CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP015902	Lactococcus lactis subsp. lactis strain UC06 chromosome, complete genome	3 crisprs	cas3,DEDDh,csa3,DinG	1	10
NZ_CP016735	Lactococcus lactis subsp. lactis strain UC06 plasmid pUC06B, complete sequence	0 crisprs	NA	0	0
NZ_CP016734	Lactococcus lactis subsp. lactis strain UC06 plasmid pUC06A, complete sequence	0 crisprs	RT	0	0
NZ_CP016736	Lactococcus lactis subsp. lactis strain UC06 plasmid pUC06C, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015902_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015902_1

1284658-1284770

Orphan

Consensus_repeat	Method
TGCGATTGAATAGTGAGCATTTTAGTTGTAGATAAAAGAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015902_1

>merge|NZ_CP015902|1|1284658-1284770|CRISPRCasFinder
TGCGATTGAATAGTGAGCATTTTAGTTGTAGATAAAAGAACCGTCAGCGCAGCTGACAGTTCTGTCAGTAATTGCGATTGAATAGTGAGCATTTTAGTTGTAAATAAAAGAAC

>NZ_CP015902|1|1|1284658-1284770|CRISPRCasFinder
TGCGATTGAATAGTGAGCATTTTAGTTGTAGATAAAAGAAC	CGTCAGCGCAGCTGACAGTTCTGTCAGTAAT
TGCGATTGAATAGTGAGCATTTTAGTTGTAAATAAAAGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015902.1\|WP_012897809.1\|1277123_1277732_+\|imidazole-glycerol-phosphate-synthase-subunit-HisH	unknown	unknown	gnl\|CDD\|237288
NZ_CP015902.1\|WP_058220784.1\|1287765_1289478_+\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|234861
NZ_CP015902.1\|WP_017864485.1\|1279217_1279856_+\|bifunctional-phosphoribosyl-AMP-cyclohydrolase/phosphoribosyl-ATP-diphosphatase	unknown	unknown	gnl\|CDD\|235067
NZ_CP015902.1\|WP_039115453.1\|1284873_1286256_+\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|235490
NZ_CP015902.1\|WP_081213510.1\|1280679_1281639_-\|rhodanese-domain-containing-protein	unknown	unknown	gnl\|CDD\|234663
NZ_CP015902.1\|WP_081213511.1\|1283617_1284655_+\|3-isopropylmalate-dehydrogenase	unknown	unknown	gnl\|CDD\|234832
NZ_CP015902.1\|WP_015426406.1\|1291730_1292753_+\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NZ_CP015902.1\|WP_081213508.1\|1278441_1279221_+\|imidazole-glycerol-phosphate-synthase-subunit-HisF	unknown	unknown	gnl\|CDD\|234996
NZ_CP015902.1\|WP_058220787.1\|1294174_1294885_+\|alpha-acetolactate-decarboxylase	unknown	unknown	gnl\|CDD\|273524
NZ_CP015902.1\|WP_003131129.1\|1286275_1286851_+\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP015902.1\|WP_003131115.1\|1276296_1277085_+\|aminoglycoside-3'-phosphotransferase	unknown	unknown	gnl\|CDD\|225771
NZ_CP015902.1\|WP_081213512.1\|1286864_1287644_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224044
NZ_CP015902.1\|WP_010905839.1\|1291208_1291685_+\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NZ_CP015902.1\|WP_017864483.1\|1277732_1278452_+\|1-(5-phosphoribosyl)-5-[(5--phosphoribosylamino)methylideneamino]imidazole-4--carboxamide-isomerase	unknown	unknown	gnl\|CDD\|179108
NZ_CP015902.1\|WP_003131113.1\|1275697_1276300_+\|imidazoleglycerol-phosphate-dehydratase	unknown	unknown	gnl\|CDD\|153419
NZ_CP015902.1\|WP_003131142.1\|1294925_1295306_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|129116
NZ_CP015902.1\|WP_081213509.1\|1279856_1280666_+\|PHP-domain-containing-protein	unknown	unknown	gnl\|CDD\|273837
NZ_CP015902.1\|WP_017864488.1\|1282064_1283606_+\|2-isopropylmalate-synthase	unknown	unknown	gnl\|CDD\|234864
NZ_CP015902.1\|WP_017864495.1\|1292808_1294059_+\|threonine-dehydratase	unknown	unknown	gnl\|CDD\|236318
NZ_CP015902.1\|WP_058220785.1\|1289488_1291216_+\|acetolactate-synthase,-large-subunit,-biosynthetic-type	unknown	unknown	gnl\|CDD\|180919

Protein	Function_ID	Function_description	E-value
NZ_CP015902.1\|WP_012897809.1\|1277123_1277732_+\|imidazole-glycerol-phosphate-synthase-subunit-HisH	gnl\|CDD\|237288	PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional.	8.82359e-112
NZ_CP015902.1\|WP_058220784.1\|1287765_1289478_+\|dihydroxy-acid-dehydratase	gnl\|CDD\|234861	PRK00911, PRK00911, dihydroxy-acid dehydratase; Provisional.	0
NZ_CP015902.1\|WP_017864485.1\|1279217_1279856_+\|bifunctional-phosphoribosyl-AMP-cyclohydrolase/phosphoribosyl-ATP-diphosphatase	gnl\|CDD\|235067	PRK02759, PRK02759, bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE.	8.8479e-121
NZ_CP015902.1\|WP_039115453.1\|1284873_1286256_+\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|235490	PRK05478, PRK05478, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP015902.1\|WP_081213510.1\|1280679_1281639_-\|rhodanese-domain-containing-protein	gnl\|CDD\|234663	PRK00142, PRK00142, rhodanese-related sulfurtransferase.	0
NZ_CP015902.1\|WP_081213511.1\|1283617_1284655_+\|3-isopropylmalate-dehydrogenase	gnl\|CDD\|234832	PRK00772, PRK00772, 3-isopropylmalate dehydrogenase; Provisional.	0
NZ_CP015902.1\|WP_015426406.1\|1291730_1292753_+\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
NZ_CP015902.1\|WP_081213508.1\|1278441_1279221_+\|imidazole-glycerol-phosphate-synthase-subunit-HisF	gnl\|CDD\|234996	PRK02083, PRK02083, imidazole glycerol phosphate synthase subunit HisF; Provisional.	1.00499e-158
NZ_CP015902.1\|WP_058220787.1\|1294174_1294885_+\|alpha-acetolactate-decarboxylase	gnl\|CDD\|273524	TIGR01252, Alpha-acetolactate_decarboxylase, alpha-acetolactate decarboxylase. Puruvate can be fermented to 2,3-butanediol. It is first converted to alpha-acetolactate by alpha-acetolactate synthase, then decarboxylated to acetoin by this enzyme. Acetoin can be reduced in some species to 2,3-butanediol by acetoin reductase. [Energy metabolism, Fermentation].	1.80675e-124
NZ_CP015902.1\|WP_003131129.1\|1286275_1286851_+\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	3.92442e-121
NZ_CP015902.1\|WP_003131115.1\|1276296_1277085_+\|aminoglycoside-3'-phosphotransferase	gnl\|CDD\|225771	COG3231, Aph, Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis].	9.9534e-131
NZ_CP015902.1\|WP_081213512.1\|1286864_1287644_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224044	COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism].	2.76937e-106
NZ_CP015902.1\|WP_010905839.1\|1291208_1291685_+\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	1.42954e-62
NZ_CP015902.1\|WP_017864483.1\|1277732_1278452_+\|1-(5-phosphoribosyl)-5-[(5--phosphoribosylamino)methylideneamino]imidazole-4--carboxamide-isomerase	gnl\|CDD\|179108	PRK00748, PRK00748, 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated.	8.69175e-120
NZ_CP015902.1\|WP_003131113.1\|1275697_1276300_+\|imidazoleglycerol-phosphate-dehydratase	gnl\|CDD\|153419	cd07914, IGPD, Imidazoleglycerol-phosphate dehydratase. Imidazoleglycerol-phosphate dehydratase (IGPD; EC 4.2.1.19) catalyzes the dehydration of imidazole glycerol phosphate to imidazole acetol phosphate, the sixth step of histidine biosynthesis in plants and microorganisms where the histidine is synthesized de novo. There is an internal repeat in the protein domain that is related by pseudo-dyad symmetry, perhaps as a result of an ancient gene duplication. The apo-form of IGPD exists as a catalytically inactive trimer which, in the presence of specific divalent metal cations such as manganese (Mn2+), cobalt (Co2+), cadmium (Cd2+), nickel (Ni2+), iron (Fe2+) and zinc (Zn2+), assembles to form a biologically active high molecular weight metalloenzyme; a 24-mer with 4-3-2 symmetry. Each 24-mer has 24 active sites, and contains around 1.5 metal ions per monomer, each monomer contributing residues to three separate active sites. IGPD enzymes are monofunctional in fungi, plants, archaea and some eubacteria while they are encoded as bifunctional enzymes in other eubacteria, such that the enzyme is fused to histidinol-phosphate phosphatase, the penultimate enzyme of the histidine biosynthesis pathway. The histidine biosynthesis pathway is a potential target for development of herbicides, and IGPD is a target for the triazole phosphonate herbicides.	1.36861e-115
NZ_CP015902.1\|WP_003131142.1\|1294925_1295306_+\|RidA-family-protein	gnl\|CDD\|129116	TIGR00004, RutC_family_protein, reactive intermediate/imine deaminase. This protein was described initially as an inhibitor of protein synthesis intiation, then as an endoribonuclease active on single-stranded mRNA, endoribonuclease L-PSP. Members of this family, conserved in all domains of life and often with several members per bacterial genome, appear to catalyze a reaction that minimizes toxic by-products from reactions catalyzed by pyridoxal phosphate-dependent enzymes. [Cellular processes, Other].	7.37961e-66
NZ_CP015902.1\|WP_081213509.1\|1279856_1280666_+\|PHP-domain-containing-protein	gnl\|CDD\|273837	TIGR01856, Probable_histidinol-phosphatase, histidinol phosphate phosphatase, HisJ family. This model represents the histidinol phosphate phosphatase HisJ of Bacillus subtilis, and related proteins from a number of species within a larger family of phosphatases in the PHP hydrolase family. HisJ catalyzes the penultimate step of histidine biosynthesis but shows no homology to the functionally equivalent sequence in E. coli, a domain of the bifunctional HisB protein. Note, however, that many species have two members and that Clostridium perfringens, predicted not to make histidine, has five members of this family; this family is designated subfamily rather than equivalog to indicate that members may not all act as HisJ.	5.18896e-99
NZ_CP015902.1\|WP_017864488.1\|1282064_1283606_+\|2-isopropylmalate-synthase	gnl\|CDD\|234864	PRK00915, PRK00915, 2-isopropylmalate synthase; Validated.	0
NZ_CP015902.1\|WP_017864495.1\|1292808_1294059_+\|threonine-dehydratase	gnl\|CDD\|236318	PRK08639, PRK08639, threonine dehydratase; Validated.	0
NZ_CP015902.1\|WP_058220785.1\|1289488_1291216_+\|acetolactate-synthase,-large-subunit,-biosynthetic-type	gnl\|CDD\|180919	PRK07282, PRK07282, acetolactate synthase large subunit.	0

>NZ_CP015902.1|WP_081213511.1|1283617_1284655_+|3-isopropylmalate-dehydrogenase
MSKKIVTLAGDGIGPEIMSAGLSVLKAVSKKIAFEYELEAKDFGGIAIDKHGHPLPEETLQAVKNADAILLAAIGHPKYNNAKVRPEQGLLDLRKELGLYANVRPLKIYPALKKLSPIRNVENVDFLVIRELTGGIYFGQHELADDKARDVNDYSADEIRRILHFAFKSAQSRPRKLVTSVDKQNVLATSKLWRKMADEIADEYPDVRLEHQLVDSCAMLLITNPQQFDVIVTENLFGDILSDEASSLAGSLGVMPSSSHGFNGLALYEPIHGSAPDIAGKGIANPVSMILSIAMMLRESFGQEEGAAMIEKAVTQTFTDGILTKDLGGTATTKEMTEAILKNCQ
>NZ_CP015902.1|WP_017864488.1|1282064_1283606_+|2-isopropylmalate-synthase
MRKIEFFDTSLRDGEQTPGVSFSISEKVTIAKQLEKWGISVIEAGFPAASPDSFEAVKQIADSLNDTAVTALARCVISDIDKAVEAVKGAKYPQIHVFIATSPIHMKYKLKISPEEVLKNIDKCVKYARERVEVVEFSPEDATRTELNFLLEAVQTAVDAGATYINIPDTVGYTTPEEYGKIFKFLIDNTKSEREIIFSPHCHDDLGMAVANSLAAIKAGAGRVEGTVNGIGERAGNAALEEIAVALHIRKDFYQAQSPLKLSETAATAELISQFSGIAIPKNKAIVGANAFAHESGIHQDGVLKNAETYEIITPELVGIKHNSLPLGKLSGRHAFSEKLTELNIAYDDESLAILFEKFKKLADKKKEITDADIHALFTGETVKNLAGFILDNVQIDGHKALVQLKNQEEEIYVSQGEGSGSVDAIFKAIDKVFNHQLKLISYSVDAVTDGIDAQATTLVSVENLSTGTIFNAKGVDYDVLKGSAIAYMNANVLVQKENLQGKVEQISAHDGI
>NZ_CP015902.1|WP_081213510.1|1280679_1281639_-|rhodanese-domain-containing-protein
MTQDYRVLLYYQYVPIEDGETFAQKHLADCKELGLKGRILVADEGINGTVSGTIEQANAYMELMKNDPRFSSTIFKIDEAEQNAFKKMHVRYRPELVNLSLEDDVNPLELTGAYLDPKEFREAMLDENTVVIDARNDYEFDLGHFRGAIRPEIRSFRELPQWIRDNKEQFMEKRVLTYCTGGIRCEKFSGWLVREGFKDVGQLHGGIATYGKDPEVQGDLWDGQMYVFDSRIAVPINQKEHVIVGRDWFDGSPCERYINCGNPECNRQMLASEENEAKYLGACSHECRVHPNNRYIKAHQLSNQEVQERLALLEKDLAS
>NZ_CP015902.1|WP_081213509.1|1279856_1280666_+|PHP-domain-containing-protein
MKKLDYHFHSHFSADSEELPRKQVTEAIAHGLEEICFTEHRDFYFPGMDFSLNLLEYFQEINQLQAEFKDKIKIKIGLEMGIDLRFKSEINQFIDSASFDFVIASVHEIGDIEVYDGTEFYLQKTKEEAQREYLLACLDVVQNFETYNSFGHLDYVARYGPYTDKSIKFAENREILFEILRALASKEKALEINTRLFDDPKTEQFYSDLLINFKKFGGKFITLGTDSHIAKRDWLSIHKARTLIKKAGFHELATFSGMKIDKNKKSIKE
>NZ_CP015902.1|WP_017864485.1|1279217_1279856_+|bifunctional-phosphoribosyl-AMP-cyclohydrolase/phosphoribosyl-ATP-diphosphatase
MRPDFHKQELIPVVVQDYQTNQVLMLAYTNEVAFEKMLETGETWFWSRSRQKLWHKGEESGHFQKIKGMRLDCDQDTLLVFVEQIGNACHTGTYSCFYDEIIPFDDSDIFSELEKQIIDRKLHPVEKSYTNYLLGEGIDKVLKKVGEEASEVIIASKNSDKGELLGEIDDLLYHLFVLMNQQGISLEEVRQKAKERHQLEGNKKEFHTRTAD
>NZ_CP015902.1|WP_081213508.1|1278441_1279221_+|imidazole-glycerol-phosphate-synthase-subunit-HisF
MLTKRIIPCLDIKNGKVVKGINFVGLREIGDPVELAKIYEEQCADEIVFLDITASFEEREIIGELIGRAARELSIPLTVGGGIRSIDDFRRILARGADKVSVNSAAIENPELIRQAANEFGIQCVVVAIDAKKRADHRGYDVYIKGGREIAGLDLVDWAKKCERLGAGEILLTSMDKDGTKTGYDLEMLNTVCTAVNIPVVASGGCGKISDIVEVFQNTRSDAALVASLFHYGEATVDEVKDELIKNNIPARIIKKETL
>NZ_CP015902.1|WP_017864483.1|1277732_1278452_+|1-(5-phosphoribosyl)-5-[(5--phosphoribosylamino)methylideneamino]imidazole-4--carboxamide-isomerase
MKIIPAIDLQNGEAVRLYKGDYDKKTVYSKNPLEIAQKFERMGATDLHLVDLDGAKIGQTRNLELVRKIKDETRLKIEIGGGIRDFDTVRMYLEQIGVERVILGTAAVEKPDFLKELLIKYGPSRIVVGVDIREGFVSTSGWLEKTSLPYLSFLKKLERIGVKTTIITDISKDGTLTGPNFKLYDEISKESSLNVIISGGVKDNSDIQRATRSDFYGIIVGKAYYEGKINLEKEFRNAN
>NZ_CP015902.1|WP_012897809.1|1277123_1277732_+|imidazole-glycerol-phosphate-synthase-subunit-HisH
MKKIVIIDYNIGNLQSVQAAFLRLGQETVISRDLEEIRKADALILPGVGAFPTAMNNLKKFNLIELIQERAAAGIPILGICLGMQVLFEKGYEIEERQGLGLLKGEVIPIKTNEKIPHMGWNQLNLAKTSPTTHYLSGNDEVYFVHSYQATCPDDELIAYTTYGEVKIPAIVGKNNVIGCQFHPEKSGEIGRKILKAFLEEI
>NZ_CP015902.1|WP_003131115.1|1276296_1277085_+|aminoglycoside-3'-phosphotransferase
MTNLKELRINIEKFPEALHNTLKDAKIYDSSSSPEAQVLFIDKKDGYYLKIASSKTLEREAEMTAYFQKKKLGLGYISYLSDQSQDFLLKKKIQGENYLAKQYLNNPKRLCDNLAENLRFLHEQNFEDCPILDHSERYLKKVEKNASINNSNLDFVNNYNIRTTEEAYDYIENKKLLLRNDTLLHGDYCLPNIILDNWKFKGFIDLDCAGVGDRHIDLFWGAWTLNFNIGTDQYRDRFFDAYGRDRIDVDRLKLVGCCEVFG
>NZ_CP015902.1|WP_003131113.1|1275697_1276300_+|imidazoleglycerol-phosphate-dehydratase
MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEALGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL
>NZ_CP015902.1|WP_039115453.1|1284873_1286256_+|3-isopropylmalate-dehydratase-large-subunit
MSGKTIFDKLWDQHVIAGNEGEPQLLYIDLHVIHEVTSPQAFQGLREAGRRVRRKDLTYGTLDHNVPTQDIFNIQDLISKKQIDTFTKNVKEFDVPAETHGGKGQGIVHMVAPESGRTQPGKTIVCGDSHTATNGAFGAIAFGIGTSEVEHVLATQTIWQVKPKRMKIEFQGHPQKGIYSKDFILALIAKYGVDAGVGYAVEYSGDTISDLSMEERMTICNMSIEFGAKIGLMNPDEKTYDYVKGREHEPKNFDEAVSKWEKLVSDSDAQYDKILSLDVSQLKPMVTWGTNPGMGLEFGEKFPEINNDLNYERAYQYMDLKPGQTASDIDLGYIFIGSCTNARLGDLEEAAKIIGDRHIADGLTGIVVPGSRPVKEAAEAQGLDKIFKEAGFEWREPGCSACLGMNPDQIPEYVHCASTSNRNFEGRQGHNARTHLCSPAMAAAAAIAGKFVDVRTLVTD
>NZ_CP015902.1|WP_003131129.1|1286275_1286851_+|3-isopropylmalate-dehydratase-small-subunit
MEKFTIYKGTSVPVMNDNIDTDQIIPKQFLKAIDKKGFGKNLFYEWRYLKDYDENPDFILNAPKYKKASLLISGDNFGSGSSREHAAWALSDYGFRAIIAGSYSDIFYNNALKNGLLPIKQPREVLNQLTKLSSQEEITIDLPHQLIITSLGDFHFEIDPIWKDKLINGLDDIGITLQYEEAISAYEQKNQ
>NZ_CP015902.1|WP_081213512.1|1286864_1287644_+|ABC-transporter-ATP-binding-protein
MTIINLKNVNLTRNKKEILKDIIWKVNPGENWVILGLNGSGKSSLLKLILAEEWKTSGEITVLNTQFGNGEIPKLRKRISVVGSFIAERFQPNIKAENLVYTGKFNSSMLYKPYTDQELDEARQLLRQMGAKSLIGRNYASLSQGEKQVLLIARSLILKPELLILDEATNGLDLFAKEKLLKQLQQINQLKTAPTLIYISHHPDEITDIFTHLLLLREGKVVQSGKKENLLNEKILTDFYQEKVEVHRFEQKYFVIPAN
>NZ_CP015902.1|WP_058220784.1|1287765_1289478_+|dihydroxy-acid-dehydratase
MEFKYNGKVESVELNKYSKTLTQDPTQPATQAMYYGIGFKDEDFKKAQVGIVSMDWDGNPCNMHLGTLGSKIKSSVNQTDGLIGLQFHTIGVSDGIANGKLGMRYSLVSREVIADSIETNAGAEYYDAIVAIPGCDKNMPGSIIGMARLNRPSIMVYGGTIEHGEYKGEKLNIVSAFEALGQKITGNISDEDYHGVICNAIPGQGACGGMYTANTLAAAIETLGMSLPYSSSNSAVSQEKQEECDEIGSAIKNLLEKDIKPSDIMTKEAFENAITIVMVLGGSTNAVLHIIAMANAIGVEITQDDFQRISDITPVLGDFKPSGKYMMEDLHKIGGLPAVLKYLLKEGKLHGDCLTVTGKTLAENVETALDLDFDSQDIMRPLKNPIKATGHLQILYGNLAQGGSVAKISGKEGEFFKGTARVFDGEQHFIDGIESGRLHAGDVAVIRNIGPVGGPGMPEMLKPTSALIGAGLGKSCALITDGRFSGGTHGFVVGHIVPEAVEGGLIGLVEDDDIIEIDAVNNSISLKVSDEEIAKRRANYQKPTPKATRGVLAKFAKLTRPASEGCVTDL
>NZ_CP015902.1|WP_058220785.1|1289488_1291216_+|acetolactate-synthase,-large-subunit,-biosynthetic-type
MKKIKLEKPTSGSQLVLQTLKELGVEIIFGYPGGAMLPLYDAIHNFEGIQHILARHEQGATHEAEGYAKSSGKVGVVVVTSGPGATNAVTGIADAYLDSVPLLVFTGQVGRQSIGKDAFQEADTVGITAPITKYNYQIRETADIPRIVTEAYYLARTGRPGPVEIDLPKDVSTLDVTEINDPSLNLPHYHESEKATDEQLQELLTELSVSKKPVIIAGGGINYSGSVDIFRAFVEKYQIPVVSTLLGLGTLPISHELQLGMAGMHGSYAANMALVEADYIINLGSRFDDRVVSNPAKFAKNAVVAHIDIDAAELGKIVKTDIPILSDLKVALSRLLQLNNVKTDFNDWIKTVIENKEKAPFTYEPQNHDIRPQETIKLIGEYTQGDAIIVTDVGQHQMWVAQYYPYKNARQLITSAGMGTMGFGIPAAIGAKLAQPNKNVIVFVGDGGFQMTNQELALLNGYGIAIKVVLINNHSLGMVRQWQESFYEERRSQSVFDVEPNFQLLAEAYGIKHVKLDNPKTLADDLKIITEDEPMLIEVLISKSEHVLPMIPAGLHNDEMIGLHFTDENEEVDNA
>NZ_CP015902.1|WP_010905839.1|1291208_1291685_+|acetolactate-synthase-small-subunit
MRRMIIAKLHNVTGIMNRFTAVLNRRQVNILSITAGVTESQDLTHTTFVIEVDHLDEVEQIIKQLNRLIDVIEVADITDLPHVEREVVLIKVSAPPTIRAEIFTMIEPFRVNVVDVNLENVTIQLTGDSAKIEALIDVVSPYGILNMARTGSAGFERG
>NZ_CP015902.1|WP_015426406.1|1291730_1292753_+|ketol-acid-reductoisomerase
MAVTMYYEDDVEVSALAGKQIAVIGYGSQGHAHAQNLRDSGHNVIIGVRHGKSFDKAKEDGFETFEVGEAVAKADVIMVLAPDELQQSIYEEDIKPNLKAGSALGFAHGFNIHFGYIKVPEDVDVFMVAPKAPGHLVRRTYTEGFGTPALFVSHQNASGHAREIAMDWAKGIGCARVGIIETTFKEETEEDLFGEQAVLCGGLTALVEAGFETLTEAGYAGELAYFEVLHEMKLIVDLMYEGGFTKMRQSISNTAEFGDYVTGPRIITDEVKKNMKLVLADIQSGKFAQDFVDDFKAGRPKLTAYREAAKNLEIEKIGAELRQAMPFTQSGDDDAFKIYQ
>NZ_CP015902.1|WP_017864495.1|1292808_1294059_+|threonine-dehydratase
MISAKEVEDAYDLLKAVVTKTPLQLDPYLSNKYQANIYLKEENLQKVRSFKLRGAYYSISKLSDEQRSKGVVCASAGNHAQGVAFAANQLNISATIFMPVTTPNQKISQVKFFGESHVTIRLIGDTFDESARAAKAFSQDNDKPFIDPFDDENVIAGQGTVALEIFAQAKKQAISLDKIFVQIGGGGLIAGITAYSKERYPQTEIIGVEAKGATSMKAAYSAGQPVTLEHIDKFADGIAVATVGQKTYQLINDKVKQLLAVDEGLISQTILELYSKLGIVAEPAGATSVAALELIKDEIKGKNIVCIISGGNNDISRMQEIEERALVYEGLKHYFVINFPQRPGALRTFVSDILGPNDDITRFEYIKRADKGKGPCLVGILLSDASDYDSLIDRIERFDNRYVNLHGNDSLYELLV
>NZ_CP015902.1|WP_058220787.1|1294174_1294885_+|alpha-acetolactate-decarboxylase
MTEITQLFQYNTLGALMAGLYEGTMTIGELLKHGDLGIGTLDSIDGELIVLDGKAYQAKGDKTIVELTDDIKVPYAAVVPHQAEVVFKQKFTASDKELEDRIESYFDGQNLFRSIKITGEFPKMHVRMIPRAKSGTRFVEVSQNQPEYTEENVKGTIVGIWTPEMFHGVSVAGYHLHFISEDFTFGGHVLDFIIDNGTVEIGAIDQLNQSFPVQDRKFLFADLDIEALKKDIDVAE
>NZ_CP015902.1|WP_003131142.1|1294925_1295306_+|RidA-family-protein
MKIIATLDAPAAIGPYVQGKIVNGLLYASGQIPLNPLNGEIVGDSIETQTEQVMKNISAILKEAHSDFDLVIKTTCFLKNIEDFSRFNAIYSKFFDKEFPARSAVGVAGLPKNVLIEIEVIAEVKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015902_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015902_2

1753817-1753959

Orphan

Consensus_repeat	Method
ATATTTGAAGCATTTAAATTAAT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP015902_2

>merge|NZ_CP015902|2|1753817-1753959|CRISPRCasFinder
ATATTTGAAGCATTTAAATTAATAACATTTATCTTATTCCCATTTAAGGTTCCAGTTGATATATTTGAAGCATTTAGATTAATGATGTTGACATTTGCTGCATTAAGTGTACCTGTCGATAGTTTTGAAGCACTTAAATTGCC

>NZ_CP015902|2|2|1753817-1753959|CRISPRCasFinder
ATATTTGAAGCATTTAAATTAAT	AACATTTATCTTATTCCCATTTAAGGTTCCAGTTGAT
ATATTTGAAGCATTTAGATTAAT	GATGTTGACATTTGCTGCATTAAGTGTACCTGTCGAT
AGTTTTGAAGCACTTAAATTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015902.1\|WP_080668870.1\|1744600_1745032_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_021722205.1\|1761536_1761962_-\|major-tail-protein	unknown	unknown	gnl\|CDD\|370135
NZ_CP015902.1\|WP_023188700.1\|1745146_1745509_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131381
NZ_CP015902.1\|WP_021722206.1\|1761974_1762337_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213603.1\|1762868_1763222_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_032946647.1\|1762336_1762885_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213598.1\|1751691_1752042_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|143405
NZ_CP015902.1\|WP_014734984.1\|1760657_1761029_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_025017008.1\|1746758_1747595_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|224326
NZ_CP015902.1\|WP_081213602.1\|1755845_1760627_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|381605
NZ_CP015902.1\|WP_023188699.1\|1745734_1746646_-\|CHAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236304
NZ_CP015902.1\|WP_081213595.1\|1749478_1749691_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213594.1\|1748281_1749190_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
NZ_CP015902.1\|WP_081213597.1\|1751379_1751679_-\|phage-holin	unknown	unknown	gnl\|CDD\|377400
NZ_CP015902.1\|WP_081213599.1\|1752068_1752893_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213604.1\|1763202_1763535_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153447
NZ_CP015902.1\|WP_081213605.1\|1763554_1764673_-\|N4-gp56-family-major-capsid-protein	unknown	unknown	gnl\|CDD\|275180
NZ_CP015902.1\|WP_011676909.1\|1761052_1761463_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213601.1\|1755467_1755833_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213596.1\|1750600_1751380_-\|phage-holin	unknown	unknown	gnl\|CDD\|283125

Protein	Function_ID	Function_description	E-value
NZ_CP015902.1\|WP_081213602.1\|1755845_1760627_-\|phage-tail-protein	gnl\|CDD\|381605	cd13402, LT_TF-like, lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	4.2736e-37
NZ_CP015902.1\|WP_021722205.1\|1761536_1761962_-\|major-tail-protein	gnl\|CDD\|370135	pfam08813, Phage_tail_3, Phage tail tube protein, TTP. This is a family of phage tail tube proteins. A few members have an associated bacterial Ig-like domain, pfam02368, at their C-terminus.	1.43241e-05
NZ_CP015902.1\|WP_023188699.1\|1745734_1746646_-\|CHAP-domain-containing-protein	gnl\|CDD\|236304	PRK08581, PRK08581, amidase domain-containing protein.	3.08246e-34
NZ_CP015902.1\|WP_023188700.1\|1745146_1745509_-\|hypothetical-protein	gnl\|CDD\|131381	TIGR02328, TIGR02328, conserved hypothetical protein. Members of this protein are found in a small number of taxonomically well separated species, yet are strongly conserved, suggesting lateral gene transfer. Members are found in Treponema denticola, Clostridium acetobutylicum, and several of the Firmicutes. The function of this protein is unknown. [Hypothetical proteins, Conserved].	3.66015e-76
NZ_CP015902.1\|WP_081213594.1\|1748281_1749190_+\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	3.62309e-13
NZ_CP015902.1\|WP_081213597.1\|1751379_1751679_-\|phage-holin	gnl\|CDD\|377400	pfam04688, Holin_SPP1, SPP1 phage holin. This family constitutes holin proteins from the dsDNA Siphidoviridae group bacteriophages with two transmembrane segments. Most bacteriophages require an endolysin and a holin for host lysis. During late gene expression, holins accumulate and oligomerize in the host cell membrane. They then suddenly trigger to permeablise the membrane, which causes lysis by allowing endolysin to attach the peptidoglycan. There are thought to be at least 35 different families of holin genes.	2.12664e-29
NZ_CP015902.1\|WP_081213605.1\|1763554_1764673_-\|N4-gp56-family-major-capsid-protein	gnl\|CDD\|275180	TIGR04387, hypothetical_protein, major capsid protein, N4-gp56 family. Members of this family are phage major capsid proteins as found in phage N4 (a double-stranded DNA virus) plus many additional lytic phage and integrated prophage regions. [Mobile and extrachromosomal element functions, Prophage functions].	1.56882e-16
NZ_CP015902.1\|WP_081213598.1\|1751691_1752042_-\|hypothetical-protein	gnl\|CDD\|143405	cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins. ALDH subfamily which includes the NAD+-dependent, alpha-aminoadipic semialdehyde dehydrogenase (AASADH, EC=1.2.1.31), also known as Antiquitin-1, ALDH7A1, ALDH7B or delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH), and other similar sequences, such as the uncharacterized aldehyde dehydrogenase of Candidatus kuenenia AldH (locus CAJ73105).	0.00119987
NZ_CP015902.1\|WP_081213604.1\|1763202_1763535_-\|hypothetical-protein	gnl\|CDD\|153447	cd08055, gp15, Head-Tail Connector Protein gp15 of Bacteriophage SPP1 and similar proteins. The bacteriophage SPP1 gp15 protein is critical in the assembly of the connector, a specialized structure that serves as an interface for head and tail attachment, as well as a point at which DNA exits the head during infection by the bacteriophage. It forms a dodecameric ring structure that comprises the middle ring of the connector, located between the portal protein (attached to the head) and the gp16 ring (attached to the tail). Binding of the gp15 and gp16 rings to the portal protein is essential to prevent leakage of packaged DNA. gp15 is a component of the mature phage and its mutation results in defective head-tail joining.	6.99344e-30
NZ_CP015902.1\|WP_025017008.1\|1746758_1747595_-\|metallophosphoesterase	gnl\|CDD\|224326	COG1408, COG1408, Predicted phosphohydrolases [General function prediction only].	4.83579e-75
NZ_CP015902.1\|WP_081213596.1\|1750600_1751380_-\|phage-holin	gnl\|CDD\|283125	pfam05382, Amidase_5, Bacteriophage peptidoglycan hydrolase. At least one of the members of this family, the Pal protein from the pneumococcal bacteriophage Dp-1 has been shown to be a N-acetylmuramoyl-L-alanine amidase. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside at the N-terminal domain whereas the C-terminal domain binds to the choline residues of the cell wall teichoic acids. This family appears to be related to pfam00877.	2.36509e-75

>NZ_CP015902.1|WP_081213599.1|1752068_1752893_-|hypothetical-protein
MSYEKQTWNKYDDLKTEEENIENGAVVTDNRMNHIEEGIYSHTIDISNPHKVTAAQVGLDKVDNVKQASKVEFDSHTSDNSNPHKVTAAQIGLDKVDNIQQAAKTDFDSHVNNKANPHSVTASQVGTYTKQEIDTKLSKTVMTDDSGKVTIKDLVVTGTIQQTLSVNQSIAVGWGRTLNFTRIGNVVTVTAEGTFGTTMPQGAWQSAGETLPVGFRPLSRQTTRASAITNVNKFMWTRFNTDGSIQHWQNGSIAVTDTIIMNGTSWVTTDPFPT
>NZ_CP015902.1|WP_081213598.1|1751691_1752042_-|hypothetical-protein
MELEKIVEQHEDKLKQHDKELARLSDMSVEMQKQMSEGLARVDESNRFLREQNTRQSEQNAQILQAVIKGNESSDERQFQLKLLDKTNFWKLALGIGGSAAAIFAALTEIIKVIFK
>NZ_CP015902.1|WP_081213597.1|1751379_1751679_-|phage-holin
MKTIDRGTLTRTILLVLALANQLLTASGHSVIPIDDATVTNIISTGFTVATALASWWKNNDFTHAAKKGTELTKSLKNGDSVQVVKASDSDHEFTEGGE
>NZ_CP015902.1|WP_081213596.1|1750600_1751380_-|phage-holin
MSSIENMIAWMQARKGKVTYSMTSRMGPNSYDCSSSVFFSMIAGGFLSAGSMGNTETLFGMSGTKLKEISRGEVQRGDIFISGTPGGSAGSDGHTGIFLSNGSFIHCSYTHNGIAVDTNDAYMSTRLPHHFYRIVGSGSGNTDNKPQMVILNVDGKFGNATAKRLQEYFDTAGKDGVISHQYKQTFNQNIYAAQFDSSLIGSNVVKALQRFLGVGQDGLFGQGTIKALQKHLGTTQDGTISPVSDSVRELQRRLNANKL
>NZ_CP015902.1|WP_081213595.1|1749478_1749691_-|hypothetical-protein
MNLKQVLELIADGNIVALKFKDSDEIMVKDYKNSDIFDDFMNCKVIEVNTARVINEFEEEEIEITVELER
>NZ_CP015902.1|WP_081213594.1|1748281_1749190_+|hypothetical-protein
MKKSIIALSTCTLLTCILFTTLPSPSMADQLDTPSSDISAKAEQEWYGISTIEFFNMGLDSGIVEVTQGDIITGRATFGYYGGDSLTTQDIIVNSNLDYVVISNITIDNNSHTGTFDIMIDTSNISSGSQTFQLNVTDALPENDRHVTPYSITNMIQINEAPRPDPDPNPTPDPEPNPDPEPNPNPEPNPNPEPIPNPEPIPNPEPTPNPEPAPNPEPAPNPEPAPNPEPAPNPEPAPSINKNTLNISKDSIVLDNKITKVSEEGNIKTLPETGVNSKADLSFVLIGIIIISSAVTILYKNR
>NZ_CP015902.1|WP_025017008.1|1746758_1747595_-|metallophosphoesterase
MKIKKIVFSLIILIICTVIGVFYYAFKVEPYRLVVNEHQVNNTNSKENLKIVQLSDLHIKKDFNADRLDKVIQKTNEQNPDFIIFSGDLYDNYSQYNENEAVISKLKSLKAKYGKIAIWGNRDYGGGSVREYANIMAESDFSLLRNENQVFTLDNGKKILFTGLDEALLGNPQFPSPNQMAETSYDILLTHEPDEVSQYQNKGYELILSGHSHGGQINIPLIPQIQKKATALMSHANNYTGGLYQLGANEKLYVNTGIGTTHLSARFGVAPEIAVLTF
>NZ_CP015902.1|WP_023188699.1|1745734_1746646_-|CHAP-domain-containing-protein
MQGKKVFLLLGIITAVGAWNIANGTQVKASSKSPVYRLYNPNSGEHFYTTNFYEGNSLKNVGWRDEGIGWQAANSGEPVYRLYNPNVKGGDHYYTLSKYEAQTLVNLGWRWDNNANPVFYSAGTVNLYVSYNPNAQSGAHNYTTNVFEQNSLLSVGWKYGAIAWKTMPSDSLPGTPAGWTIDRPMNIDNYSTQTYAYKQCTWWVYNRAKEFGINYGQYMGNGKDWQNQAGYQVTSTPQLHSAVSFKAGQDGADATYGHVAFVEKIRSDGSILISQSGTGYSTLFSYQVLSKDQASRLRYVIGK
>NZ_CP015902.1|WP_023188700.1|1745146_1745509_-|hypothetical-protein
MRLWHEALIKKLPRQQLLGQHRECCALRGKGWEKPHSTVNYVFNYSPYKLFQYHLQVMTEMRKRGYHPDEKWLNPLYRGQTSKVYLELEEVIQTFPIYPEHNNDYLEDCKENLREKGIII
>NZ_CP015902.1|WP_080668870.1|1744600_1745032_-|hypothetical-protein
MSAIGTIAVVIVSLYLARRDYRKKLEVDYWISYKIFSGEKISLWSIDLVNIGSVPVKIYEVGLYQKSWLRKRRKKIIFMMPRDFEYESAKLPILLNPQEDATYFIAKNEWITKIKELGINQRKIGLYARDTTGKYYYRKFLLK
>NZ_CP015902.1|WP_081213601.1|1755467_1755833_-|hypothetical-protein
MSAELQFNGVTVKTPKEFSVSISTIDADSSGRNANGEMVRDVIAQKTKLDIKWGPLSDSEVSDILQRINQPFFVVIYPDPQIGRQRSKTFYAGDSTMPSYSWNDKFKAMKWENLSVNLIEK
>NZ_CP015902.1|WP_081213602.1|1755845_1760627_-|phage-tail-protein
MELETLEVLLDVNTARVQASLDKIMPNIESAMSKIQNITGKSMKKTEDNLNIDKGATQFGKQLEKMNQTFEKMMGHLESSSKKSSESIGDNLSTGFKKARPKVSKEIDAMLNEINAKMGQAKAAQEKVAYLKSQRQSSSAKGDGRQTVKYDDQIARAQASMLKYQDQAKSLARSMKTEFDAVPSSLERIAKVMDANEAKYYTMRESVRALQKEYQYQLKPVGSFDKGFKNVDTPDSLKTAQKMQAQSDKMQKLASSNDVLQKEYQRTEERAESLRKAIGRINSVLSQSSMATGTAAAGASMTGSGLKQSERAVSKYGGVFNRMSNSISHGAGGIGNGLKNSFGILDKFGNLFSRNSNKVTQGTRSMSMGNNAFLQSMKYLLPSLIVYQLIGGAISKLAGGMMSALKTNDQFSNSLNQIKVNLMTAFYPIYNAILPAINAMMSAIATLTGQLASFIAGLFGTTYQAAKQGASGLYDNVQAMNDTGSSATKAKDKVDKLQRSLMGFDEINRIGLQDKTDNDTDKGQDTKTPGIDFGAATGNYSTPKWMKDMQALLKDFFKPFQDAWKNQGQKVIDAWKYALGEVIGLAGAIGKSFMEVWTNGTGQKFIENLLILLADVLNIIGDIAKAFKDAWNEDGRGTALIQSLFDGLNRILELLHSIAKSFREAWNDGTGKEIAANLLEIFTNINNTVGNLAEQLKKAWEKGDTGKEIFSIILGIINDLLGHLNNMTKATADWAKTLDFSPLLKGIERLLKNLEPLTDNIGAGLEWLYKNVLLPLAKFTIEDVLPVFLDALAGALKVINGVIEVLKPLFTWFWEKFLQPLGKWVGKNIVDGLQNIADVLNILGDWLAKNKNFLQSAIKMGTDLIDGLLKGIGDSLKNIGAWLQENLVDPIVNGVKSLFGIHSPSTVFAEIGSFLIQGLLNGISSLIGGVSDLIGGIWGDIKKTISDKTQEILDTSKAIWGNISNAIGGAVDGAKKWVSDRWSDISKTTSDTWDNVKKWTSDKWNDAKKSISDTADSIGTKISTKWSEVKKGTSDAWDNVKNWTSSKWNDTKTAVHSAADSIGSKVSSKWNEIKSGTSTAWENVRSSVSNAANNAKDNASNAWSNMKDRMGGYANSIKSTAKSAFDSVASWASDMGKKIGSGLESGVNAVRRGAAAIGNGIAGVIGSAVNGVIDGINWVLGKVGSGNRLGHWSVPRYANGTEGHPGGPALVNDGSGSQWQEMYLTPDGKTGLFPKVRNLMVDLPKGTQVLSGTKTAKAMSGMPAYANGIGDWMGEKWNQAKEMVGDIWDYATHPEKILNIAISKFTNLSQAVEPALSIATGGISTIANGAMGMIEKAFSEGSESPSGTGVERWRPVIKKALSMNGVSTSENYVNAWLRQVQSESGGNEKAVQGGYTDVNTLSGDLAKGLLQTISATFNANKFPGHGNIFNGYDNALAAIHYAMGRYGDPGMLQVIGHGHGYAKGTPYVPEDQLAMIHEGEMVVPAKYNPYNSISDFKSFETLQLPEMFTDKPTDYSNSGSFGGGQDVSNYGLANMNGSLTSAIMLLVQSLGAQTSQTSNGDIVINIGGREFGRIAVSEINKYHQQLGYTELNI
>NZ_CP015902.1|WP_014734984.1|1760657_1761029_-|hypothetical-protein
MLEDLYPQAVEAGISSTDFWAMTFDEIMVQVEANKKRHENELKEKAMFDYSQQRLAIYAFNDPKNFPKYEDAYPFLNQLKEEVVQAVSEEEEKKQAMLTDQEIMRQNAMLIQETRKRKSQKTN
>NZ_CP015902.1|WP_011676909.1|1761052_1761463_-|hypothetical-protein
MTKATIVKMPNTKQFEFGGLNLQLRLDGNSILSIEKRLDESIVGLFLKGQGEAKIPATNKLLIVLQGANQTSNVSESDIVAAFGRYVDEGHSTLDLFAAINELLEESGFFGNKKTEKEATNGVSLDSEPVEEDSIL
>NZ_CP015902.1|WP_021722205.1|1761536_1761962_-|major-tail-protein
MTTVAGLLSKDTVLSYKDGATSKPVAAVKSIPAMGSDPEKVDVTHLGSAKKAYIAGIQDSDNLEFAIIYQGDNFKDVDTLVKAGKSVDWTVTYPDGMKVDFTGQPSYKFDGVEVNQALGFNLVVVVSAGPNFTPAPAGSGQ
>NZ_CP015902.1|WP_021722206.1|1761974_1762337_-|hypothetical-protein
MEKVNIKVATVSVLSGISEIKKVATDYPSTWNDFPTAIYRTVNTPHFVDGSGEELQTKWSITIELYSKSSLTTIVNNIIEQFGDIGFTGTQRDANTADLKRVIIELSAIVDNKTKYVYSK
>NZ_CP015902.1|WP_032946647.1|1762336_1762885_-|hypothetical-protein
MTLGVEIKGLDRLKRKINAMPKILNDAVNDATYEITELVRSAAELRLASSMKFSSGELLGSLKTEVVENAEGKIVGRVWSDKAQAIYREFGTGPNGQASSKDLPEGVNPVYTQTRWFIPAEEVGIDLNEIYGMPKITIQGKEFYITSGQPARPFLYPSLKEILPQMPEIYKEHVQKKLRELK
>NZ_CP015902.1|WP_081213603.1|1762868_1763222_-|hypothetical-protein
MRLMKRDLTTVYLKRIDPNNTQDEEGNDQVNYLAPIALEMNVQSASGAVNATIYGSKLSSMKSCKYQGDELKEGRDENSGICLYVDKDSEPDYKIKSIQHYSTHINVMLERNDDIGS
>NZ_CP015902.1|WP_081213604.1|1763202_1763535_-|hypothetical-protein
MEESEPKTKAIERLKTDLGIDDNKATGLIEDAVILVLDYTNQEKMLDSMWLYARQLATITFNRESTEGESSRSEGGISQSFVEDIPLNIQRGLNRYRLGKVVSFYAPDET
>NZ_CP015902.1|WP_081213605.1|1763554_1764673_-|N4-gp56-family-major-capsid-protein
MKNKQLKMNLQRFADGVTFLKTQVDPEVMGQMVAAQLPKAIKFAGIAPIDTTLAGQPGSTITLPKFKYSGDAKVVAEGESIEMDELTTTTQTATIKKVGKGVSITDEAALSGYGDPVGEAQRQIRMAIASAVDNEIVAVAGTAALTVISNVSLDLIDQLEDTFVEAPDALEEQGFTQGVLFVSYKDAATLRKAAGVNWTRASDLGDNILVSGAFGEVLGWTVVRSKKIKTGSPIAVKPGAMKTYLKRDVSVEADRDIKKKITEFTGDEHYVVAIVDDTKIVRVEAADIPVTGVTISQKTASMKVGTTRELKATVDPENATNKSVTYSSDAEAVATVNSDGKVTALTAGTANITVTTTDGSKTDKCVVTVTEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015902_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015902_3

1879522-1879616

Orphan

Consensus_repeat	Method
GATTTGCTGACAGTTCTGTCAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015902_3

>merge|NZ_CP015902|3|1879522-1879616|CRISPRCasFinder
GATTTGCTGACAGTTCTGTCAGTTCAACGCGACCAACGGAAGATGTTGAATCGGCAGATTGAGGAACTGACAGCTTTGCTGACAGTTCTGTCAGT

>NZ_CP015902|3|3|1879522-1879616|CRISPRCasFinder
GATTTGCTGACAGTTCTGTCAGT	TCAACGCGACCAACGGAAGATGTTGAATCGGCAGATTGAGGAACTGACA
GCTTTGCTGACAGTTCTGTCAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015902.1\|WP_058221012.1\|1875658_1876633_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP015902.1\|WP_015426871.1\|1889655_1890522_+\|maltose-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226354
NZ_CP015902.1\|WP_003130364.1\|1874812_1875490_-\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP015902.1\|WP_058208139.1\|1891453_1892485_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275056
NZ_CP015902.1\|WP_023189703.1\|1888267_1889650_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP015902.1\|WP_012898265.1\|1871079_1871346_-\|membrane-protein-insertion-efficiency-factor-YidD	unknown	unknown	gnl\|CDD\|223830
NZ_CP015902.1\|WP_058221011.1\|1873352_1874720_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP015902.1\|WP_058221029.1\|1890652_1891228_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP015902.1\|WP_025016952.1\|1892822_1893134_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213643.1\|1864852_1865686_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|273772
NZ_CP015902.1\|WP_058208140.1\|1892634_1892826_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015902.1\|WP_081213644.1\|1866559_1869265_-\|YhgE/Pip-domain-containing-protein	unknown	unknown	gnl\|CDD\|224428
NZ_CP015902.1\|WP_023189702.1\|1884842_1886597_-\|alpha-glycosidase	unknown	unknown	gnl\|CDD\|200477
NZ_CP015902.1\|WP_081213645.1\|1876785_1879041_-\|family-65-glycosyl-hydrolase	unknown	unknown	gnl\|CDD\|237517
NZ_CP015902.1\|WP_081040699.1\|1883010_1884636_-\|alpha-glucosidase	unknown	unknown	gnl\|CDD\|200472
NZ_CP015902.1\|WP_058221010.1\|1871462_1873205_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|237053
NZ_CP015902.1\|WP_017864852.1\|1869523_1870957_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|236580
NZ_CP015902.1\|WP_081040701.1\|1882378_1882990_-\|sugar-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP015902.1\|WP_058221015.1\|1880811_1882389_-\|alpha-amylase	unknown	unknown	gnl\|CDD\|200455
NZ_CP015902.1\|WP_081213806.1\|1865721_1866462_-\|demethylmenaquinone-methyltransferase	unknown	unknown	gnl\|CDD\|334435

Protein	Function_ID	Function_description	E-value
NZ_CP015902.1\|WP_058221012.1\|1875658_1876633_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	4.57044e-97
NZ_CP015902.1\|WP_015426871.1\|1889655_1890522_+\|maltose-ABC-transporter-permease	gnl\|CDD\|226354	COG3833, MalG, ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism].	8.20065e-99
NZ_CP015902.1\|WP_003130364.1\|1874812_1875490_-\|DNA-binding-response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	5.03478e-70
NZ_CP015902.1\|WP_058208139.1\|1891453_1892485_-\|hypothetical-protein	gnl\|CDD\|275056	TIGR04211, hypothetical_protein, SH3 domain protein. Members of this protein family have a signal peptide, a strongly conserved SH3 domain, a variable region, and then a C-terminal hydrophobic transmembrane alpha helix region.	0.00774849
NZ_CP015902.1\|WP_023189703.1\|1888267_1889650_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	3.39744e-59
NZ_CP015902.1\|WP_012898265.1\|1871079_1871346_-\|membrane-protein-insertion-efficiency-factor-YidD	gnl\|CDD\|223830	COG0759, COG0759, Uncharacterized conserved protein [Function unknown].	3.39011e-41
NZ_CP015902.1\|WP_058221011.1\|1873352_1874720_-\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	6.25796e-49
NZ_CP015902.1\|WP_058221029.1\|1890652_1891228_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	0.000632203
NZ_CP015902.1\|WP_081213643.1\|1864852_1865686_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|273772	TIGR01716, HTH-type_transcriptional_regulator_rgg, transcriptional activator, Rgg/GadR/MutR family, C-terminal domain. This model describes the whole, except for a 60 residue N-terminal helix-turn-helix DNA-binding domain (pfam01381) of the family of proteins related to the transcriptional regulator Rgg, also called RopB. Rgg is required for secretion of several proteins, including a cysteine proteinase associated with virulence. GadR is a positive regulator of a glutamate-dependent acid resistance mechanism. MutR is a transcriptional activator for mutacin biosynthesis genes in Streptococcus mutans. This family appears restricted to the low-GC Gram-positive bacteria, including at least eight members in Lactococcus lactis. [Regulatory functions, DNA interactions].	4.30254e-59
NZ_CP015902.1\|WP_081213644.1\|1866559_1869265_-\|YhgE/Pip-domain-containing-protein	gnl\|CDD\|224428	COG1511, COG1511, Predicted membrane protein [Function unknown].	0
NZ_CP015902.1\|WP_023189702.1\|1884842_1886597_-\|alpha-glycosidase	gnl\|CDD\|200477	cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP015902.1\|WP_081213645.1\|1876785_1879041_-\|family-65-glycosyl-hydrolase	gnl\|CDD\|237517	PRK13807, PRK13807, maltose phosphorylase; Provisional.	0
NZ_CP015902.1\|WP_081040699.1\|1883010_1884636_-\|alpha-glucosidase	gnl\|CDD\|200472	cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins. The sucrose isomerases (SIs) Isomaltulose synthase (EC 5.4.99.11) and Trehalose synthase (EC 5.4.99.16) catalyze the isomerization of sucrose and maltose to produce isomaltulose and trehalulose, respectively. Oligo-1,6-glucosidase (EC 3.2.1.10) hydrolyzes the alpha-1,6-glucosidic linkage of isomaltooligosaccharides, pannose, and dextran. Unlike alpha-1,4-glucosidases (EC 3.2.1.20), it fails to hydrolyze the alpha-1,4-glucosidic bonds of maltosaccharides. Dextran glucosidase (DGase, EC 3.2.1.70) hydrolyzes alpha-1,6-glucosidic linkages at the non-reducing end of panose, isomaltooligosaccharides and dextran to produce alpha-glucose.The common reaction chemistry of the alpha-amylase family enzymes is based on a two-step acid catalytic mechanism that requires two critical carboxylates: one acting as a general acid/base (Glu) and the other as a nucleophile (Asp). Both hydrolysis and transglycosylation proceed via the nucleophilic substitution reaction between the anomeric carbon, C1 and a nucleophile. Both enzymes contain the three catalytic residues (Asp, Glu and Asp) common to the alpha-amylase family as well as two histidine residues which are predicted to be critical to binding the glucose residue adjacent to the scissile bond in the substrates. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP015902.1\|WP_058221010.1\|1871462_1873205_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|237053	PRK12315, PRK12315, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP015902.1\|WP_017864852.1\|1869523_1870957_-\|6-phospho-beta-glucosidase	gnl\|CDD\|236580	PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed.	0
NZ_CP015902.1\|WP_081040701.1\|1882378_1882990_-\|sugar-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	3.11241e-90
NZ_CP015902.1\|WP_058221015.1\|1880811_1882389_-\|alpha-amylase	gnl\|CDD\|200455	cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes Chloroflexi, Dictyoglomi, and Fusobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP015902.1\|WP_081213806.1\|1865721_1866462_-\|demethylmenaquinone-methyltransferase	gnl\|CDD\|334435	pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family.	1.18473e-142

>NZ_CP015902.1|WP_081213645.1|1876785_1879041_-|family-65-glycosyl-hydrolase
MKQIKRIMGIDPWKITSNQIEKEDRRLQESLTSIGNGYMGMRGNFSETYSGDSHQGTYIAGVWFPDKTRVGWWKNGYPEYFGKAINALNFASVRVFIDDKEVDLAASHVTDFNLSLDMEKGVLTYTYVAYGVRVTAERFFSIAQQELAVFAFMFESLDGEIHQIRTASIIDANVRNEDSNYDEKFWTVKNLDNTATGSFIVTETIPNPFGVEQFTVAAKQSFAGDFTRVKQETRESSVLDVYEAKLIENAPLTFIKNVLVVTSRDIEPSNLTKVLSNLTLEISKKTYHEFYKEQEIAWKKRWEIADVQIDGSAEAQQGIRFNLFQLFSTYYGEDERLNIGPKGFTGEKYGGATYWDTEAYAVPLYLALSDEKVAKNLLKYRHNQLPQAQHNARQQGLKGALYPMVTFTGVECHNEWEITFEEIHRNGAMAYAIYNYSNYTGDETYLAHEGLEVLIEIARFWADRVHYSKRNDKYMIHGVTGPNEYENNINNNWYTNKLAAWVLTYTAESLAKYPRPDLIEGAEIAHWAEIVDKMYYPEDEELGIFVQHDGYLDKDLTPVAQLDPKNLPLNQNWSWDRVLRSPYIKQADVLQGIYFFGNQFSLAEKQRNFDFYEPLTVHESSLSPSIHAILAAELGMEDKAVEMYERTARLDLDNYNNDTEDGLHITSMTGSWLAIVHGFAEMKTWDGQLSFAPFLPQAWTGYAFHINYRGSLLKISVGQEVKLELLRGQSLNLEIYGEKIELKDFYVTKTK
>NZ_CP015902.1|WP_058221012.1|1875658_1876633_-|LacI-family-transcriptional-regulator
MAVTIKDVAKKAGVNASTVSRVIKDSSEISDKTKVKVRKAMHELGYRRNAAAQILASGKTNTIGVVFPPVADKASQPFFMKILTSINETARDYDVSIAIATGHSAKELKKQIELQYSEKRVDGFIVLYAGKNDEVRDYLLENKVPFVLVGTPAEGKNEITHVDNDNMLLGREAVRHLAQLNHQNISFVTDTKETEVFEERYQGFKDEAEKLGLNHDLLFMDANFSLRNETALVVMDDVLSLKVVERLRSQGLNVPEDVSLITYNNSIFGAMIHPYLTTFDIHIEQLGASAIKKILDLRDKKENLPEKSIIPFELIIRESTKARI
>NZ_CP015902.1|WP_003130364.1|1874812_1875490_-|DNA-binding-response-regulator
MDSMIKILLVEDDLSLSKSVYDFLKSFAQVKQVYDGVEGLYEAELGIYDLILLDLMLPEKNGFEVLKELREQNVDTPVLIMTAKESLDDKMHGFDIGADDYLTKPFYLDELKARIQALLKRTGKLEDSNGLTYGNIRLNLSNKSTLVDDQPVDLIGKEFDLVVYLMQNQNVILPKEQIFDRIWGYDSDTTVTVVEVYMSKIRKKLKDTEFVNNLSTLRNVGYILR
>NZ_CP015902.1|WP_058221011.1|1873352_1874720_-|sensor-histidine-kinase
MKKIIKKVKSSAIVKNDGKNFLHFFLAFTVIFVALAVIIIQVMQLGMYRATDQNLHNLAQNRVFLEEAANNQLGTSSSQDSGFGPNNSVIFYDSEGKNFMPSTGSNANISTNFGMSLLQKAMKFNEKHINTIQTVSVKNPYGDNLHYRYYTTSQFIITNSDGTVTPVYMQIFSNVDQIQDAMSRAMWVIVTTMITFWLLSIIISLYLANWTLRPILAAYEKQKEFVENASHELRTPLAILQNRLELLFQKPTATIIDESENISESLSEVRNMRLLTSNLLNLARRDSGIRIEPEATTATYFENIFNSYEMLAENAGKKFSGHLKLDGTINLDQALIKQLLTILFDNALKYTGDEGEISVDVQKNGGFLVFAVADNGEGISDEDKKKIFDRFFRVDKARTRQKGGLGLGLSLAKQIVEAYNGKITVEDNKPKGTKFIVRIRVDSTISNPAKIFQKL
>NZ_CP015902.1|WP_058221010.1|1871462_1873205_-|1-deoxy-D-xylulose-5-phosphate-synthase
MSVLEKIDSPADLKKVSNQELEELASEIRTAVLHKVSNIGGHVGPNLGVTELTIALHKVFNSPIDKFIWDVSHQTYPHKILTGRKNGFTDGHFHDITPYTSQRESEHDFFTVGHTSTSIANALGYAKARDLTNDKGNIVAVIGDGSLSGGLAMEALNNAGDFKGNLIILVNDNQMSIAENHGGFYRNLAELRATNGQAENNFFKTFGLDYKYLENGNDIESLIHLFEEVKGIDHPIVLHIHTEKGRGYQPALENKEAFHWHMPFDLETGQSKVIDSGKSYSSVMLDYMDKKVSEGLPLVAINAAIPGIFGLKQFAAKYPDRYIDAGIAEQFTITFGGAMAAAGARPIIFHNSTFVQRAYDQFWHDLAINEEPAIVIVKGGVISGSDETHQGSSAMTWISNIPNIKYLAPTSEEEFISILDWALEQHEEPVVIQMPEHGLESRPTVLTDYSTPSYQMTKSGEKVALLALGGLYSHGEKVAKVLAENGINATLINPLFINDLDQAFLENLVENHQVIATIEDGILDGGFGQKVASFLGKYDVKVLNFGAKREFNDSVPVTELYNRYHLTPELMVADILSLLK
>NZ_CP015902.1|WP_012898265.1|1871079_1871346_-|membrane-protein-insertion-efficiency-factor-YidD
MKKVLVKAVHGYQRWISPALPPACRYYPTCSNYMIQAIEKHGPAKGLAMGTARILRCHPFCQPGYDLVPDHFSLRRNWAEPEKEEDSN
>NZ_CP015902.1|WP_017864852.1|1869523_1870957_-|6-phospho-beta-glucosidase
MPFSKDFLWGGATAANQCEGGYNQGGRGLANVDLVPHGKDRFPIITGEMKHLEFDEDHFYPAKEAIDMYHHWKEDLALFAEMGFKTYRMSIAWTRIFPKGDEQEPNEEGLQFYEDIFKECQRLGIEPLVTITHFDCPVHLIKEYGGWRNRKMVGFYENLARAIFTRYKGLVRYWLTFNEINMLLHAPFMGAGLVFEEGENKEQAKYLAAHHELLASALATKIGHEVDPENKIGCMLAAGDYYPFDCNPENVFEAQKQNHDNLFFIDVQSRGKYPNYLLKRLEREEITLPIEKGDLEILAENTVDFISFSYYASRVAKVKDEDADKSAGNIFESVKNPYLEASEWGWQIDPLGLRITMNSIYDRYQKPLFIVENGLGAVDKPDENGFVADDYRIDYMAAHIKEMKKAVELDGVELLGYTSWGCIDLVSAGTGEMSKRYGFIYVDRDDYGKGSLKRTPKKSFNWYKKVIASNGEDLTNE
>NZ_CP015902.1|WP_081213644.1|1866559_1869265_-|YhgE/Pip-domain-containing-protein
MKSIKNTWKLFALDWKRIFKNPVATFLIVALMIIPSLYAWFNIKALWDPYANTSQLPIAVYSADKSASFQDKTINIGDEVLKNLKKNHQLGWKFVDSKADLDKGVKSGKYYAGIYLPKDFSKDLLSFTTGDIKKPQIVYSINEKINAIAPKITSKGASSLQSQISEEFIKTASSTLLKTFNTIGYDIDKNMVSIQKVKSAILSTNDNLGTIDKYTQQVVDLHGKMPEIKEKLAKANEFITYLPEVDALGQKVIKLNDKMPEIDKSFSLVLTLQEKIPEIQNAGKQISMIDDDFASVESTMTQGIQEAKQGLQIINQVQKSMPDIKKLGQDADSLGTITLDAAKKMQSALPSITNSVQITLQSIQEFSKNTSSVISIIDQAIADNQLTDDEKEQINSLITNFTNNIAKQRETIQNIVEYMKQVQESNGNHDLDSTIEQLTNLDSLLSELSTRMSHLNDLVQEGDVSKIRAYLSQINDVVNNISDLINKIDVSEISSTINKALTTLINTITDAKGLLNQAQQIDFDALLNSTSQTVSNAITILEKYQGEMPAIKQEIHDANVMLNGNMTTIVNAINEGANLYKNEFPTLKTKLGTASDFFKNDYAGVRKDLTDTLTMANEKMPDVESALNQANDLIQNDWPEIKSGIQKAAAAIQKSEKEVDLGEIVKLLKLDATKESDFLTQPVEVQENQIYPIANNGSASTPFYTALCLWVGAVLLSSLATTEVHLSDKDKKRYSKREQFFARMGSFVAIGLAQALIVTLGNYFGLGVDVRDPFYSVLFALLISIAFMIMVYVLVALFGNVGKGIAIIILVLSISGGGGNYPIQVSGKFFQAINPYLPFTHAVNLLRESAGGIYWPNAWFAIIILVAVSIVFVAIGAFLFPHFEDKTKKISEIGSKSHFFH
>NZ_CP015902.1|WP_081213806.1|1865721_1866462_-|demethylmenaquinone-methyltransferase
MTKVNEERVQEIFNSISSDYDKMNAIISFKQHDLWRVKTMKRMGDLTGLSILDLCCGTGDWTFDLSESVGPSGKVIGLDFSENMLEIAKAKLKEEAKKNIEFLQGNAMALPFENESFDVVTIGYGLRNTPDYLTVLKEIFRVLKPGGRVVCIETSHPTLPIYKQAFELYFKNVMPFFGKVFAKSLKEYQWLQKSAEDFPDAKTLEELFRKAGFVAVEYQKHGGGAIASHFATKSKKPKSNIRIGKK
>NZ_CP015902.1|WP_081213643.1|1864852_1865686_-|helix-turn-helix-domain-containing-protein
MPYKRYGEIFKKLREQKNFSLSHFSEIGISKASLSRFELGQTMISFERLDSALQEMNVTLAEYEHFINNFSMDYKEEFIEDIIIAHIADDVNKLHSLYLEAMEYDSKMLAYCAKSRYETLTQMEADDVVEYLYDVGEWGYFELSIFYLTLDSFSEREIMYLMKELWGKSKHLYGVFKYRRRVLQSSYRAVVLLSSKGARDSARSILQKSYPKDYFYDLYVENLRNLAHGFYSYCFKDKISGEKQIKNAIEIFGQVGYEDLADYYQKRYQKLLGKLLT
>NZ_CP015902.1|WP_058221015.1|1880811_1882389_-|alpha-amylase
MKNKLLLLSVTLLATCALSACQKANSKDSSVKKAAVSQKVDRSLYRNFYEIFTSSFADSNHDGEGDLNGVTQHLDYLNTGKSNSTTDLKVQGLWMTPIFASPSYHGYDVTNYEKINPKFGTMADFENLIAQAKKRGIAVILDMPFNHTATDNVWFQKALAGDKKYVAYYNWSDTAKEGYSLASNGKYYESEFDKSMPDLNLANPEVKKEIAKITKFWLDKGVSGFRLDAVGFYFSNDDKKTTAFTKWLTDTVKKQNPKAYLVGEVFSTASAIDDIYPSGIDSLFDFPNALQSSSSPINSALVLGEGSLFGQQIEAWDQEIHADNPKAIDAPFLSNHDTDRSATLLSSLSMQKMAAQTYLLMPGNPFIYYGEELGLTGSGIDQNKRLPMPWNAAGTDSPKADISVPGATEIATTDGGSVAQQEANPNSLLNWYKKILRVKAKYPEIATDRLKNISVSEESLSVINYGKDLTIINNFSDTENVTMKLPKSVVGTKITDQLSVSSSQAKLTDGKLTIPAYSTVILKKK
>NZ_CP015902.1|WP_081040701.1|1882378_1882990_-|sugar-O-acetyltransferase
MKMSEFKRMVAGELYKASKVEPEYKPDNNRALNQEINQLNLLDTEKIVALEKELFGQTGDELFVNPPLYIDYGKNTRIGQRFYANMDCIFLDVAPITIGDDVMFGPRVSLITASHPIDAGVRQRGLEYGKAITIGNRVWLGAGVIVNPGVTIGKNTIVGSGTVVTKNLPANVIAVGNPARILREITDSDRLYWEEKENEYYEK
>NZ_CP015902.1|WP_081040699.1|1883010_1884636_-|alpha-glucosidase
MNSHLNGVVNMKENWWQKTVVYQIYPRSFMDANGDGVGDLQGIISKLDYLEKLGIGAIWLSPVYQSPMDDNGYDISDYQAIADVFGTMADMDELLKEAKKRNIQIVMDLVVNHTSDEHKWFVEARKSKDNAYRDYYIWADEPNGLQSTFSGSAWEFDEESGQYFLHLFSKRQPDLNWGNPQVHQEVYDMMNFWIDKGIGGFRMDVIDLIGKEIDQEITGNGPKLHEYLHEMNQATFGQKNLLTVGETWGATPEIAELYSDPKRQELSMVFQFEHITNAYLDEGEKWDKKEFSVSKLKEILAKWQALEKGWNSLFWNNHDLPRIVSNWGNDGKYRLKSAKAFAILLHLMKGTPYIYQGEELGMTNYPFESIEEVNDIESRNMFAERLAAGHSENEIMDSIRRVGRDNARTPMQWTAGENAGFTDGKPWLAVNPNHEEINADQAMSDPDSVFYTYQKLIELRKQHDWVIYGDFKLIDSEADVFAYLRTYKGKKYLVVANLSDEENQFKTGFVCRDLLIHNENFLPELSQIKLKAWEAFACEVE
>NZ_CP015902.1|WP_023189702.1|1884842_1886597_-|alpha-glycosidase
MNKAAIYHRPESEFAYLYAKNLMHVRLQTQKCDVEKVELFYGDPYSWEGLDNPETQYWASQKVEMKKYLSTNISDYFEAEITVATKRVDYLFVITGLDGEKVVYTDQGMFDYDESLVTKKYGAFRLPYFHESDRFKAPEWVKETVWYQIFPERFANGDTSNDPEGTKAWNPQDVPDRQDFYGGDLQGVIDHLEHLTELGVNGIYFTPIFQAFSNHKYDTEDYMEIDKQFGDKELFKTLVKEAHARGIKVMLDAVFNHIGDTSAQWQDVLKNQEKSKFADWFHVNSWPATYTPTDDFENAENATYDTFAFTPHMPKLNTANPEVEAYLLKVADYWISEFDIDAWRLDVADEVDHTFWKKFRTTCDAAKDDFYILGEVWHSAQPWLVGDEFSAVMNYAYTDAIKDGLITKKISLEQMVSNINTQLTLYRKQVNQMMFNVLDSHDTPRILTVAKNNKNLMKLVETFTFMQPGVPCIYYGDEYAVTGGMDPECRKVMPWEEKDQDLEMFDFFKNLIALRKQYQGILSDSEVEWKIVDSENGIVKFERGSLKAIFNIGEKPAYFSADEVVFSNLVDQNNILQYGFVIYK
>NZ_CP015902.1|WP_023189703.1|1888267_1889650_+|sugar-ABC-transporter-permease
MTKKKKRKLTESTISPEEKSIKLGEVFSKGDTVTKLTFFVMGLNQIKNKQWVKGFTLLILEIAFIGWLLFSGISAFSLLSSLGPNKIKRTITDASGFPQTLQPDNSVLILLWGLIACLVVILFILLYWFNYRSNKHLYYLKREGKHIPTNKEELASLLDEKLYATLMAVPLIGVLAFTVLPTVYMISMAFTNYDRLHATAFSWTGFQAFANVLTGDLAGTFFPVLGWTLVWAIVATATTFLGGVLLALLIESTGIKFKGFWRTVFVIVFAVPQFVTLLMMAQFLDQQGALNGILMNLHLISNPINFIGAASDPMVARITVIFVNMWIGIPVSMLVSTAIIQNLPQDQIEAARIDGANSLNIFRSITFPQILFVMTPALIQQFIGNINNFNVIYLLTSGWPMNPNYQGAGSTDLLVTWLYNLVFGQTQRYNAAAVLGILIFIVNASISLVAYRRTNAFKEG
>NZ_CP015902.1|WP_015426871.1|1889655_1890522_+|maltose-ABC-transporter-permease
MKSYKTQRRISLSLRYILLALLAIVWIFPIIWIVLASLTQNNTGFVSTIIPKTFTFENYIQLFQNKSGSFPFVSWIINTFIVAVISATLSTFITIIMSYTLSRLRFAFRKPFLQIALVLGMFPGFMSMIALYYILKAMNMLNLGGLILVYVGGAGLGFYIAKGFFDTIPRSIDEAATIDGANKWQVFTHITLPLSRPIIVYTALMAFIAPWTDFIFSGIILGNNQAHPETFTIAYGLYSMVHSQKGAATAFFTQFIAGCVIIAIPITILFVIMQKFYVNGITAGADKG
>NZ_CP015902.1|WP_058221029.1|1890652_1891228_-|CPBP-family-intramembrane-metalloprotease
MSSIDLHIGYVQEFTLLIFSIVGVTVIFGNQALIWFSKPQGRYTKIAIACLIINTIWSMLGGTIVALIFGNSGNHANAVFGDYIMIFFVPFMIMGEELFSIGILETLRTKWGLPTMISTLVTSVIFGLIHFNTYNGGNVLRTIIQILLVQGVARLIFNYAYLKTSRIWTSYAVHLVFDLVFLFVLPFVIPK
>NZ_CP015902.1|WP_058208139.1|1891453_1892485_-|hypothetical-protein
MKNSKILLTTVTLLTLTAIGMQTVDAATVSGAENSTEKSLNNSQNSSTDSTPTQDELRARFNELKAQKEANQEAATYNKNASDEKNAELTSQHKVMDIATNQEAATNNLLATPYKYAEIEAQESAAGNPNSISGTDYKNSELQAQHEEQQTELRAEFNNLKAAKYNQSPSAYKDGEISAQEASIGNPDNIKGSDYKTAVLKRQASEKEAQEHDVSGTDYRKSVTKLEKLNKKDSAKTTETTNKVAGKEAVKVNPIVSSGTVSIHSAQPESAKAVKATATGTKATTTSVTKSANQNEVKTLAASLPTTGDDAGLSLFLTFIGMILFGSVGVILALFQKHGRHSK
>NZ_CP015902.1|WP_058208140.1|1892634_1892826_-|hypothetical-protein
MRKVGIICLIFLTLIVSLIAFKVYINYELDRRITLEFKKEQQSIERSARNKVGSTFTEQTGCS
>NZ_CP015902.1|WP_025016952.1|1892822_1893134_-|hypothetical-protein
MKKRKRIKISPIQGAVIVLMCFMVISIVFNIHESQRCEVLIQKYKVEHIARARQYNMIMLLYKSVPIEWENAQNENSKLSDTKLVKTLDDAKEFNEKESKIGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	19089-19119	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP017782	Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence	128363-128393	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP017783	Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence	14971-15001	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP017783	Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence	24614-24644	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP017784	Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence	9527-9557	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP017784	Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence	19170-19200	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010616	Phaeobacter inhibens strain P92 plasmid pP92_f, complete sequence	50314-50344	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP049030	Fluviibacterium aquatile strain SC52 plasmid pSC52_2, complete sequence	324627-324657	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP049031	Fluviibacterium aquatile strain SC52 plasmid pSC52_3, complete sequence	36344-36374	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP049031	Fluviibacterium aquatile strain SC52 plasmid pSC52_3, complete sequence	39240-39270	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028537	Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence	283153-283183	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	175196-175226	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	429650-429680	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP011601	Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence	171366-171396	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP019439	Thioclava nitratireducens strain 25B10_4 plasmid unnamed2, complete sequence	76363-76393	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028975	Cronobacter sakazakii strain GZcsf-1 plasmid pGW1, complete sequence	335177-335207	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	MT077884	Escherichia coli plasmid p33, complete sequence	136706-136736	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	MT077886	Escherichia coli plasmid p39, complete sequence	236030-236060	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP048293	Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence	62383-62413	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	MN423361	Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence	232620-232650	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP031568	Enterobacter hormaechei strain 2013_1a plasmid pSHV12-1301491, complete sequence	25580-25610	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	94865-94895	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP044215	Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence	311456-311486	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP020542	Sphingobium herbicidovorans strain MH plasmid pSHV3, complete sequence	4486-4516	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP030186	Salmonella enterica strain SA20094620 plasmid pSA20094620.1, complete sequence	196313-196343	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010635	Phaeobacter inhibens strain P78 plasmid pP78_f, complete sequence	46834-46864	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP009431	Sphingopyxis macrogoltabida strain 203 plasmid unnamed, complete sequence	21012-21042	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP009431	Sphingopyxis macrogoltabida strain 203 plasmid unnamed, complete sequence	64039-64069	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP040696	Citrobacter freundii strain R47 plasmid pR47-309, complete sequence	212441-212471	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP042552	Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence	235484-235514	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP016526	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence	173721-173751	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010718	Phaeobacter piscinae strain P18 plasmid pP18_c, complete sequence	97417-97447	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010722	Phaeobacter piscinae strain P18 plasmid pP18_g, complete sequence	22195-22225	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010723	Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence	2577-2607	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP043927	Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence	430599-430629	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP044075	Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence	177163-177193	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028920	Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence	120845-120875	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028920	Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence	131983-132013	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP028921	Gemmobacter sp. HYN0069 plasmid unnamed3, complete sequence	27647-27677	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP012170	Enterobacter hormaechei subsp. steigerwaltii strain 34977 plasmid p34977-263.138kb, complete sequence	142541-142571	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP005089	Sphingobium sp. TKS plasmid pTK5, complete sequence	13338-13368	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP013215	Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence	279137-279167	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP027144	Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence	25045-25075	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NC_012556	Enterobacter cloacae plasmid pEC-IMPQ, complete sequence	272863-272893	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NC_012555	Enterobacter cloacae plasmid pEC-IMP, complete sequence	255809-255839	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010755	Phaeobacter inhibens strain P70 plasmid pP70_f, complete sequence	50313-50343	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP049193	Enterobacter hormaechei strain Y2152 plasmid pIHI2-2152, complete sequence	242792-242822	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP032842	Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence	136047-136077	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010769	Phaeobacter piscinae strain P13 plasmid pP13_b, complete sequence	91130-91160	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010775	Phaeobacter piscinae strain P13 plasmid pP13_h, complete sequence	22195-22225	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP014775	Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence	119816-119846	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP049189	Enterobacter hormaechei strain Y323 plasmid pIHI2-323, complete sequence	291304-291334	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010713	Phaeobacter inhibens strain P66 plasmid pP66_h, complete sequence	50313-50343	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP029717	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence	27270-27300	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	MN937241	Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence	233920-233950	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP033103	Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence	298243-298273	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_MF344580	Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence	204522-204552	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_MH399264	Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence	172960-172990	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010740	Phaeobacter inhibens strain P72 plasmid pP72_e, complete sequence	46848-46878	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP010740	Phaeobacter inhibens strain P72 plasmid pP72_e, complete sequence	49755-49785	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_CP049047	Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence	240677-240707	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_KY863418	Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence	263181-263211	8	0.742
NZ_CP015902_1	1.1\|1284699\|31\|NZ_CP015902\|CRISPRCasFinder	1284699-1284729	31	NZ_KY978628	Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence	266944-266974	8	0.742

1. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

2. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP017782 (Rhodobacter sp. LPB0142 plasmid pEJ01, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

3. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP017783 (Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

4. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP017783 (Rhodobacter sp. LPB0142 plasmid pEJ02, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

5. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP017784 (Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

6. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP017784 (Rhodobacter sp. LPB0142 plasmid pEJ03, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

7. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010616 (Phaeobacter inhibens strain P92 plasmid pP92_f, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

8. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP049030 (Fluviibacterium aquatile strain SC52 plasmid pSC52_2, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

9. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP049031 (Fluviibacterium aquatile strain SC52 plasmid pSC52_3, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

10. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP049031 (Fluviibacterium aquatile strain SC52 plasmid pSC52_3, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

11. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028537 (Enterobacter hormaechei strain SCEH020042 plasmid pQnrB4_020042, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

12. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

13. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

14. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP011601 (Phytobacter ursingii strain CAV1151 plasmid pCAV1151-296, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

15. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP019439 (Thioclava nitratireducens strain 25B10_4 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

16. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028975 (Cronobacter sakazakii strain GZcsf-1 plasmid pGW1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

17. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to MT077884 (Escherichia coli plasmid p33, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

18. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to MT077886 (Escherichia coli plasmid p39, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

19. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP048293 (Escherichia coli strain CVM N18EC0432 plasmid pN18EC0432-1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

20. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to MN423361 (Leclercia sp. strain 1106151 plasmid p1106151-mcr, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

21. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP031568 (Enterobacter hormaechei strain 2013_1a plasmid pSHV12-1301491, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

22. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

23. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP044215 (Klebsiella aerogenes strain KA_P10_L5_03.19 plasmid pIMPIncH12_334kb, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

24. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP020542 (Sphingobium herbicidovorans strain MH plasmid pSHV3, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

25. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP030186 (Salmonella enterica strain SA20094620 plasmid pSA20094620.1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

26. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010635 (Phaeobacter inhibens strain P78 plasmid pP78_f, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

27. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP009431 (Sphingopyxis macrogoltabida strain 203 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

28. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP009431 (Sphingopyxis macrogoltabida strain 203 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

29. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP040696 (Citrobacter freundii strain R47 plasmid pR47-309, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

30. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP042552 (Enterobacter hormaechei strain C45 plasmid pC45_001, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

31. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP016526 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_261, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

32. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010718 (Phaeobacter piscinae strain P18 plasmid pP18_c, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

33. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010722 (Phaeobacter piscinae strain P18 plasmid pP18_g, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

34. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010723 (Phaeobacter piscinae strain P18 plasmid pP18_h, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

35. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP043927 (Klebsiella quasipneumoniae subsp. quasipneumoniae strain M17277 plasmid p17277A_477, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

36. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP044075 (Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

37. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028920 (Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

38. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028920 (Gemmobacter sp. HYN0069 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

39. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP028921 (Gemmobacter sp. HYN0069 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

40. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP012170 (Enterobacter hormaechei subsp. steigerwaltii strain 34977 plasmid p34977-263.138kb, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

41. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP005089 (Sphingobium sp. TKS plasmid pTK5, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

42. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP013215 (Klebsiella pneumoniae subsp. pneumoniae strain H11 plasmid pH11, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

43. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP027144 (Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

44. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NC_012556 (Enterobacter cloacae plasmid pEC-IMPQ, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

45. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NC_012555 (Enterobacter cloacae plasmid pEC-IMP, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

46. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010755 (Phaeobacter inhibens strain P70 plasmid pP70_f, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

47. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP049193 (Enterobacter hormaechei strain Y2152 plasmid pIHI2-2152, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

48. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP032842 (Enterobacter hormaechei strain C15117 plasmid pSPRC-Echo1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

49. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010769 (Phaeobacter piscinae strain P13 plasmid pP13_b, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

50. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010775 (Phaeobacter piscinae strain P13 plasmid pP13_h, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

51. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP014775 (Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

52. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP049189 (Enterobacter hormaechei strain Y323 plasmid pIHI2-323, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

53. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010713 (Phaeobacter inhibens strain P66 plasmid pP66_h, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

54. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP029717 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

55. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to MN937241 (Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

56. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP033103 (Enterobacter hormaechei strain L51 plasmid pEHZJ1, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

57. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_MF344580 (Enterobacter cloacae strain 30860 plasmid p30860-HI2, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

58. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_MH399264 (Enterobacter cloacae strain RJ702 plasmid pIMP26, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

59. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010740 (Phaeobacter inhibens strain P72 plasmid pP72_e, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

60. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP010740 (Phaeobacter inhibens strain P72 plasmid pP72_e, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

61. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_CP049047 (Enterobacter hormaechei strain Y233 plasmid pIHI2-233, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

62. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_KY863418 (Enterobacter asburiae strain AMA 497 plasmid pOXA436, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

63. spacer 1.1|1284699|31|NZ_CP015902|CRISPRCasFinder matches to NZ_KY978628 (Cronobacter sakazakii strain 505108 plasmid p505108-MDR, complete sequence) position: , mismatch: 8, identity: 0.742

cgtcagcgcagctgacagttctgt-cagtaat	CRISPR spacer
tttcagcgcagcggacagatctgtccagccg-	Protospacer
. ********** ***** ***** ***. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

136636 : 163981

Clostridium_phage(25.0%)

transposase,integrase

attL 145042:145101|attR 162889:163022

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081213290.1\|136636_137527_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021037031.1\|137680_139261_-	hypothetical protein	NA	NA	NA	NA
WP_011835457.1\|139241_140006_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.5e-27	28.4
WP_021216425.1\|140128_141028_-	EamA family transporter	NA	NA	NA	NA
WP_023349191.1\|141177_142068_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_021214757.1\|142072_142402_-	hypothetical protein	NA	NA	NA	NA
WP_010890681.1\|142427_142808_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_042748662.1\|142821_143187_-	hypothetical protein	NA	NA	NA	NA
WP_010890679.1\|143281_143548_-	hypothetical protein	NA	NA	NA	NA
WP_010890656.1\|143561_144359_-	hypothetical protein	E2ELL2	Clostridium_phage	1.8e-18	38.3
WP_081213291.1\|144462_145020_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.3e-31	43.1
145042:145101	attL	NA	NA	NA	NA
WP_081213292.1\|145567_147034_-	DNA polymerase	Q6DMX4	Streptococcus_phage	2.6e-124	51.5
WP_081213293.1\|147673_148006_+	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_081144388.1\|148037_148241_-	hypothetical protein	NA	NA	NA	NA
WP_052133406.1\|149313_149856_-	hypothetical protein	NA	NA	NA	NA
WP_081213294.1\|150035_150716_-\|transposase	IS6-like element ISS1N family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	83.2
WP_003132322.1\|151693_151894_+	hypothetical protein	Q9AZK6	Lactococcus_phage	2.2e-05	51.9
WP_003132324.1\|152024_152225_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_012898583.1\|152502_152703_+	cold-shock protein	Q9AZD3	Lactococcus_phage	6.9e-28	92.4
WP_003131011.1\|153217_153457_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003131013.1\|153486_154047_+	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_011835142.1\|154056_154245_+	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_014017382.1\|154265_154817_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_081213295.1\|155302_155983_-	DDE domain-containing protein	A0A1X9I6C6	Streptococcus_phage	6.1e-108	82.7
WP_021109227.1\|156182_157049_+	KR domain-containing protein	F2NZ40	Diadromus_pulchellus_ascovirus	1.2e-60	46.9
WP_081213296.1\|158633_159176_-\|integrase	site-specific integrase	E2ELN7	Clostridium_phage	1.4e-17	35.3
WP_003107891.1\|159204_159501_-	DUF4298 domain-containing protein	NA	NA	NA	NA
WP_081213297.1\|159591_160482_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_080749492.1\|160644_160791_+	hypothetical protein	NA	NA	NA	NA
WP_081213786.1\|162869_163709_-	DDE domain-containing protein	A0A1P8CWQ3	Bacillus_phage	5.5e-50	41.4
162889:163022	attR	NA	NA	NA	NA
WP_003137511.1\|163720_163981_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6

DBSCAN-SWA_2

498308 : 510436

uncultured_virus(30.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003131595.1\|498308_498626_+	thioredoxin	A0A0K2FIM3	Achromobacter_phage	4.5e-05	30.4
WP_003131594.1\|498711_499338_+	DUF4479 domain-containing protein	NA	NA	NA	NA
WP_023188995.1\|499500_500841_+	NADH oxidase	NA	NA	NA	NA
WP_058221224.1\|500929_501319_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	1.1e-24	47.9
WP_003131589.1\|501438_501723_+	co-chaperone GroES	A0A221S386	uncultured_virus	3.1e-13	44.1
WP_003131585.1\|501811_503440_+	molecular chaperone GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.8
WP_003131583.1\|503485_504298_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	38.1
WP_012897229.1\|504466_505909_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.4e-32	33.0
WP_003131580.1\|505901_506603_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.2e-42	39.7
WP_012897230.1\|506780_507416_+	thymidylate kinase	M1PSC7	Streptococcus_phage	5.4e-74	65.0
WP_003131573.1\|507547_508408_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.0e-67	45.2
WP_023188991.1\|508459_509242_+	Signal peptidase-like protein	NA	NA	NA	NA
WP_011675472.1\|509234_509561_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_003131568.1\|509560_510436_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	8.7e-99	65.4

DBSCAN-SWA_3

947873 : 998858

Lactococcus_phage(50.0%)

protease,transposase,holin,portal,tail,terminase,capsid,integrase

attL 979556:979572|attR 995141:995157

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081213439.1\|947873_949004_-\|integrase	site-specific integrase	A0A1B1IMP1	Lactococcus_phage	1.8e-43	33.8
WP_081213440.1\|949144_950029_-	hypothetical protein	NA	NA	NA	NA
WP_081213441.1\|950086_950674_-	hypothetical protein	Q9AZW4	Lactococcus_phage	1.5e-83	76.2
WP_081213442.1\|950684_951224_-	XRE family transcriptional regulator	A0A1B1IMP5	Lactococcus_phage	8.6e-49	68.6
WP_081213443.1\|951452_951671_+	hypothetical protein	NA	NA	NA	NA
WP_081213798.1\|951630_952260_-	DUF4145 domain-containing protein	Q7Y4L7	Streptococcus_phage	4.2e-55	53.9
WP_081213444.1\|952357_952693_+	XRE family transcriptional regulator	A0A1B1IMQ9	Lactococcus_phage	1.0e-36	97.4
WP_081213445.1\|952709_953432_+	hypothetical protein	O48505	Lactococcus_phage	1.3e-68	54.5
WP_058218046.1\|953571_953823_+	hypothetical protein	NA	NA	NA	NA
WP_081213446.1\|954071_954281_+	hypothetical protein	NA	NA	NA	NA
WP_081213447.1\|954306_954495_+	hypothetical protein	NA	NA	NA	NA
WP_081213448.1\|954504_954939_+	single-stranded DNA-binding protein	Q9AYU6	Lactococcus_phage	1.8e-49	70.9
WP_081213449.1\|954949_955798_+	DnaD domain protein	A0A1L2BY83	Clostridium_phage	8.3e-14	44.3
WP_081213450.1\|955801_956197_+	hypothetical protein	NA	NA	NA	NA
WP_058208322.1\|956193_956412_+	hypothetical protein	NA	NA	NA	NA
WP_081213451.1\|956408_956918_+	hypothetical protein	NA	NA	NA	NA
WP_081213452.1\|957074_957371_+	hypothetical protein	NA	NA	NA	NA
WP_081213453.1\|957363_957924_+	DUF1642 domain-containing protein	Q77MW7	Lactococcus_phage	6.0e-45	56.3
WP_081213454.1\|957920_958265_+	hypothetical protein	Q9AZU2	Lactococcus_phage	1.2e-56	93.0
WP_081213455.1\|958257_958656_+	hypothetical protein	Q9AZ74	Lactococcus_phage	9.6e-05	32.7
WP_081213456.1\|959003_959165_+	hypothetical protein	A0A1P8BKU8	Lactococcus_phage	5.0e-21	83.0
WP_081213457.1\|960218_960491_+	hypothetical protein	Q8LTL7	Lactococcus_phage	1.0e-42	92.2
WP_039115547.1\|960741_961041_+	hypothetical protein	NA	NA	NA	NA
WP_081213458.1\|961089_961389_+	alpha/beta hydrolase	A0A1S5SFB3	Streptococcus_phage	9.1e-24	60.5
WP_081213459.1\|962120_963860_+\|terminase	terminase large subunit	A3F641	Streptococcus_phage	9.5e-214	62.3
WP_081213460.1\|964599_965904_+\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	1.6e-40	30.6
WP_080756630.1\|965866_966709_+\|protease	Clp protease ClpP	A3F644	Streptococcus_phage	5.5e-34	41.4
WP_058208909.1\|966708_967854_+\|capsid	phage major capsid protein	A3F645	Streptococcus_phage	2.4e-80	46.7
WP_081213461.1\|968032_968338_+	hypothetical protein	A3F647	Streptococcus_phage	1.1e-11	43.0
WP_039115531.1\|968334_968721_+	hypothetical protein	A0A1S5SFE6	Streptococcus_phage	4.8e-17	42.7
WP_081213462.1\|968713_969118_+	hypothetical protein	A0A2P0ZLD7	Lactobacillus_phage	4.4e-13	41.3
WP_029344159.1\|969114_969504_+	hypothetical protein	NA	NA	NA	NA
WP_029344158.1\|969518_970097_+	hypothetical protein	A3F651	Streptococcus_phage	4.8e-29	42.9
WP_029344157.1\|970153_970459_+	hypothetical protein	NA	NA	NA	NA
WP_029344156.1\|970734_971298_+	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_081213463.1\|971375_973859_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	4.2e-90	38.4
WP_081213464.1\|973822_975463_+	hypothetical protein	A3F654	Streptococcus_phage	5.7e-27	41.1
WP_081213799.1\|975471_976986_+\|tail	phage tail protein	Q9AZL3	Lactococcus_phage	1.4e-75	35.7
WP_081213465.1\|976985_980138_+	hypothetical protein	A0A1P8BKD5	Lactococcus_phage	8.8e-210	44.9
979556:979572	attL	NA	NA	NA	NA
WP_025017282.1\|980148_980385_+	hypothetical protein	NA	NA	NA	NA
WP_023189750.1\|980397_980622_+\|holin	phage holin	A0A1B1IMU8	Lactococcus_phage	1.4e-32	98.6
WP_023164507.1\|980634_980922_+\|holin	phage holin	Q9AZL0	Lactococcus_phage	1.6e-46	98.9
WP_081213466.1\|980921_981701_+\|holin	phage holin	Q9AZW7	Lactococcus_phage	1.5e-126	98.1
WP_081213800.1\|981805_982000_-	hypothetical protein	A5GYL5	Lactococcus_phage	3.2e-14	88.6
WP_081213467.1\|983378_984560_+	serine/threonine protein kinase	A0A0G2YBE6	Acanthamoeba_polyphaga_mimivirus	6.0e-10	27.3
WP_032941908.1\|985084_985582_+	hypothetical protein	NA	NA	NA	NA
WP_029343694.1\|985574_986903_+	glycosyl transferase	NA	NA	NA	NA
WP_010905603.1\|987128_987665_+	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_021722038.1\|987863_988595_+	nicotinamide riboside transporter PnuC	A0A1S5RCS1	Lactobacillus_phage	2.6e-16	29.9
WP_003131384.1\|989123_989549_+	universal stress protein	NA	NA	NA	NA
WP_081213468.1\|989691_990018_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_003131387.1\|990087_990621_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_039115065.1\|990786_993186_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_003131392.1\|993371_993704_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_039115070.1\|993839_994814_+\|integrase	integrase	A0A142F1N9	Bacillus_phage	6.6e-31	28.6
WP_003137511.1\|998597_998858_-\|transposase	IS3 family transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6
995141:995157	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1004299 : 1018666

Lactococcus_phage(82.35%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039115080.1\|1004299_1005928_+	hypothetical protein	A0A2K8I8E7	Lactococcus_phage	7.3e-184	59.3
WP_039115081.1\|1005940_1006225_+	HNH endonuclease	A0A023J2U4	Lactococcus_phage	3.7e-27	63.2
WP_081213469.1\|1007430_1007946_+	hypothetical protein	A0A126HA84	Lactococcus_phage	1.5e-37	46.8
WP_039115088.1\|1007938_1009087_+	hypothetical protein	A0A126HA32	Lactococcus_phage	4.1e-88	48.7
WP_039115090.1\|1009205_1009481_+	hypothetical protein	A0A126HAQ3	Lactococcus_phage	2.5e-12	38.8
WP_081213470.1\|1009477_1009792_+	hypothetical protein	H9ED09	Lactococcus_virus	3.1e-30	64.4
WP_039115096.1\|1009805_1010144_+	hypothetical protein	R9R0Z2	Lactococcus_phage	5.4e-25	50.9
WP_039115098.1\|1010136_1010502_+	hypothetical protein	A0A1W6JH10	Lactococcus_phage	5.5e-23	49.6
WP_052230904.1\|1010517_1011192_+	hypothetical protein	A0A126HD64	Lactococcus_phage	5.9e-55	51.2
WP_039115102.1\|1011227_1011506_+	hypothetical protein	A0A2K8IJZ2	Lactococcus_phage	4.2e-15	51.2
WP_039115103.1\|1011577_1012063_+	hypothetical protein	B3TJP9	Lactococcus_virus	1.7e-11	32.5
WP_039115104.1\|1012066_1014547_+	tape measure domain-containing protein	A0A023J3B5	Lactococcus_phage	1.1e-98	54.9
WP_039115105.1\|1014550_1015909_+	hypothetical protein	C7T1V3	Lactococcus_virus	2.0e-134	51.2
WP_081213471.1\|1015908_1016508_+	hypothetical protein	A0A126H9C5	Lactococcus_phage	9.3e-36	54.1
WP_081213472.1\|1016480_1017032_+	hypothetical protein	A0A2H4ESG5	Lactococcus_phage	6.4e-31	45.2
WP_052230906.1\|1017424_1018312_+	hypothetical protein	Q1RNC9	Lactococcus_phage	3.9e-46	42.9
WP_039115108.1\|1018342_1018666_+	hypothetical protein	A0A1X9IGI3	Lactococcus_phage	1.9e-19	49.5

DBSCAN-SWA_5

1092331 : 1115781

Staphylococcus_phage(21.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130964.1\|1092331_1093024_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.7e-31	34.4
WP_012897609.1\|1093016_1093952_+	ABC transporter permease	NA	NA	NA	NA
WP_012897610.1\|1094053_1095031_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.9e-118	66.0
WP_017864416.1\|1095379_1097548_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.3e-257	61.1
WP_003130968.1\|1097683_1098106_-	protein NrdI	A0A142F1R4	Bacillus_phage	2.3e-12	37.3
WP_012897612.1\|1098107_1098326_-	NrdH-redoxin	C3U2K9	Lactococcus_phage	7.6e-12	47.6
WP_012897613.1\|1098499_1099138_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_012897614.1\|1099412_1101347_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.1e-125	43.5
WP_003130975.1\|1101551_1102091_+	cysteine hydrolase	NA	NA	NA	NA
WP_081213483.1\|1102083_1102917_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	5.3e-21	39.4
WP_003130977.1\|1102913_1103363_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003130980.1\|1103637_1106112_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	4.2e-98	32.2
WP_003130981.1\|1106137_1107043_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_012897616.1\|1107511_1108600_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.9e-50	38.8
WP_012897617.1\|1108599_1109250_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	9.4e-42	43.1
WP_081213484.1\|1109258_1110455_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.4e-112	51.5
WP_003130993.1\|1110482_1110947_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.8e-39	53.7
WP_012897620.1\|1111049_1111502_+	signal peptidase II	NA	NA	NA	NA
WP_003130995.1\|1111562_1112468_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.4e-11	28.2
WP_012897621.1\|1112616_1113060_+	acid phosphatase	NA	NA	NA	NA
WP_012897622.1\|1113199_1114822_+	hypothetical protein	NA	NA	NA	NA
WP_012897623.1\|1114824_1115781_+	glycosyltransferase	I1TED8	Salmonella_phage	4.0e-49	37.5

DBSCAN-SWA_6

1320667 : 1326444

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081213518.1\|1320667_1321879_-	NADPH-dependent FMN reductase	A0A2P0ZL82	Lactobacillus_phage	3.5e-58	57.4
WP_011915229.1\|1321932_1322538_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	8.8e-50	52.7
WP_023189236.1\|1322553_1323477_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_023189235.1\|1323656_1324709_-	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	5.2e-58	39.1
WP_058223180.1\|1324773_1325253_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	4.5e-33	47.4
WP_058220898.1\|1325236_1325791_-	TIGR00730 family Rossman fold protein	A0A1D3SNB7	Enterococcus_phage	1.5e-27	41.9
WP_023189232.1\|1325793_1326444_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	2.2e-54	49.5

DBSCAN-SWA_7

1389327 : 1401073

Streptococcus_phage(25.0%)

integrase

attL 1385005:1385020|attR 1390946:1390961

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1385005:1385020	attL	NA	NA	NA	NA
WP_081213525.1\|1389327_1390590_-\|integrase	site-specific integrase	A0A1S5S9U4	Streptococcus_phage	3.5e-32	29.7
WP_025016762.1\|1390667_1390916_-	hypothetical protein	A0A1X9IGE0	Lactococcus_phage	2.9e-15	50.7
WP_025016763.1\|1390955_1391249_-	hypothetical protein	NA	NA	NA	NA
1390946:1390961	attR	NA	NA	NA	NA
WP_081213526.1\|1391633_1393418_-	ImmA/IrrE family metallo-endopeptidase	A0A1X9I6C7	Streptococcus_phage	1.1e-76	31.4
WP_081213527.1\|1393445_1394504_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.1e-74	43.7
WP_025016766.1\|1396380_1397157_-	XRE family transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	8.2e-08	39.5
WP_044009673.1\|1397467_1398634_-	nucleotide sugar dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	9.2e-80	42.2
WP_032943383.1\|1398633_1399413_-	site-specific DNA-methyltransferase	K9MDN9	Sulfolobus_virus	9.3e-12	28.0
WP_081213528.1\|1399483_1401073_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.6e-53	30.3

DBSCAN-SWA_8

1720791 : 1791739

Lactococcus_phage(82.14%)

head,tRNA,protease,portal,holin,tail,terminase,capsid,integrase

attL 1749285:1749305|attR 1788205:1788225

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058221313.1\|1720791_1721829_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003130721.1\|1721904_1722216_-	XRE family transcriptional regulator	A0A1S5SAD3	Streptococcus_phage	3.3e-08	40.8
WP_023188713.1\|1722294_1723467_-	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_081213591.1\|1723589_1728446_-	hypothetical protein	NA	NA	NA	NA
WP_023188710.1\|1728482_1729238_-	WxL domain-containing protein	NA	NA	NA	NA
WP_081213592.1\|1729275_1730034_-	WxL domain-containing protein	NA	NA	NA	NA
WP_080513158.1\|1730071_1730800_-	WxL domain-containing protein	NA	NA	NA	NA
WP_058221316.1\|1730891_1731737_-	WxL domain-containing protein	NA	NA	NA	NA
WP_017864793.1\|1731797_1732103_-	hypothetical protein	NA	NA	NA	NA
WP_039115689.1\|1732690_1733308_+	hypothetical protein	NA	NA	NA	NA
WP_017864795.1\|1733342_1733513_-	hypothetical protein	NA	NA	NA	NA
WP_010906045.1\|1733540_1734848_-	GTPase ObgE	NA	NA	NA	NA
WP_021722683.1\|1735003_1736182_-	cell division protein DivIB	NA	NA	NA	NA
WP_003130746.1\|1736182_1737256_-	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase	NA	NA	NA	NA
WP_003130748.1\|1737465_1738818_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_010906046.1\|1739309_1739651_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_039115695.1\|1739782_1741024_-	ammonium transporter	NA	NA	NA	NA
WP_010906048.1\|1741206_1742682_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.5e-26	33.1
WP_012898209.1\|1742690_1743383_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	5.3e-35	34.1
WP_081213593.1\|1743538_1744069_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_003130760.1\|1744199_1744445_-	50S ribosomal protein L31 type B	NA	NA	NA	NA
WP_080668870.1\|1744600_1745032_-	hypothetical protein	A0A1P8BMT7	Lactococcus_phage	1.7e-10	34.3
WP_023188700.1\|1745146_1745509_-	hypothetical protein	NA	NA	NA	NA
WP_023188699.1\|1745734_1746646_-	CHAP domain-containing protein	W5R8Q8	Staphylococcus_phage	4.0e-06	38.5
WP_025017008.1\|1746758_1747595_-	metallophosphoesterase	NA	NA	NA	NA
WP_081213594.1\|1748281_1749190_+	hypothetical protein	NA	NA	NA	NA
1749285:1749305	attL	NA	NA	NA	NA
WP_081213595.1\|1749478_1749691_-	hypothetical protein	A0A182BQ74	Lactococcus_phage	7.9e-06	38.2
WP_081213596.1\|1750600_1751380_-\|holin	phage holin	Q9AZW7	Lactococcus_phage	1.8e-124	96.5
WP_081213597.1\|1751379_1751679_-\|holin	phage holin	Q9AZR2	Lactococcus_phage	2.9e-46	99.0
WP_081213598.1\|1751691_1752042_-	hypothetical protein	A0A1P8BKU2	Lactococcus_phage	1.1e-49	91.4
WP_081213599.1\|1752068_1752893_-	hypothetical protein	A0A059NTA1	Lactococcus_phage	1.5e-20	70.1
WP_081213600.1\|1753026_1755456_-	hypothetical protein	A0A059NT86	Lactococcus_phage	5.4e-311	71.8
WP_081213601.1\|1755467_1755833_-	hypothetical protein	A0A059NT91	Lactococcus_phage	7.1e-63	98.3
WP_081213602.1\|1755845_1760627_-\|tail	phage tail protein	A0A059NT57	Lactococcus_phage	0.0e+00	83.6
WP_014734984.1\|1760657_1761029_-	hypothetical protein	A0A059NT78	Lactococcus_phage	1.1e-47	100.0
WP_011676909.1\|1761052_1761463_-	hypothetical protein	A0A059NTA0	Lactococcus_phage	2.8e-68	99.3
WP_021722205.1\|1761536_1761962_-\|tail	major tail protein	A0A182BQ87	Lactococcus_phage	2.5e-67	92.1
WP_021722206.1\|1761974_1762337_-	hypothetical protein	A0A182BQ88	Lactococcus_phage	1.1e-60	99.2
WP_032946647.1\|1762336_1762885_-	hypothetical protein	A0A059NT55	Lactococcus_phage	1.0e-97	99.5
WP_081213603.1\|1762868_1763222_-	hypothetical protein	A0A059NT74	Lactococcus_phage	1.9e-57	94.9
WP_081213604.1\|1763202_1763535_-	hypothetical protein	A0A059NT99	Lactococcus_phage	3.2e-54	95.5
WP_081213605.1\|1763554_1764673_-\|capsid	N4-gp56 family major capsid protein	A0A182BQ73	Lactococcus_phage	1.1e-149	84.3
WP_081213803.1\|1764684_1765341_-	DUF4355 domain-containing protein	A0A182BQ92	Lactococcus_phage	9.7e-79	89.9
WP_081213606.1\|1765687_1766824_-\|head	phage head morphogenesis protein	A0A059NT80	Lactococcus_phage	3.0e-200	98.4
WP_081213607.1\|1766833_1767208_-	hypothetical protein	NA	NA	NA	NA
WP_081213608.1\|1767209_1767497_-\|protease	ribosomal-processing cysteine protease Prp	A0A059NT85	Lactococcus_phage	2.4e-45	94.7
WP_081213609.1\|1767719_1769123_-\|portal	phage portal protein	A0A182BQ97	Lactococcus_phage	3.5e-251	98.5
WP_081213610.1\|1769131_1770367_-\|terminase	PBSX family phage terminase large subunit	A0A182BQ98	Lactococcus_phage	1.2e-234	95.6
WP_081213611.1\|1770356_1770869_-\|terminase	terminase small subunit	A0A182BQ99	Lactococcus_phage	1.4e-80	95.9
WP_081213612.1\|1771318_1771744_-	DUF722 domain-containing protein	A0A059NT50	Lactococcus_phage	1.5e-75	98.6
WP_032398678.1\|1772077_1772299_-	hypothetical protein	A0A1P8BL06	Lactococcus_phage	6.4e-35	100.0
WP_032398551.1\|1772307_1772538_-	hypothetical protein	NA	NA	NA	NA
WP_081213613.1\|1772534_1772705_-	hypothetical protein	A0A1B1IMR7	Lactococcus_phage	5.7e-07	48.4
WP_081213614.1\|1772680_1772905_-	hypothetical protein	NA	NA	NA	NA
WP_081213615.1\|1772901_1773177_-	hypothetical protein	NA	NA	NA	NA
WP_081213804.1\|1773173_1773446_-	hypothetical protein	Q9AZP0	Lactococcus_phage	2.9e-29	94.1
WP_081213805.1\|1773726_1773963_-	hypothetical protein	Q9AZU2	Lactococcus_phage	4.8e-20	86.9
WP_075070383.1\|1774076_1774508_-	hypothetical protein	NA	NA	NA	NA
WP_081213616.1\|1774510_1774930_-	aminotransferase	A5GYP0	Lactococcus_phage	1.3e-68	94.9
WP_081213617.1\|1774926_1775196_-	hypothetical protein	A0A1W6JJZ9	Lactococcus_phage	6.5e-21	52.9
WP_081213618.1\|1775192_1775699_-	DUF1642 domain-containing protein	A0A1P8BLY6	Lactococcus_phage	6.9e-32	47.7
WP_081213619.1\|1775691_1776003_-	hypothetical protein	NA	NA	NA	NA
WP_081213620.1\|1775983_1776133_-	hypothetical protein	Q9AZP4	Lactococcus_phage	5.5e-14	94.9
WP_081213621.1\|1776240_1776717_-	hypothetical protein	A5GZ50	Lactococcus_phage	4.3e-76	99.3
WP_023164530.1\|1776640_1776805_-	hypothetical protein	A0A1P8BKY2	Lactococcus_phage	5.5e-23	98.1
WP_081213622.1\|1776814_1777705_-	prepilin peptidase	Q38098	Lactococcus_phage	4.6e-164	99.7
WP_081213623.1\|1777714_1778521_-	replication protein	A0A1P8BL25	Lactococcus_phage	4.4e-57	99.1
WP_031560862.1\|1778645_1779071_-	single-stranded DNA-binding protein	Q9AZV6	Lactococcus_phage	1.6e-74	99.3
WP_081213624.1\|1779063_1779822_-	hypothetical protein	Q0ILF6	Lactococcus_phage	1.1e-142	96.0
WP_081213625.1\|1779830_1780349_-	hypothetical protein	Q9XJE3	Lactococcus_phage	9.1e-88	98.3
WP_010905687.1\|1780464_1780680_-	hypothetical protein	Q38272	Lactococcus_phage	2.4e-34	100.0
WP_081213626.1\|1780679_1780880_-	XRE family transcriptional regulator	A0A1X9I6I3	Streptococcus_phage	1.1e-06	43.5
WP_003130869.1\|1781485_1781824_-	hypothetical protein	A0A1B1IMQ1	Lactococcus_phage	9.8e-59	99.1
WP_081213627.1\|1781837_1782629_-	phage antirepressor	Q38330	Lactococcus_phage	9.9e-110	79.0
WP_021214421.1\|1782641_1782890_-	XRE family transcriptional regulator	J7KK54	Streptococcus_phage	2.9e-07	51.7
WP_081213628.1\|1783077_1783749_+	hypothetical protein	NA	NA	NA	NA
WP_081213629.1\|1784032_1784521_+	helix-turn-helix domain-containing protein	Q9AZW3	Lactococcus_phage	3.4e-36	76.4
WP_081213630.1\|1784530_1785118_+	hypothetical protein	Q9AZW4	Lactococcus_phage	4.9e-106	98.5
WP_081213631.1\|1785182_1785938_+	DUF4352 domain-containing protein	A0A0P0IXE0	Lactobacillus_phage	1.8e-23	46.2
WP_081213632.1\|1786039_1786816_+	glycoside hydrolase, family 25	A0A1P8BMN5	Lactococcus_phage	4.2e-97	98.1
WP_081213633.1\|1786950_1788090_+\|integrase	site-specific integrase	A0A1B1IMP1	Lactococcus_phage	1.4e-210	97.6
WP_015426754.1\|1788194_1789268_-	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.0e-60	35.3
1788205:1788225	attR	NA	NA	NA	NA
WP_017864817.1\|1789330_1790263_-	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	9.8e-24	30.8
WP_010906053.1\|1790446_1791739_-	uracil permease	Q9KX94	Enterobacteria_phage	1.6e-61	35.9

DBSCAN-SWA_9

1924762 : 1934623

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003130886.1\|1924762_1925524_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-17	30.0
WP_003130885.1\|1925689_1926499_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-10	26.5
WP_003130884.1\|1926532_1927426_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
WP_021722156.1\|1927425_1928349_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_017864882.1\|1928469_1929321_-	phosphate ABC transporter substrate-binding protein	E3SNT9	Prochlorococcus_phage	4.2e-05	27.3
WP_003130880.1\|1929666_1930563_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	7.2e-08	32.4
WP_003130878.1\|1930840_1931308_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	2.7e-43	56.6
WP_081040700.1\|1931339_1931918_-	esterase	NA	NA	NA	NA
WP_058221023.1\|1932004_1934623_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.9e-64	33.3

DBSCAN-SWA_10

1951106 : 1966041

Lactococcus_phage(86.67%)

integrase

attL 1956239:1956254|attR 1966429:1966444

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081213652.1\|1951106_1951595_-	DUF4065 domain-containing protein	A0A0N9SGM1	Paenibacillus_phage	3.7e-14	40.5
WP_081213653.1\|1951793_1952087_-	hypothetical protein	NA	NA	NA	NA
WP_081213654.1\|1952079_1952355_-	DUF2089 domain-containing protein	NA	NA	NA	NA
WP_010906208.1\|1952499_1953006_-	GNAT family N-acetyltransferase	Q9AZG4	Lactococcus_phage	4.2e-90	100.0
WP_081213807.1\|1953155_1953293_-	hypothetical protein	NA	NA	NA	NA
WP_003132811.1\|1953505_1953868_-	hypothetical protein	Q9AZG6	Lactococcus_phage	1.7e-56	99.2
WP_081213655.1\|1953885_1954458_-	hypothetical protein	Q9AZG7	Lactococcus_phage	1.4e-94	96.8
WP_032398903.1\|1954619_1954826_-	hypothetical protein	Q9AZG9	Lactococcus_phage	1.4e-31	97.1
WP_003132807.1\|1954844_1955027_-	hypothetical protein	Q9AZH0	Lactococcus_phage	5.3e-27	98.3
WP_080554626.1\|1955396_1955711_-	hypothetical protein	Q9AZH1	Lactococcus_phage	4.1e-51	94.2
1956239:1956254	attL	NA	NA	NA	NA
WP_081213656.1\|1957103_1957373_-	hypothetical protein	Q9AZH3	Lactococcus_phage	3.4e-38	93.3
WP_023163719.1\|1957369_1957522_-	hypothetical protein	Q9AZH4	Lactococcus_phage	1.7e-15	86.0
WP_010906219.1\|1957774_1957945_-	hypothetical protein	Q9AZH6	Lactococcus_phage	4.6e-25	100.0
WP_081213657.1\|1958016_1958706_-	hypothetical protein	R9QNB1	Lactococcus_phage	9.8e-114	96.8
WP_010906222.1\|1958820_1959027_-	transcriptional regulator	NA	NA	NA	NA
WP_047686619.1\|1959175_1959883_+	XRE family transcriptional regulator	Q9AZH9	Lactococcus_phage	9.1e-115	92.3
WP_081213658.1\|1959963_1961169_+\|integrase	site-specific integrase	Q9AZI0	Lactococcus_phage	5.7e-117	54.1
WP_081213659.1\|1961295_1962210_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	5.4e-11	25.8
WP_003132795.1\|1962365_1962878_-	HD domain-containing protein	NA	NA	NA	NA
WP_010906113.1\|1963210_1963444_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_058220830.1\|1963536_1966041_-	ATP-dependent RecD-like DNA helicase	A0A1W6JK95	Lactococcus_phage	1.3e-43	25.6
1966429:1966444	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP015902

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection