISSSVLVTVSGGGGIPVIETQEGYEGVEAVIDKDFSAAKVAELVEADNLLILTAVDNVFVNFNKPNQKKLETVTMAEMKAYIKEGQFAAGSMLPKVEAAMEFVTRTGRPATITSLENLEDFLNNDSGTKIIP
>NZ_CP015909.1|WP_021165024.1|2116758_2117889_-|aminotransferase
MELVQFGCEDWLNVWEKSATIDIAQSTIDSLSLEEVLAFEEDKGEAFMSQMMKEKFSYGWIEGSPAFKSEVAKLYKRVSEDNILSTNGATGANFLTILGLIGQGDHVIAQYPSYQQLYDWPKTLGAQVDYWKIKEENHWLPQIEDLRRLVKPNTKLICLNNAAQPTGAIMSPDFLAEVVEIARSVDAYILCDEVYLPLDEETPYAPIADLYEKGISTNSISKTYSVPGIRVGWVATQDRDLCNEFRKIRDYTLICTGVFDDALASLVLKHKDKVLARARDIVKGNLSILKEWVENEPLVSMVYPNAVSVSFVKFEQLDPMKTEDFAIQLLREKGVLIIPGNRFDLPGYARIGYCTDEKTLRQGLQLLSEFLREYKG
>NZ_CP015909.1|WP_011677103.1|2115075_2116569_-|amino-acid-permease
MENKKTKGISLFALLAIIISGAIGGGVFNLANDLARGSTPGGVVISWLFIGFGILMLVLSFNRLITIKPDLSGVSDYARAGFGDFVGFLSGWGYWISAWTGTIGFAVLMMTSADYFFPGKFANSNGSLTILSVIIVSIISWILMLLVDRGVETAAAVNAIVMIAKLIPLVVFSITGIILFKANIFTQHFWQTFTTNFAADGSVKDFVWHAMTASGLLSQIKGSLLVMVWVFVGIEGAAMMGNRAKKKSDTAKATVIGLAVLLVIYVLLSLLPYGYMDQASLANVKAPGLVYILNEMVGGWGGSLMAVGLMISLLGAWLSWTMLPVEATQQLAEQKLLPSWFGKLNKYHAPSNSLLITQLMIQIFIIITYFVANAYNVFIYMATAVIMICYALVGAYLFKIGLKEASVKNILIGFFTFAFQALALYLSGWQYVWLAMILYTIGFLLFIGAKKESHQSISVKEWLGMLVVTVLGVLAIVVLICGAKAGTGFDLRGLLGF
>NZ_CP015909.1|WP_011677102.1|2114508_2115000_-|prolyl-tRNA-editing-protein
MRTFAEVEKLLTELSIPYKIVEHPASHSTEESDNYIKDYEGCRSKTLILANKKSTQFYMIIMDDAKQVDMNRLSEILEVKRLHFISEDRLEEMLGLNSGIVSLFGLVGTNYENMNIYFDQQMLDDYQIQTFHPNDNTKTIFFKMEACFTILKSQGYDYQIIDL
>NZ_CP015909.1|WP_021165018.1|2132591_2133212_-|tyrosine-type-recombinase/integrase
MKEFEKTQNAKQEDCVRKRLFIEFTYLNGNRYGEGAGLKFSTVNHGGIWIKDQYSRKSSVKNPINKQTKTLTSRRIKAFENDDTRSKEIIQWFLDHNNSGINDDYIFVRKNGHLLSDDTMNRYLHRFEKQMPDKLSSSFVMHSLRNSYITRRAEAGDTETEIMAKVGHANPNLVHTLYTHVRDTLKFDEQKKFKKQPRLLKIGKSA
>NZ_CP015909.1|WP_081146305.1|2133294_2133975_+|IS6-family-transposase
MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYDRGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLHKQFGQPRVIVKDKAPSIGSAFRKLQSNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSLRTSSTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVLMGILA
>NZ_CP015909.1|WP_003331414.1|2134237_2134996_-|ATP-binding-protein
MTTYHQLLNQLDHLKLDRVRQLLPEFLDEHADISLVEGLHELLSEELREREALLQERRLKKAHLPYEKRVMDFDFQFQPKINKAEILDLHTLRFLDKHENLLFIGNSGVGKTHLAISITLEALEKGYSSYFCMSTELVDRLLRANQKGTLERVLKQYANYDVLVIDEVGYLPFSRDGASLLFQLINMRYEKKSTLITTNIPLSQWSEFLQDKKLTNALLDRLVHHSKVISITGKSYRMKDYSEKKTKTPKSK
>NZ_CP015909.1|WP_003331415.1|2135007_2136231_-|IS21-like-element-IS712-family-transposase
MRKDILESITEHLMTGIKPNFADIARRYNCDYRTVKRYYDLGKEKTLEEASKRRVPPSLIENYKSIIEDKLKLGCSVRSIYYFIQLKGYQGSYTTVKRYARLIRESCKHKATIRIETTPGLSAQVDWKENLKLISRNGEVFTINIFLYILGYSRMKYLQLTVDRLQPTLFECLNHAFEKFGGVPEEIWFDNMKTVVDHSKSQFSNVVFNERFRQYAKDAGFKPIACRPFRPQTKGKVEALARTVDRLLVFNNEFEDLEELQALVQQLMEDLNHKEISQAIGTSPSERLDQEALNLKAFDLELLKVYSQLSVPLTRKVSKEALVIFEGRKYSVPVKYIGQTVTCEKEQEDLKVYCDQRLIARHPLSDRPFNYRREDYVEILKSDVFKHLEEDELEAYVDENLQAYDLL
>NZ_CP015909.1|WP_061778278.1|2136543_2137434_+|IS982-family-transposase
MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIIDSFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYGCKCHALVSESGYIIDYTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMPK
>NZ_CP015909.1|WP_015082898.1|2137586_2138543_-|serine-hydrolase
MKNQQEFLAMIEDYLERDVFPGVNFAILEGEEVSEYLFGKAALIPEPIALTPGKKWDLASLTKVIGTGTAVIDLVLAGKLELDAPLQKYYAKFTDSTVSLRQLLTHTSGIDPYIPNRDKLGFFELTEAINQIRVTDDKSFKYTDINFILLGFLLEEYYDESLDYIFNKNIFKNWEMKQTSFGSVENAVPTSQNIPLGTVHDPKAQVLKNHCGSAGLFSTLSDMILFSQAYFREEKYLELLKNYADGAKERSLAWDLPAENNDWLLHTGYTGTFILINPRIKKAVVFLSNRVHLKDNREKWIEERDRLIKFLINHLSLD
>NZ_CP015909.1|WP_011677117.1|2138615_2139395_-|hypothetical-protein
MSEIINHITAFQPVYRVLHREENLDFYRGVLGFKVLVEEGAMVWLGGHEAKKDRFQLEESPGFHPVEGLKKHGQTVIKANSSEIEQLIVRNLDKIAKIYQGKNGLAFTALSPEAGLFLVSSDSLTDLPALTEINKSEIKLNLDKNFKGLSDFEITAMNLNVADKSIIEFYESVFDLKAIDGKIEFPFVTLTLNVEESEDLTAGTDEVLDLEFLIFMIDKDFDLKAFANQFSEANGTYIDASAKTFSLEVPDHAELWFVK
>NZ_CP015909.1|WP_011677119.1|2139856_2140186_-|hypothetical-protein
MEFEEFFINNQLMKLIRETVLSIFPEAQERISYGMPAWFNGKTVLIYAQPQKHHLGIYPRPNFIEKHLEVLKQQYECSKGTIKVPYGIEHGELRKLVSDVINWNLTHFT
>NZ_CP015909.1|WP_116368894.1|2140580_2141692_+|IS3-family-transposase
MQKRYSKEFKETLIAFYHSGQSVIQLSKEYDVAPATIYKWIDLYSKSNESSVSKADFLELKRQLAKVKEERDNLKKSIDHIRREKEVSAADMAQTIQPLALNVRLSCQLLDVPESSYYERINRHPSKTQLRRQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKPGYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPNQQGWAYLSTIMDRYTKKVIAWDLGKRMTVELVQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEYEELLKYYGMTHSFSRRGYPYHNASLESWHGHFKREWVYQFKYKNFEEAYQSIFWYIEDFYNSKRIHQSLGYLTPNQFEKVSA
>NZ_CP015909.1|WP_021165011.1|2142322_2143105_+|CPBP-family-intramembrane-metalloprotease
MNIEKLQFLAKYRWIIVLILALIFSGLSVSIFHLPFLMTALVLSVIGLIFAYHKSVWLVLFILSNLPMLVSTIFASQHHFSTLDTIIFFIIFIFTIISSYLIARKAELIPKLSWKYFPPLRIILGFVLLFLVSILTGIFAQIFNQSPTTTNQESLNELQKVIPIAVFATQTLAASFLEELVYRVGIFELIFKNQKYFAFLTTMLLFAFMHGPTDVYSWLTYGLMSLVLTGLYAKYSNFYLNMSVHFLWNLFGLVIALMVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF775673	Lactococcus phage LP9206a, complete genome	7627-7672	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF775670	Lactococcus phage LP9104, complete genome	7617-7662	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MN534318	Lactococcus phage proPhi5, complete genome	36458-36503	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MN534315	Lactococcus phage proPhi1, complete genome	36458-36503	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF775671	Lactococcus phage LP9205a, complete genome	7627-7672	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	NC_049398	Lactococcus phage 16802, complete genome	7635-7680	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF775674	Lactococcus phage LP9206b, complete genome	7627-7672	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	KC522412	Lactococcus phage CaseusJM1, complete genome	7607-7652	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	NC_049416	Lactococcus phage LP8511, complete genome	7617-7662	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF775672	Lactococcus phage LP9205b, complete genome	7627-7672	0	1.0
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF448557	Lactococcus phage 37201, complete genome	8305-8350	1	0.978
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	KP793104	Lactococcus phage 936 group phage PhiB1127, complete genome	7627-7672	1	0.978
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	KP793109	Lactococcus phage 936 group phage PhiC0139, complete genome	7627-7672	1	0.978
NZ_CP015909_1	1.1\|885386\|46\|NZ_CP015909\|CRISPRCasFinder	885386-885431	46	MF448566	Lactococcus phage 63302, complete genome	7597-7642	1	0.978

1. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF775673 (Lactococcus phage LP9206a, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

2. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF775670 (Lactococcus phage LP9104, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

3. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MN534318 (Lactococcus phage proPhi5, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

4. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MN534315 (Lactococcus phage proPhi1, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

5. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF775671 (Lactococcus phage LP9205a, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

6. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to NC_049398 (Lactococcus phage 16802, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

7. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF775674 (Lactococcus phage LP9206b, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

8. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to KC522412 (Lactococcus phage CaseusJM1, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

9. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to NC_049416 (Lactococcus phage LP8511, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

10. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF775672 (Lactococcus phage LP9205b, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

11. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF448557 (Lactococcus phage 37201, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcagca	Protospacer
*******************************************.**

12. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to KP793104 (Lactococcus phage 936 group phage PhiB1127, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaattgtttcaaca	Protospacer
***********************************.**********

13. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to KP793109 (Lactococcus phage 936 group phage PhiC0139, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaattgtttcaaca	Protospacer
***********************************.**********

14. spacer 1.1|885386|46|NZ_CP015909|CRISPRCasFinder matches to MF448566 (Lactococcus phage 63302, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcggcaactgtttcaaca	Protospacer
******************************.***************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

406458 : 418615

uncultured_virus(30.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675460.1\|406458_406776_+	thioredoxin family protein	A0A0K2FIM3	Achromobacter_phage	9.0e-06	31.9
WP_011675461.1\|406881_407508_+\|tRNA	DUF4479 and tRNA-binding domain-containing protein	NA	NA	NA	NA
WP_021165897.1\|407669_409010_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_021165898.1\|409100_409490_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	2.0e-23	47.4
WP_011675464.1\|409608_409893_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.3e-13	43.0
WP_021213999.1\|409979_411608_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.7e-156	56.4
WP_011675466.1\|411659_412472_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	1.5e-33	38.1
WP_011675468.1\|412661_414089_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	3.9e-32	32.9
WP_003131580.1\|414081_414783_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_015082045.1\|414960_415596_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.6e-73	66.0
WP_011675470.1\|415728_416589_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.1e-64	44.8
WP_064305123.1\|416638_417421_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_011675472.1\|417413_417740_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_021165901.1\|417739_418615_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.0e-100	66.1

DBSCAN-SWA_2

578154 : 632629

Bacillus_phage(25.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_116368833.1\|578154_579547_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.3e-56	45.0
WP_021166347.1\|581174_583190_+	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	2.6e-58	31.8
WP_021166348.1\|583242_583413_-	DUF3042 family protein	NA	NA	NA	NA
WP_011675765.1\|583607_584273_+	YitT family protein	M1Q1P6	Streptococcus_phage	2.3e-19	29.8
WP_011675766.1\|584404_585289_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_021166349.1\|585434_586103_+	hypothetical protein	NA	NA	NA	NA
WP_011675768.1\|586267_587170_+	SPFH domain-containing protein	A0A1V0SL90	Klosneuvirus	1.8e-35	35.2
WP_021166351.1\|588543_588891_-	XRE family transcriptional regulator	A0A182BQC8	Lactococcus_phage	1.2e-43	75.4
WP_015082147.1\|589655_590579_+	ribonuclease Z	NA	NA	NA	NA
WP_021166352.1\|590571_591273_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_021166353.1\|591445_593674_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	8.7e-79	31.1
WP_011834623.1\|593798_594311_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.3e-32	44.0
WP_021166354.1\|594501_595065_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_021166355.1\|595200_596841_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_014573028.1\|596901_597372_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_116368835.1\|597463_598838_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.3e-51	42.5
WP_021166358.1\|599054_599510_+	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_021166359.1\|599499_601950_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	6.3e-123	34.2
WP_011834629.1\|602084_602642_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_010905473.1\|602829_604131_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
WP_021166361.1\|604172_604853_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-29	36.8
WP_081146204.1\|604854_605928_-	ABC transporter permease	NA	NA	NA	NA
WP_014573008.1\|605939_606509_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_021166362.1\|606695_608219_-	acyl-CoA synthetase	NA	NA	NA	NA
WP_021166363.1\|608412_609330_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_021166364.1\|609504_611868_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	8.0e-107	31.8
WP_021166365.1\|611996_612656_+	dephospho-CoA kinase	NA	NA	NA	NA
WP_021166366.1\|612658_613876_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003129585.1\|613872_614019_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_011675634.1\|614396_615659_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_021166367.1\|615763_619177_+	pyruvate carboxylase	NA	NA	NA	NA
WP_064305132.1\|620624_623171_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_081146206.1\|623190_624429_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_064305133.1\|624468_625068_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.2e-52	52.6
WP_011675638.1\|625263_625794_+	hypothetical protein	NA	NA	NA	NA
WP_003129597.1\|625963_626362_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_011675640.1\|626743_627907_-	ABC transporter permease	NA	NA	NA	NA
WP_015081777.1\|627997_628756_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
WP_064305106.1\|628767_629991_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
WP_101944661.1\|631518_632629_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4

DBSCAN-SWA_3

833299 : 931898

109

Lactococcus_phage(74.29%)

transposase,plate,tail,terminase,integrase,holin,head,capsid,portal

attL 833910:833928|attR 882831:882849

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152023825.1\|833299_834672_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.8e-54	43.1
833910:833928	attL	NA	NA	NA	NA
WP_064305190.1\|834723_835344_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	8.0e-99	82.9
WP_014572475.1\|836012_836555_+	ParB-like nuclease domain-containing protein	A0A220GKT8	Streptococcus_phage	5.8e-61	66.1
WP_011676403.1\|836584_836887_+	helix-turn-helix transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	6.0e-07	51.7
WP_021166271.1\|837168_838113_+	cation transporter	NA	NA	NA	NA
WP_021166270.1\|838166_838598_+	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_064305189.1\|838668_839589_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.9e-32	37.7
WP_031286733.1\|839777_840374_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011676397.1\|841702_841891_+	hypothetical protein	NA	NA	NA	NA
WP_011676396.1\|841903_842566_+	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_021166267.1\|842552_842945_+	cytidine deaminase	NA	NA	NA	NA
WP_064305188.1\|843212_844268_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	1.1e-60	41.2
WP_011676393.1\|844454_845162_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_021166266.1\|845169_845610_-	DUF4395 domain-containing protein	NA	NA	NA	NA
WP_011676391.1\|845707_847261_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-33	37.3
WP_011676390.1\|847250_847961_-	response regulator transcription factor	A0A1V0SGR9	Hokovirus	5.3e-06	30.1
WP_011676389.1\|848144_848480_+	putative DNA-binding protein	NA	NA	NA	NA
WP_021166264.1\|849094_850174_-\|integrase	site-specific integrase	A5GYP9	Lactococcus_phage	4.7e-203	99.2
WP_021166263.1\|850295_850874_-	SHOCT domain-containing protein	Q9AZQ9	Lactococcus_phage	3.1e-97	98.4
WP_031286732.1\|850957_851794_-	helix-turn-helix domain-containing protein	Q9AZQ8	Lactococcus_phage	5.1e-157	99.6
WP_031286731.1\|852010_852190_+	putative transcriptional regulator	A0A1B1IMU6	Lactococcus_phage	4.0e-27	100.0
WP_015966780.1\|852210_852453_+	hypothetical protein	Q77JL3	Lactococcus_phage	5.2e-38	100.0
WP_021166261.1\|852465_853290_+	hypothetical protein	Q38330	Lactococcus_phage	9.3e-119	81.8
WP_021166260.1\|853302_853593_+	hypothetical protein	Q9AZW0	Lactococcus_phage	7.9e-49	97.9
WP_021166259.1\|853659_853896_+	DUF1408 domain-containing protein	Q9MC36	Lactococcus_phage	6.7e-38	96.2
WP_021166258.1\|854000_854519_+	hypothetical protein	Q9XJE3	Lactococcus_phage	3.6e-84	95.3
WP_064305187.1\|854527_855286_+	hypothetical protein	Q0ILF6	Lactococcus_phage	3.4e-144	97.2
WP_021166254.1\|855278_855704_+	single-stranded DNA-binding protein	Q9AZV6	Lactococcus_phage	1.7e-71	95.0
WP_015966802.1\|855832_856615_+	phage replisome organiser protein	Q9XJE6	Lactococcus_phage	3.7e-125	100.0
WP_021166253.1\|856614_857340_+	hypothetical protein	A0A1P8BKN5	Lactococcus_phage	1.7e-132	97.9
WP_003132944.1\|857336_858095_+	site-specific DNA-methyltransferase	Q9XJE8	Lactococcus_phage	1.6e-146	99.6
WP_021166252.1\|858084_858474_+	RusA family crossover junction endodeoxyribonuclease	R9QLL1	Lactococcus_phage	2.3e-67	96.9
WP_021166251.1\|858477_858672_+	hypothetical protein	Q38101	Lactococcus_phage	3.3e-27	98.4
WP_031286728.1\|858664_858904_+	DUF1031 family protein	Q94M89	Lactococcus_phage	1.7e-36	97.5
WP_021166249.1\|859015_859195_+	DUF1497 domain-containing protein	A0A1P8BMJ6	Lactococcus_phage	3.5e-23	98.3
WP_021166248.1\|859184_859754_+	DUF658 family protein	Q9B002	Lactococcus_phage	3.8e-87	96.3
WP_011676533.1\|859764_860025_+	hypothetical protein	NA	NA	NA	NA
WP_021166247.1\|860025_860232_+	DUF1125 domain-containing protein	Q9MC26	Lactococcus_phage	3.4e-30	98.5
WP_021166246.1\|860224_860854_+	DUF1642 domain-containing protein	Q9AZ77	Lactococcus_phage	1.2e-65	65.4
WP_021166245.1\|860850_861270_+	dUTP diphosphatase	Q77K24	Lactococcus_phage	1.5e-72	99.3
WP_021166244.1\|861274_861544_+	hypothetical protein	A0A1P8BKH9	Lactococcus_phage	2.5e-41	87.5
WP_021166243.1\|861540_861855_+	hypothetical protein	NA	NA	NA	NA
WP_134799462.1\|861866_862256_+	hypothetical protein	A0A1P8BM10	Lactococcus_phage	4.2e-37	97.5
WP_021166241.1\|862252_862579_+	hypothetical protein	NA	NA	NA	NA
WP_031286727.1\|862620_862956_+	DUF1140 family protein	Q77MW4	Lactococcus_phage	2.4e-49	90.9
WP_021166239.1\|862974_863205_+	hypothetical protein	A0A1P8BMS6	Lactococcus_phage	5.4e-08	43.6
WP_015966898.1\|863201_863360_+	DUF1660 domain-containing protein	Q9AZ71	Lactococcus_phage	9.3e-28	100.0
WP_021166237.1\|863599_863842_+	hypothetical protein	A6MA87	Lactococcus_virus	8.7e-25	69.6
WP_014573151.1\|863922_864345_+	DUF722 domain-containing protein	Q9AYX5	Lactococcus_phage	5.5e-75	100.0
WP_011676523.1\|864715_865126_+\|terminase	terminase	Q9AZ67	Lactococcus_phage	1.4e-67	100.0
WP_021165213.1\|865118_866507_+\|terminase	phage terminase large subunit	Q2QER6	Lactococcus_phage	4.5e-275	100.0
WP_021165214.1\|866507_867866_+\|portal	phage portal protein	Q9AZ65	Lactococcus_phage	3.3e-254	99.6
WP_021165215.1\|867869_868910_+\|capsid	minor capsid protein	B5SP29	Lactococcus_phage	2.4e-188	97.4
WP_003131938.1\|868955_869288_+	hypothetical protein	Q9AYW8	Lactococcus_phage	1.3e-58	100.0
WP_021165216.1\|869411_870074_+	DUF4355 domain-containing protein	B5SP30	Lactococcus_phage	1.4e-77	99.5
WP_021165217.1\|870075_870894_+\|capsid	N4-gp56 family major capsid protein	Q9AZ61	Lactococcus_phage	1.5e-140	98.2
WP_011676051.1\|870893_871094_+	hypothetical protein	B5SP32	Lactococcus_phage	9.6e-30	100.0
WP_021165218.1\|871077_871410_+\|head,tail	phage head-tail connector protein	A0A1L2JXP0	Streptococcus_phage	4.2e-54	100.0
WP_021165219.1\|871406_871718_+	hypothetical protein	B5SP34	Lactococcus_phage	1.8e-54	97.1
WP_021165220.1\|871714_872041_+	HK97 gp10 family phage protein	A0A1P8BKS5	Lactococcus_phage	1.7e-52	97.2
WP_021165221.1\|872037_872427_+	hypothetical protein	Q38611	Lactococcus_phage	4.0e-64	95.3
WP_021165222.1\|872437_872947_+\|tail	phage major tail protein, TP901-1 family	Q77K19	Lactococcus_phage	2.9e-86	96.4
WP_014572189.1\|873062_873413_+	hypothetical protein	B5SP38	Lactococcus_phage	5.0e-58	100.0
WP_021165223.1\|873496_873766_+	hypothetical protein	A0A1P8BKT4	Lactococcus_phage	1.5e-41	98.9
WP_003331414.1\|874954_875713_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_003331415.1\|875724_876948_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
WP_021165306.1\|878584_879346_+	hypothetical protein	B5SP41	Lactococcus_phage	2.0e-139	97.2
WP_021213901.1\|879345_882102_+	peptidoglycan DD-metalloendopeptidase family protein	Q9AZ57	Lactococcus_phage	0.0e+00	97.3
WP_021165307.1\|882114_883095_+\|plate	phage baseplate upper protein	A0A1P8BKH4	Lactococcus_phage	2.9e-180	96.6
882831:882849	attR	NA	NA	NA	NA
WP_021165308.1\|883084_883870_+	fibronectin type III domain-containing protein	B5SP44	Lactococcus_phage	1.3e-85	63.6
WP_021165309.1\|883888_884380_+	hypothetical protein	Q9G096	Lactococcus_phage	6.6e-88	97.5
WP_011676503.1\|884393_884618_+\|holin	holin	A0A1B1IMU8	Lactococcus_phage	6.1e-33	100.0
WP_015974072.1\|887018_887285_+\|holin	phage holin	A0A1B1IMU0	Lactococcus_phage	1.6e-40	100.0
WP_064305186.1\|887281_888571_+	LysM peptidoglycan-binding domain-containing protein	Q9FZS8	Lactococcus_phage	3.5e-237	96.0
WP_116368845.1\|890482_891593_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	2.1e-49	41.4
WP_011675801.1\|891697_892528_-	SP_1767 family glycosyltransferase	NA	NA	NA	NA
WP_014572862.1\|892833_894252_+	dipeptidase PepV	NA	NA	NA	NA
WP_021165391.1\|894380_894740_+	holo-ACP synthase	NA	NA	NA	NA
WP_021165392.1\|894783_895887_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.3e-30	28.1
WP_064305184.1\|896047_896467_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_011675806.1\|896614_897922_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_064305183.1\|898050_898968_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.0e-22	30.1
WP_011835503.1\|898964_900467_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_064305182.1\|903106_903610_+	hypothetical protein	NA	NA	NA	NA
WP_021165395.1\|903619_903997_+	hypothetical protein	NA	NA	NA	NA
WP_031286442.1\|904287_904572_+	hypothetical protein	NA	NA	NA	NA
WP_021165496.1\|905613_907656_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-61	30.9
WP_011835499.1\|907844_908702_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.6e-39	39.0
WP_031286477.1\|908872_910126_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.2e-45	32.3
WP_011675817.1\|910128_910368_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_064305180.1\|910594_911485_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165630.1\|911543_912689_+	glycerate kinase	W6LM47	Streptococcus_phage	4.5e-47	37.8
WP_014572853.1\|912913_913771_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_021165631.1\|913771_914272_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021165632.1\|914347_915154_+	TlyA family RNA methyltransferase	NA	NA	NA	NA
WP_011675823.1\|915150_915597_+	transcriptional regulator	NA	NA	NA	NA
WP_021165633.1\|915776_917444_+	DNA repair protein RecN	NA	NA	NA	NA
WP_015082274.1\|918137_918704_+	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_011835491.1\|918798_919320_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_031286508.1\|919341_920268_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_032940916.1\|920511_921453_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_011675830.1\|921608_921989_+	cell division protein FtsL	NA	NA	NA	NA
WP_021214282.1\|921985_924283_+	penicillin-binding protein	NA	NA	NA	NA
WP_011835486.1\|924357_925347_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_011675833.1\|925545_925830_+	hypothetical protein	NA	NA	NA	NA
WP_021165638.1\|925980_927498_+	ABC transporter permease	NA	NA	NA	NA
WP_011675836.1\|928627_929515_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_064305180.1\|929773_930664_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_116368847.1\|930787_931898_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4

DBSCAN-SWA_4

941497 : 992819

Streptococcus_phage(33.33%)

integrase,transposase

attL 966783:966800|attR 987281:987298

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064305089.1\|941497_942388_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_031286550.1\|942522_944358_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_003131392.1\|944546_944879_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_021165730.1\|945013_945988_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	7.3e-30	28.4
WP_021165731.1\|946612_946855_+	hypothetical protein	NA	NA	NA	NA
WP_116368849.1\|946906_948018_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	6.1e-49	41.1
WP_021037023.1\|949320_949950_+	hypothetical protein	NA	NA	NA	NA
WP_014572828.1\|949946_950945_+	sensor histidine kinase	NA	NA	NA	NA
WP_021165122.1\|950972_951602_+	response regulator transcription factor	NA	NA	NA	NA
WP_081146229.1\|951668_952478_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_014572825.1\|952577_953168_+	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	3.2e-28	45.5
WP_011675859.1\|953169_953601_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_021165123.1\|953597_954203_+	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	2.2e-29	36.9
WP_021165124.1\|954414_955659_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_021165125.1\|956990_957752_+	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_021165126.1\|958296_959847_+	ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	1.3e-25	23.6
WP_081146230.1\|960261_961884_+	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_011675866.1\|963359_964259_+	EamA family transporter	NA	NA	NA	NA
WP_021165129.1\|964381_965146_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-26	28.4
WP_021165130.1\|965126_966707_+	hypothetical protein	NA	NA	NA	NA
966783:966800	attL	NA	NA	NA	NA
WP_021165133.1\|967792_968440_+	HAD family hydrolase	NA	NA	NA	NA
WP_011675870.1\|968593_970549_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.7e-142	44.7
WP_011675871.1\|970647_970833_+	hypothetical protein	NA	NA	NA	NA
WP_021165134.1\|971056_971794_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.2e-80	58.3
WP_021165135.1\|971966_972608_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_015082299.1\|972765_973230_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_021165138.1\|974766_975486_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_081146231.1\|975764_976655_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165141.1\|976818_977727_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_015082326.1\|982166_983057_+\|transposase	IS982-like element IS982B family transposase	NA	NA	NA	NA
WP_021165148.1\|984151_985306_-\|integrase	site-specific integrase	Q8SBN2	Clostridium_phage	3.3e-29	29.1
WP_021165149.1\|985302_985536_-	DUF3173 family protein	NA	NA	NA	NA
WP_064305143.1\|985586_986621_-	hypothetical protein	NA	NA	NA	NA
WP_050574191.1\|986844_987060_-	hypothetical protein	NA	NA	NA	NA
WP_021165152.1\|987307_987496_-	hypothetical protein	NA	NA	NA	NA
987281:987298	attR	NA	NA	NA	NA
WP_021165153.1\|987492_988266_-	hypothetical protein	NA	NA	NA	NA
WP_021165154.1\|988255_988822_-	hypothetical protein	NA	NA	NA	NA
WP_021165155.1\|988996_989479_+	hypothetical protein	NA	NA	NA	NA
WP_021165156.1\|989581_990448_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021165157.1\|990549_990942_+	hypothetical protein	NA	NA	NA	NA
WP_153950482.1\|990952_991105_+	hypothetical protein	NA	NA	NA	NA
WP_021165159.1\|991108_991486_+	hypothetical protein	NA	NA	NA	NA
WP_021165160.1\|991499_991721_+	hypothetical protein	NA	NA	NA	NA
WP_064305093.1\|991928_992819_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1049536 : 1063286

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011675982.1\|1049536_1050229_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.6e-31	34.8
WP_021165191.1\|1050221_1051157_+	ABC transporter permease	NA	NA	NA	NA
WP_011675984.1\|1051266_1052244_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	6.0e-117	65.7
WP_064305099.1\|1052648_1054817_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.6e-256	60.6
WP_011675986.1\|1054953_1055376_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.7e-12	36.4
WP_021165193.1\|1055377_1055596_-	redoxin NrdH	C3U2K9	Lactococcus_phage	4.4e-12	49.2
WP_011675988.1\|1055769_1056411_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_021165194.1\|1056689_1058624_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.1e-125	43.4
WP_021165197.1\|1059259_1060093_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	5.3e-21	40.0
WP_014572756.1\|1060089_1060539_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_031301152.1\|1060811_1063286_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	6.0e-97	31.9

DBSCAN-SWA_6

1196109 : 1248284

Lactococcus_phage(27.27%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011676268.1\|1196109_1196619_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_011835213.1\|1197050_1197557_+	dihydrofolate reductase	A0A1L7N103	Ralstonia_phage	2.2e-09	29.8
WP_011676271.1\|1197805_1199041_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	58.6
WP_011676272.1\|1199037_1199625_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_011676273.1\|1199678_1200029_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_011676274.1\|1200108_1201158_+	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	8.7e-37	45.1
WP_021165285.1\|1201154_1202228_+	dihydropteroate synthase	NA	NA	NA	NA
WP_014572580.1\|1202230_1202731_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_021165286.1\|1202746_1204030_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_162494586.1\|1204155_1204797_+	deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	7.9e-49	47.7
WP_021165288.1\|1204977_1206264_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_011676280.1\|1206268_1207159_+	homoserine kinase	NA	NA	NA	NA
WP_162494582.1\|1207342_1208011_+	niacin ECF transporter S component NiaX	NA	NA	NA	NA
WP_021165290.1\|1208053_1208953_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_021165291.1\|1209412_1210693_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.1e-32	38.9
WP_021165292.1\|1210689_1211478_+	ABC transporter permease	NA	NA	NA	NA
WP_021165293.1\|1211479_1212280_+	ABC transporter permease	NA	NA	NA	NA
WP_021165294.1\|1212327_1213395_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011676287.1\|1213704_1214604_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_021165301.1\|1216095_1217277_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_088793343.1\|1218178_1219290_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_021037230.1\|1220055_1220301_+	hypothetical protein	NA	NA	NA	NA
WP_014572649.1\|1224573_1225278_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_021165388.1\|1225415_1226237_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_031286440.1\|1226299_1227670_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	1.1e-140	55.7
WP_021165386.1\|1227714_1229322_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_101913726.1\|1229323_1230037_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011676167.1\|1230008_1231181_+	AI-2E family transporter	NA	NA	NA	NA
WP_021165385.1\|1231208_1232465_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_021165384.1\|1232619_1234284_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_021165383.1\|1234390_1235536_-	MFS transporter	NA	NA	NA	NA
WP_014572641.1\|1235643_1236042_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081146249.1\|1236358_1237249_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165379.1\|1238366_1240370_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.2e-80	39.6
WP_021165378.1\|1240688_1241180_+	tryptophan-rich sensory protein	NA	NA	NA	NA
WP_081146251.1\|1241454_1242135_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	82.7
WP_064305175.1\|1242649_1243540_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_116368857.1\|1243564_1245271_+	DegV family EDD domain-containing protein	NA	NA	NA	NA
WP_011676155.1\|1245267_1246059_+	DUF1295 domain-containing protein	NA	NA	NA	NA
WP_003331414.1\|1246290_1247049_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_003331415.1\|1247060_1248284_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	4.9e-233	100.0

DBSCAN-SWA_7

1278831 : 1423601

113

Bacillus_phage(36.36%)

tRNA,lysis,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021165348.1\|1278831_1280178_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_014572599.1\|1280227_1281298_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_021165347.1\|1281924_1282632_-	hypothetical protein	NA	NA	NA	NA
WP_014572597.1\|1282810_1282957_-	hypothetical protein	NA	NA	NA	NA
WP_061777907.1\|1284210_1285128_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_011676292.1\|1285803_1286136_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011676291.1\|1286298_1287366_-	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	1.2e-54	41.5
WP_088793343.1\|1287768_1288879_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_021214324.1\|1289296_1290154_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_011676180.1\|1290143_1292417_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_014572659.1\|1292576_1293230_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_021165342.1\|1293322_1296055_-	magnesium-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	8.6e-44	23.3
WP_021165341.1\|1296529_1297816_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_011676184.1\|1297805_1298045_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_021165340.1\|1298080_1299304_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	2.4e-22	30.8
WP_064305173.1\|1299303_1300803_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9L3I8	Tupanvirus	3.1e-40	30.0
WP_021212171.1\|1300827_1300959_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_015082476.1\|1301141_1301798_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_021165339.1\|1302604_1303357_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
WP_081146255.1\|1303987_1304878_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165334.1\|1305357_1307454_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.2e-63	31.4
WP_064305172.1\|1308220_1308901_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.4e-106	81.4
WP_081146257.1\|1309174_1310065_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676191.1\|1311376_1312213_-	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_031286423.1\|1312209_1313769_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_031286422.1\|1313774_1314152_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011676194.1\|1314601_1314967_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_011676195.1\|1315036_1315552_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_011676196.1\|1315805_1316231_-	hypothetical protein	NA	NA	NA	NA
WP_011676197.1\|1316478_1316667_-	hypothetical protein	NA	NA	NA	NA
WP_011676198.1\|1316680_1317439_-	helix-turn-helix transcriptional regulator	R9TNM0	Vibrio_phage	3.7e-05	26.6
WP_021165329.1\|1317557_1319342_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.0e-45	29.2
WP_021165328.1\|1319325_1321143_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.1e-44	27.4
WP_021165327.1\|1321280_1322531_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_014572677.1\|1322544_1323135_-	hypothetical protein	NA	NA	NA	NA
WP_011835093.1\|1324086_1324707_-	ECF transporter S component	NA	NA	NA	NA
WP_011676202.1\|1325056_1325776_-	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_021165324.1\|1325762_1326329_-	segregation/condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	2.8e-13	32.5
WP_021165323.1\|1326321_1327050_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.4e-08	35.5
WP_014572682.1\|1327080_1327797_-	site-specific tyrosine recombinase XerD	NA	NA	NA	NA
WP_011676206.1\|1327774_1328236_-	CBS domain-containing protein	NA	NA	NA	NA
WP_011676207.1\|1328266_1328770_-	metallophosphoesterase	NA	NA	NA	NA
WP_014572683.1\|1328808_1329414_-	nucleoside-triphosphate diphosphatase	NA	NA	NA	NA
WP_011676209.1\|1329414_1330230_-	glutamate racemase	NA	NA	NA	NA
WP_003130191.1\|1330405_1330645_-	YneF family protein	NA	NA	NA	NA
WP_021165322.1\|1330795_1332055_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_014572686.1\|1332169_1333609_-	glutamate synthase subunit beta	NA	NA	NA	NA
WP_021214332.1\|1333608_1338078_-	glutamate synthase large subunit	NA	NA	NA	NA
WP_021165321.1\|1338246_1338858_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_011676214.1\|1338890_1339913_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_021165320.1\|1340073_1340829_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_021165319.1\|1342313_1343825_-	glutamate:gamma-aminobutyrate antiporter	NA	NA	NA	NA
WP_014572692.1\|1343867_1344758_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_011675659.1\|1345235_1346126_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_031286419.1\|1346359_1347136_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	5.6e-25	41.9
WP_021165316.1\|1347248_1348097_-	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_116368862.1\|1348466_1349578_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.4e-48	40.7
WP_021165399.1\|1349598_1350099_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021165400.1\|1350197_1351310_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_064305170.1\|1351404_1352295_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011835073.1\|1352661_1353423_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_021165403.1\|1353415_1354801_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_064305169.1\|1354869_1356597_-	metallophosphoesterase	NA	NA	NA	NA
WP_021165404.1\|1358826_1359453_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_011676233.1\|1359468_1360602_-	endoglucanase	NA	NA	NA	NA
WP_011676308.1\|1360603_1361458_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_081146255.1\|1364589_1365480_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021165412.1\|1365681_1366629_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_021165413.1\|1366628_1367468_-	metal ABC transporter permease	NA	NA	NA	NA
WP_011676313.1\|1367474_1368188_-	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.5e-16	29.9
WP_011676314.1\|1368477_1368891_+	glyoxalase	NA	NA	NA	NA
WP_021165414.1\|1368969_1369200_-	DUF4176 domain-containing protein	NA	NA	NA	NA
WP_021165415.1\|1369451_1372592_-	SMC family ATPase	NA	NA	NA	NA
WP_021165416.1\|1372594_1373767_-	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_021165417.1\|1373912_1374851_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_011676319.1\|1375048_1375423_-	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_116368864.1\|1376259_1377370_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	2.8e-49	41.4
WP_011676322.1\|1380794_1381238_-	hypothetical protein	NA	NA	NA	NA
WP_021165422.1\|1381542_1383165_+	fibronectin/fibrinogen-binding protein	Q84500	Paramecium_bursaria_Chlorella_virus	7.2e-06	32.1
WP_021165423.1\|1383206_1384022_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_014572714.1\|1384203_1385724_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.8e-20	32.5
WP_014572715.1\|1385716_1386811_+	ABC transporter permease	NA	NA	NA	NA
WP_021165425.1\|1386807_1387761_+	ABC transporter permease	NA	NA	NA	NA
WP_162494587.1\|1387876_1388857_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_021165427.1\|1388971_1390480_-	pyruvate kinase	NA	NA	NA	NA
WP_021165428.1\|1390567_1391590_-	6-phosphofructokinase	NA	NA	NA	NA
WP_021165429.1\|1391977_1393126_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_011676330.1\|1393296_1394475_-	toxic anion resistance protein	A0A291I9K4	Lactobacillus_phage	1.5e-37	28.8
WP_021165430.1\|1394616_1395243_-\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis protein	NA	NA	NA	NA
WP_011835022.1\|1395432_1396461_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_064305168.1\|1396502_1397444_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-78	52.2
WP_011676334.1\|1397514_1397922_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_011676335.1\|1397918_1398449_+	heptaprenyl diphosphate synthase subunit I	NA	NA	NA	NA
WP_021165432.1\|1398439_1399399_+	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_014572720.1\|1399395_1400112_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_021165433.1\|1400120_1400579_-	hypothetical protein	NA	NA	NA	NA
WP_011676339.1\|1400580_1401294_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_064305167.1\|1401423_1402359_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_014572723.1\|1402589_1403378_-	dihydroorotate dehydrogenase electron transfer subunit	NA	NA	NA	NA
WP_064305166.1\|1403627_1404992_-	MFS transporter	NA	NA	NA	NA
WP_021165435.1\|1405188_1405905_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_116368866.1\|1406656_1407767_+\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	4.2e-50	41.8
WP_021165438.1\|1408638_1409379_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011676346.1\|1409379_1409925_-	hypothetical protein	NA	NA	NA	NA
WP_021165439.1\|1409921_1410758_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_021165440.1\|1410757_1411711_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_021165442.1\|1413180_1414110_-	hypothetical protein	NA	NA	NA	NA
WP_064305165.1\|1415313_1416525_+	virion core protein	NA	NA	NA	NA
WP_021165446.1\|1416738_1417890_+	ATP/GTP-binding protein	NA	NA	NA	NA
WP_011676353.1\|1417886_1418672_+	hypothetical protein	NA	NA	NA	NA
WP_011676354.1\|1418706_1419240_-	rRNA large subunit pseudouridine synthase E	NA	NA	NA	NA
WP_014572735.1\|1419539_1421057_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_116368868.1\|1422489_1423601_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	4.7e-49	41.1

DBSCAN-SWA_8

1545844 : 1627456

Lactococcus_phage(61.29%)

integrase,tRNA,bacteriocin,transposase

attL 1588512:1588530|attR 1636425:1636443

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021165518.1\|1545844_1546882_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_015082639.1\|1546953_1547556_+	hypothetical protein	NA	NA	NA	NA
WP_011834866.1\|1547802_1549116_-	GTPase ObgE	NA	NA	NA	NA
WP_021165519.1\|1549265_1550432_-	cell division protein FtsQ/DivIB	NA	NA	NA	NA
WP_011676626.1\|1550432_1551506_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_021165520.1\|1551748_1553098_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_011676628.1\|1553266_1553608_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_015082643.1\|1553692_1554934_-	ammonium transporter	NA	NA	NA	NA
WP_063283897.1\|1555119_1556592_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.1e-27	33.2
WP_011676631.1\|1556604_1557297_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	34.1
WP_011834860.1\|1557453_1557984_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_011676633.1\|1558116_1558362_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_021165524.1\|1560288_1561125_-	metallophosphoesterase	NA	NA	NA	NA
WP_021165525.1\|1561236_1561641_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	9.7e-29	47.4
WP_021165526.1\|1562386_1562689_-	MazG-like protein	NA	NA	NA	NA
WP_116368862.1\|1563244_1564356_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.4e-48	40.7
WP_021165529.1\|1564542_1565193_+	hypothetical protein	NA	NA	NA	NA
WP_021165530.1\|1565300_1566071_+	hypothetical protein	Q38326	Lactococcus_phage	4.2e-65	74.4
WP_095559415.1\|1566257_1567404_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
WP_011676639.1\|1568969_1570043_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.5e-60	35.1
WP_011676640.1\|1570130_1571063_-	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-23	30.5
WP_153927095.1\|1571121_1571265_-	hypothetical protein	NA	NA	NA	NA
WP_021165532.1\|1571311_1572604_-	uracil-xanthine permease	Q9KX94	Enterobacteria_phage	5.8e-59	37.0
WP_011676642.1\|1572703_1573225_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_021165533.1\|1573500_1574199_-	M50 family metallopeptidase	NA	NA	NA	NA
WP_011676644.1\|1574303_1574603_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021165534.1\|1574592_1575510_+	cation transporter	NA	NA	NA	NA
WP_021165535.1\|1575747_1576989_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.4e-109	53.3
WP_031286486.1\|1577099_1577906_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.1e-39	41.2
WP_116368877.1\|1578077_1579523_-	DUF438 domain-containing protein	NA	NA	NA	NA
WP_015082654.1\|1579519_1579762_-	DUF1858 domain-containing protein	NA	NA	NA	NA
WP_015082655.1\|1579877_1580204_-	AzlD domain-containing protein	NA	NA	NA	NA
WP_021165538.1\|1580190_1580895_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_021165539.1\|1581746_1582289_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011676655.1\|1582322_1583879_-	signal recognition particle protein	NA	NA	NA	NA
WP_021165540.1\|1583957_1586684_-	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_011834838.1\|1586732_1588445_-	ribonuclease J	NA	NA	NA	NA
1588512:1588530	attL	NA	NA	NA	NA
WP_021165542.1\|1588794_1589466_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	4.3e-21	45.0
WP_011676659.1\|1589505_1590399_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_011676660.1\|1590727_1591183_-	NUDIX domain-containing protein	D0R7J3	Paenibacillus_phage	1.0e-26	38.9
WP_021165543.1\|1591192_1592269_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_015082666.1\|1593575_1593827_-	hypothetical protein	NA	NA	NA	NA
WP_021165544.1\|1593994_1595971_-	transketolase	NA	NA	NA	NA
WP_021165545.1\|1596138_1597539_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_021165546.1\|1597591_1597891_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_032950333.1\|1597892_1599833_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_011676669.1\|1600007_1600649_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_081146266.1\|1603969_1605496_-	MFS transporter	NA	NA	NA	NA
WP_021165547.1\|1605681_1606758_-	mannonate dehydratase	NA	NA	NA	NA
WP_011676494.1\|1608932_1609613_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_021165548.1\|1609677_1611108_-	MFS transporter	NA	NA	NA	NA
WP_011834820.1\|1611466_1611772_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_021165549.1\|1611776_1612001_-\|bacteriocin	garvicin Q family class II bacteriocin	NA	NA	NA	NA
WP_081146268.1\|1612225_1613116_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_011676499.1\|1613097_1613298_-	hypothetical protein	NA	NA	NA	NA
WP_064305201.1\|1614525_1615815_-	LysM peptidoglycan-binding domain-containing protein	A0A1P8BLG2	Lactococcus_phage	5.1e-241	97.7
WP_064305106.1\|1616073_1617297_+\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
WP_003331414.1\|1617308_1618067_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_021165554.1\|1618370_1618790_-	hypothetical protein	A0A1P8BKW0	Lactococcus_phage	6.0e-74	100.0
WP_021165556.1\|1618952_1619843_-	ATP-binding protein	R9QM21	Lactococcus_phage	3.0e-163	99.3
WP_021165557.1\|1619852_1620659_-	replication protein	A0A1P8BL25	Lactococcus_phage	1.7e-56	97.2
WP_021214223.1\|1620786_1621212_-	single-stranded DNA-binding protein	Q9AZV6	Lactococcus_phage	1.5e-72	97.2
WP_064305202.1\|1621204_1621963_-	hypothetical protein	Q0ILF6	Lactococcus_phage	1.7e-143	96.8
WP_064305203.1\|1621971_1622370_-	hypothetical protein	A0A1X9IGE4	Lactococcus_phage	9.8e-42	64.9
WP_021165561.1\|1622467_1622704_-	DUF1408 domain-containing protein	A5GYQ9	Lactococcus_phage	1.8e-38	97.4
WP_011834777.1\|1622806_1623085_+	hypothetical protein	A0A059NT68	Lactococcus_phage	1.1e-47	100.0
WP_011834776.1\|1623039_1623273_-	hypothetical protein	A0A059NT46	Lactococcus_phage	1.8e-35	100.0
WP_011834775.1\|1623426_1623663_-	helix-turn-helix domain-containing protein	A0A059NT59	Lactococcus_phage	4.3e-37	100.0
WP_021165562.1\|1623675_1624401_-	antirepressor	A0A1P8BKW5	Lactococcus_phage	1.5e-133	100.0
WP_021165563.1\|1624414_1624654_-	helix-turn-helix transcriptional regulator	A0A1P8BKU7	Lactococcus_phage	9.1e-35	94.9
WP_021165564.1\|1624994_1625198_-	putative transcriptional regulator	A0A1B1IMU6	Lactococcus_phage	4.0e-23	93.1
WP_021165565.1\|1625460_1626273_+	helix-turn-helix domain-containing protein	A0A1B1IMP5	Lactococcus_phage	3.0e-106	72.2
WP_021165566.1\|1626322_1627456_+\|integrase	site-specific integrase	A0A059NT56	Lactococcus_phage	1.6e-201	98.4
1636425:1636443	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1856075 : 1969714

113

Lactococcus_phage(44.68%)

transposase,protease,integrase,bacteriocin,terminase,head,tRNA,capsid,portal

attL 1911095:1911121|attR 1936343:1936369

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011676874.1\|1856075_1858874_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.9e-83	26.1
WP_021165703.1\|1859323_1860259_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_011676876.1\|1860315_1861107_-	RNA-binding protein	NA	NA	NA	NA
WP_011676877.1\|1861103_1861379_-	YggT family protein	NA	NA	NA	NA
WP_021165704.1\|1861378_1861969_-	cell division protein SepF	NA	NA	NA	NA
WP_021165705.1\|1862002_1862680_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_021213780.1\|1862683_1863937_-	cell division protein FtsZ	NA	NA	NA	NA
WP_011835775.1\|1863966_1865337_-	cell division protein FtsA	NA	NA	NA	NA
WP_021165708.1\|1865499_1866369_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	8.5e-14	34.6
WP_021165709.1\|1866485_1867214_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	A0A2D1A6G0	Rhodococcus_phage	4.6e-05	27.7
WP_081146280.1\|1867406_1868297_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_014572095.1\|1868373_1869486_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_021165712.1\|1869623_1870469_-	aldo/keto reductase	A0A1V0SDE7	Indivirus	6.8e-32	33.3
WP_021165713.1\|1870480_1871806_-	MFS transporter	NA	NA	NA	NA
WP_031286544.1\|1873297_1874608_-	aminopeptidase C	R4TV59	Phaeocystis_globosa_virus	6.3e-61	31.3
WP_011676890.1\|1874736_1875411_-	HD domain-containing protein	NA	NA	NA	NA
WP_014572089.1\|1875428_1875932_-	hypothetical protein	NA	NA	NA	NA
WP_011676892.1\|1876068_1876749_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_021165715.1\|1876776_1877055_-	hypothetical protein	NA	NA	NA	NA
WP_011835788.1\|1877047_1877632_-	NUDIX hydrolase	NA	NA	NA	NA
WP_021165716.1\|1877733_1879110_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	5.5e-31	35.7
WP_021165717.1\|1879327_1880119_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	2.4e-31	33.2
WP_010906184.1\|1880202_1880472_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_064305221.1\|1880642_1882520_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SDC3	Indivirus	5.7e-23	32.4
WP_011676898.1\|1882519_1883296_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_021165718.1\|1883418_1884693_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_031286545.1\|1885208_1886147_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	7.9e-82	50.6
WP_064305170.1\|1887131_1888022_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_015081734.1\|1890254_1891085_-	AAC(3) family N-acetyltransferase	O64018	Bacillus_phage	6.2e-46	39.8
WP_064305222.1\|1891257_1891485_+	hypothetical protein	NA	NA	NA	NA
WP_064305223.1\|1891583_1892264_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-110	85.0
WP_021166223.1\|1892260_1893298_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
WP_021166069.1\|1893969_1894914_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_010890681.1\|1894939_1895320_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_003331414.1\|1895718_1896477_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_064305106.1\|1896488_1897712_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
WP_010890679.1\|1897961_1898228_-	hypothetical protein	NA	NA	NA	NA
WP_015081778.1\|1898241_1899039_-	AAA family ATPase	E2ELL2	Clostridium_phage	1.8e-18	38.3
WP_015081779.1\|1899182_1899740_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	2.9e-31	43.1
WP_031286701.1\|1899946_1900297_-	hypothetical protein	A0A182BQ76	Lactococcus_phage	3.0e-10	73.2
WP_015081780.1\|1900286_1901753_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	6.5e-123	51.3
WP_015081781.1\|1902001_1902637_+	hypothetical protein	NA	NA	NA	NA
WP_021166190.1\|1902741_1904583_+	hypothetical protein	NA	NA	NA	NA
WP_015081783.1\|1904851_1905100_+	hypothetical protein	NA	NA	NA	NA
WP_041931940.1\|1905515_1907663_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	3.5e-40	27.1
WP_081146283.1\|1907677_1909102_+	HlyD family secretion protein	NA	NA	NA	NA
WP_015081786.1\|1909175_1909403_+\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_064305224.1\|1909417_1909714_+	lactococcin-A immunity protein	NA	NA	NA	NA
WP_015081788.1\|1909988_1910195_+\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_032488552.1\|1910221_1910497_+	lactococcin-B immunity protein	NA	NA	NA	NA
1911095:1911121	attL	NA	NA	NA	NA
WP_021166195.1\|1911277_1911442_+\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_015081789.1\|1911644_1912097_+	hypothetical protein	NA	NA	NA	NA
WP_021166196.1\|1912135_1912792_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_021166197.1\|1912891_1913173_-	hypothetical protein	NA	NA	NA	NA
WP_021166198.1\|1913174_1913402_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_064305225.1\|1913754_1915074_+\|transposase	IS4-like element IS1675 family transposase	NA	NA	NA	NA
WP_021166199.1\|1915331_1915433_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_021211273.1\|1915581_1915806_-	hypothetical protein	NA	NA	NA	NA
WP_021166201.1\|1915892_1916786_-\|transposase	IS982-like element ISLgar3 family transposase	NA	NA	NA	NA
WP_021166203.1\|1917286_1918462_-\|transposase	IS256-like element IS905 family transposase	A0A0N9STL0	Staphylococcus_phage	1.4e-32	32.3
WP_015081792.1\|1919190_1919655_-	hypothetical protein	NA	NA	NA	NA
WP_015081793.1\|1919673_1919907_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_015081794.1\|1919932_1920142_-\|bacteriocin	lactococcin family bacteriocin	NA	NA	NA	NA
WP_015081785.1\|1920215_1921640_-	HlyD family secretion protein	NA	NA	NA	NA
WP_015081795.1\|1924219_1925398_-	protein kinase family protein	A0A2K9L5D2	Tupanvirus	4.4e-13	29.5
WP_015081796.1\|1925488_1926046_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	1.1e-33	45.1
WP_047685904.1\|1926215_1926452_-	hypothetical protein	NA	NA	NA	NA
WP_015081749.1\|1926441_1929501_-	hypothetical protein	NA	NA	NA	NA
WP_015081750.1\|1929518_1929989_-	hypothetical protein	NA	NA	NA	NA
WP_015081751.1\|1930152_1930743_+	CHAP domain-containing protein	NA	NA	NA	NA
WP_161486482.1\|1930955_1931912_-	Abi family protein	NA	NA	NA	NA
WP_021166207.1\|1932361_1933042_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.3e-114	88.5
WP_015081754.1\|1933287_1933590_-	hypothetical protein	NA	NA	NA	NA
WP_021721729.1\|1934315_1934699_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1X9I6C6	Streptococcus_phage	2.7e-52	56.1
WP_015081755.1\|1934980_1935679_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015081756.1\|1936046_1936328_+	hypothetical protein	NA	NA	NA	NA
WP_021166211.1\|1936868_1937699_-	hypothetical protein	NA	NA	NA	NA
1936343:1936369	attR	NA	NA	NA	NA
WP_021166213.1\|1939821_1940709_-	WYL domain-containing transcriptional regulator	NA	NA	NA	NA
WP_010891372.1\|1940807_1941488_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.1e-112	85.4
WP_021213928.1\|1941608_1942676_-	hypothetical protein	NA	NA	NA	NA
WP_010890684.1\|1942678_1942888_-	hypothetical protein	NA	NA	NA	NA
WP_081146285.1\|1942890_1943778_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.3e-62	47.2
WP_064305107.1\|1943870_1944629_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
WP_064305106.1\|1944640_1945864_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
WP_081146287.1\|1945926_1947237_-	DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.8e-52	54.7
WP_081146288.1\|1947252_1948089_-	protein TrsL	NA	NA	NA	NA
WP_010890665.1\|1948103_1948499_-	hypothetical protein	NA	NA	NA	NA
WP_021166218.1\|1948513_1950106_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_010890634.1\|1950102_1950561_-	hypothetical protein	NA	NA	NA	NA
WP_116368900.1\|1950557_1950887_-	thioredoxin	NA	NA	NA	NA
WP_021166220.1\|1950915_1951533_-	hypothetical protein	NA	NA	NA	NA
WP_010890632.1\|1951545_1952703_-	CHAP domain-containing protein	A0A0A0RSI6	Bacillus_phage	1.7e-22	31.2
WP_021213922.1\|1952704_1952998_-	hypothetical protein	NA	NA	NA	NA
WP_064305223.1\|1953058_1953739_+\|transposase	IS6-like element ISS1S family transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-110	85.0
WP_081146292.1\|1953984_1956183_-	tape measure protein	Q9AZL5	Lactococcus_phage	1.3e-289	91.2
WP_021166226.1\|1956164_1956335_-	hypothetical protein	NA	NA	NA	NA
WP_021166227.1\|1956352_1956697_-	hypothetical protein	Q9AZL6	Lactococcus_phage	1.6e-27	98.2
WP_063283916.1\|1956756_1957362_-	hypothetical protein	Q9AZL7	Lactococcus_phage	1.4e-103	95.0
WP_010905383.1\|1957363_1957759_-	DUF806 family protein	Q9AZL8	Lactococcus_phage	1.4e-67	100.0
WP_031286725.1\|1957755_1958241_-	HK97 gp10 family phage protein	Q9AZL9	Lactococcus_phage	1.8e-82	97.5
WP_081146293.1\|1958237_1958573_-\|head	phage head closure protein	Q9AZM0	Lactococcus_phage	1.5e-51	93.7
WP_021166230.1\|1958559_1958865_-	hypothetical protein	Q9AZM1	Lactococcus_phage	2.9e-49	97.0
WP_021166231.1\|1958875_1960189_-\|capsid	phage major capsid protein	Q9AZM2	Lactococcus_phage	6.1e-189	92.0
WP_021166232.1\|1960178_1960766_-\|head,protease	HK97 family phage prohead protease	Q9AZM3	Lactococcus_phage	8.4e-106	98.5
WP_021166233.1\|1960765_1961845_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	6.5e-197	98.9
WP_021166234.1\|1962014_1963826_-\|terminase	terminase large subunit	Q9AZM6	Lactococcus_phage	0.0e+00	98.3
WP_014573149.1\|1963825_1964278_-\|terminase	phage terminase small subunit P27 family	Q9AZM7	Lactococcus_phage	6.5e-82	99.3
WP_021166235.1\|1964393_1964897_-	HNH endonuclease	Q9AZM8	Lactococcus_phage	5.9e-92	98.8
WP_014573151.1\|1965130_1965553_-	DUF722 domain-containing protein	Q9AYX5	Lactococcus_phage	5.5e-75	100.0
WP_088793343.1\|1965632_1966744_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
WP_021165101.1\|1966823_1967159_+	hypothetical protein	NA	NA	NA	NA
WP_003331414.1\|1967720_1968479_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_064305106.1\|1968490_1969714_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	5.4e-232	99.8

DBSCAN-SWA_10

2070305 : 2136231

Lactococcus_phage(65.52%)

transposase,protease,integrase,head,tRNA

attL 2107974:2107991|attR 2136452:2136469

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021165062.1\|2070305_2070626_-	sigma-70 family RNA polymerase sigma factor	Q9AZD9	Lactococcus_phage	8.7e-49	94.3
WP_021165061.1\|2070726_2071056_-	hypothetical protein	Q9AZE0	Lactococcus_phage	2.3e-52	98.2
WP_021165060.1\|2071269_2071860_-\|head,protease	HK97 family phage prohead protease	Q9AZE1	Lactococcus_phage	1.9e-105	97.4
WP_021165059.1\|2071868_2072477_-	hypothetical protein	Q9AZE2	Lactococcus_phage	1.3e-77	79.7
WP_021165058.1\|2072502_2072685_-	hypothetical protein	Q9AZE3	Lactococcus_phage	1.4e-22	91.4
WP_021165057.1\|2072891_2074526_-	DNA primase	Q9AZI5	Lactococcus_phage	5.8e-298	92.6
WP_021165056.1\|2074536_2075331_-	hypothetical protein	Q9AZI6	Lactococcus_phage	2.3e-143	90.5
WP_021165055.1\|2075327_2075663_-	HTH domain-containing protein	Q9AZI7	Lactococcus_phage	1.7e-50	89.8
WP_021165054.1\|2075659_2075974_-	hypothetical protein	NA	NA	NA	NA
WP_021165053.1\|2075970_2076225_-	hypothetical protein	Q9AZE9	Lactococcus_phage	1.3e-34	86.7
WP_021165052.1\|2076221_2076461_-	hypothetical protein	Q9AZJ0	Lactococcus_phage	1.0e-38	97.5
WP_021165051.1\|2076503_2076785_-	hypothetical protein	Q9AZJ1	Lactococcus_phage	3.0e-45	93.5
WP_021165050.1\|2076777_2077302_-	hypothetical protein	Q9AZJ3	Lactococcus_phage	1.5e-69	77.2
WP_021165049.1\|2077298_2077496_-	DUF1655 domain-containing protein	Q9AZF2	Lactococcus_phage	1.4e-25	95.1
WP_021165048.1\|2077510_2077732_-	hypothetical protein	NA	NA	NA	NA
WP_021165047.1\|2077920_2078094_-	hypothetical protein	NA	NA	NA	NA
WP_021165046.1\|2078356_2079046_-	Rha family transcriptional regulator	R9QNB1	Lactococcus_phage	1.3e-89	78.7
WP_021165045.1\|2079151_2079367_-	hypothetical protein	A5GZ66	Lactococcus_phage	4.8e-11	47.0
WP_021165044.1\|2079491_2079968_+	helix-turn-helix transcriptional regulator	A5GZ65	Lactococcus_phage	8.8e-13	58.2
WP_031286289.1\|2080092_2080350_+	hypothetical protein	NA	NA	NA	NA
WP_021165042.1\|2080619_2081132_+	hypothetical protein	A3QSC6	Clostridium_virus	8.0e-20	33.6
WP_021165040.1\|2082400_2083549_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	2.0e-26	28.7
WP_021165039.1\|2083945_2085127_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	1.2e-90	45.7
WP_021165038.1\|2085339_2085966_+	hypothetical protein	NA	NA	NA	NA
WP_021165037.1\|2085998_2087018_-	ABC transporter permease	NA	NA	NA	NA
WP_011677068.1\|2087010_2087781_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.9e-29	32.8
WP_011677070.1\|2089871_2090270_+	HIT family protein	NA	NA	NA	NA
WP_011677071.1\|2090284_2090506_+	hypothetical protein	NA	NA	NA	NA
WP_021165036.1\|2090517_2090862_-	hypothetical protein	NA	NA	NA	NA
WP_011677073.1\|2090939_2091629_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_011677074.1\|2092015_2092441_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_021165035.1\|2092576_2093341_-	ABC transporter permease	NA	NA	NA	NA
WP_021165034.1\|2093340_2094219_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.5e-05	26.4
WP_021165033.1\|2094529_2095051_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_064305150.1\|2095225_2096083_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_011677080.1\|2096127_2096586_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011677081.1\|2096670_2097228_-	ribosome recycling factor	NA	NA	NA	NA
WP_004254608.1\|2097383_2098100_-	UMP kinase	NA	NA	NA	NA
WP_064305149.1\|2098184_2098637_-	hypothetical protein	NA	NA	NA	NA
WP_014573258.1\|2098766_2099954_-	acetate kinase	NA	NA	NA	NA
WP_011677084.1\|2100112_2101300_-	acetate kinase	NA	NA	NA	NA
WP_021165031.1\|2101491_2102430_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011677086.1\|2102517_2102769_-	hypothetical protein	NA	NA	NA	NA
WP_031286284.1\|2102869_2104702_-	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	9.2e-18	35.4
WP_081146303.1\|2105218_2106331_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.3e-48	40.7
WP_064305146.1\|2107080_2107971_+\|transposase	IS982 family transposase	NA	NA	NA	NA
2107974:2107991	attL	NA	NA	NA	NA
WP_021165027.1\|2108031_2108490_-	hypothetical protein	NA	NA	NA	NA
WP_014573264.1\|2108504_2109119_-	hypothetical protein	NA	NA	NA	NA
WP_031286281.1\|2109458_2110187_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_011677095.1\|2110379_2110601_+	YqgQ family protein	NA	NA	NA	NA
WP_021165026.1\|2110634_2111606_+	ROK family glucokinase	NA	NA	NA	NA
WP_011677097.1\|2111608_2111995_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_011677098.1\|2112110_2112557_-	DNA starvation/stationary phase protection protein	A0A2K9VCK5	Lactobacillus_phage	2.5e-17	33.6
WP_014573269.1\|2112722_2113388_+	prepilin peptidase	NA	NA	NA	NA
WP_021165025.1\|2113338_2114433_-	DNA polymerase IV	NA	NA	NA	NA
WP_011677102.1\|2114508_2115000_-\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
WP_011677103.1\|2115075_2116569_-	amino acid permease	NA	NA	NA	NA
WP_021165024.1\|2116758_2117889_-	aminotransferase	NA	NA	NA	NA
WP_021037905.1\|2118152_2119097_-	carbamate kinase	NA	NA	NA	NA
WP_021165021.1\|2121798_2122863_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_011677109.1\|2124562_2126257_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	7.8e-80	34.2
WP_004254487.1\|2126324_2126783_+	arginine repressor	NA	NA	NA	NA
WP_021165020.1\|2126942_2128274_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_021165019.1\|2128474_2129074_-	hypothetical protein	NA	NA	NA	NA
WP_011677113.1\|2129290_2132395_-	DEAD/DEAH box helicase family protein	A0A2L1IWL4	Gordonia_phage	2.4e-42	30.1
WP_021165018.1\|2132591_2133212_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_081146305.1\|2133294_2133975_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	83.6
WP_003331414.1\|2134237_2134996_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
WP_003331415.1\|2135007_2136231_-\|transposase	IS21-like element IS712 family transposase	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
2136452:2136469	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016729

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP015909

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection