CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP015108	Sporosarcina ureae strain S204, complete genome	3 crisprs	RT,csa3,cas14j,DEDDh,cas3,PrimPol,DinG	0	0	0	0

Cas Category Instructions

Results visualization

1. NZ_CP015108

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP015108_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015108_1

174071-174179

Orphan

Consensus_repeat	Method
CCCAACTTGCAACCGCTCATAAGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015108_1

>merge|NZ_CP015108|1|174071-174179|CRISPRCasFinder
CCCAACTTGCAACCGCTCATAAGGATGTTCTAAATGCTCTATAACAACAATCTACCGCTCTATCACAGTCCGTATCCGCTCATCCCCGACTTGCAACCGCTCATAAGGA

>NZ_CP015108|1|1|174071-174179|CRISPRCasFinder
CCCAACTTGCAACCGCTCATAAGGA	TGTTCTAAATGCTCTATAACAACAATCTACCGCTCTATCACAGTCCGTATCCGCTCATC
CCCGACTTGCAACCGCTCATAAGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015108.1\|WP_029053802.1\|176345_178319_+\|DNA-topoisomerase-IV-subunit-B	unknown	unknown	gnl\|CDD\|235542
NZ_CP015108.1\|WP_029053798.1\|174375_174801_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP015108.1\|WP_029053792.1\|167702_167921_+\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP015108.1\|WP_037561773.1\|167457_167679_+\|DUF1659-domain-containing-protein	unknown	unknown	gnl\|CDD\|377933
NZ_CP015108.1\|WP_029053807.1\|184232_185393_+\|thiolase	unknown	unknown	gnl\|CDD\|181147
NZ_CP015108.1\|WP_029053799.1\|174800_175118_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015108.1\|WP_037561795.1\|166913_167324_-\|DUF2621-domain-containing-protein	unknown	unknown	gnl\|CDD\|378554
NZ_CP015108.1\|WP_029053793.1\|168244_168835_+\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266
NZ_CP015108.1\|WP_029053801.1\|175469_176072_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	unknown	unknown	gnl\|CDD\|234691
NZ_CP015108.1\|WP_029053800.1\|175146_175440_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227178
NZ_CP015108.1\|WP_037561771.1\|165903_166416_+\|cytochrome-c-biogenesis-protein-CcdC	unknown	unknown	gnl\|CDD\|377808
NZ_CP015108.1\|WP_029053794.1\|168855_169539_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381602
NZ_CP015108.1\|WP_029053797.1\|171148_173863_+\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_CP015108.1\|WP_029053805.1\|183318_183762_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|379194
NZ_CP015108.1\|WP_029053806.1\|183777_184203_+\|dehydratase	unknown	unknown	gnl\|CDD\|239537
NZ_CP015108.1\|WP_029053803.1\|178315_180742_+\|DNA-topoisomerase-IV-subunit-A	unknown	unknown	gnl\|CDD\|235503
NZ_CP015108.1\|WP_029053795.1\|169837_170092_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP015108.1\|WP_029053804.1\|181159_183304_+\|acetyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|223972
NZ_CP015108.1\|WP_029053796.1\|170223_170772_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NZ_CP015108.1\|WP_081657891.1\|167996_168125_+\|YvrJ-family-protein	unknown	unknown	gnl\|CDD\|378969

Protein	Function_ID	Function_description	E-value
NZ_CP015108.1\|WP_029053802.1\|176345_178319_+\|DNA-topoisomerase-IV-subunit-B	gnl\|CDD\|235542	PRK05644, gyrB, DNA gyrase subunit B; Validated.	0
NZ_CP015108.1\|WP_029053798.1\|174375_174801_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	3.80009e-38
NZ_CP015108.1\|WP_029053792.1\|167702_167921_+\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	1.50191e-18
NZ_CP015108.1\|WP_037561773.1\|167457_167679_+\|DUF1659-domain-containing-protein	gnl\|CDD\|377933	pfam07872, DUF1659, Protein of unknown function (DUF1659). This family consists of hypothetical bacterial proteins of unknown function.	0.00421907
NZ_CP015108.1\|WP_029053807.1\|184232_185393_+\|thiolase	gnl\|CDD\|181147	PRK07855, PRK07855, lipid-transfer protein; Provisional.	3.42823e-107
NZ_CP015108.1\|WP_037561795.1\|166913_167324_-\|DUF2621-domain-containing-protein	gnl\|CDD\|378554	pfam11084, DUF2621, Protein of unknown function (DUF2621). This family is conserved in the Bacillaceae family. Several members are named as YneK. The function is not known.	2.19675e-89
NZ_CP015108.1\|WP_029053793.1\|168244_168835_+\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	3.89752e-39
NZ_CP015108.1\|WP_029053801.1\|175469_176072_-\|glycerol-3-phosphate-1-O-acyltransferase-PlsY	gnl\|CDD\|234691	PRK00220, PRK00220, glycerol-3-phosphate 1-O-acyltransferase PlsY.	3.03185e-75
NZ_CP015108.1\|WP_029053800.1\|175146_175440_-\|hypothetical-protein	gnl\|CDD\|227178	COG4841, COG4841, Uncharacterized protein conserved in bacteria [Function unknown].	3.04852e-30
NZ_CP015108.1\|WP_037561771.1\|165903_166416_+\|cytochrome-c-biogenesis-protein-CcdC	gnl\|CDD\|377808	pfam07301, DUF1453, Protein of unknown function (DUF1453). This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown. Members of this family seem to be found exclusively in the Order Bacillales.	9.00931e-54
NZ_CP015108.1\|WP_029053794.1\|168855_169539_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381602	cd13399, Slt35-like, Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	3.00426e-29
NZ_CP015108.1\|WP_029053797.1\|171148_173863_+\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_CP015108.1\|WP_029053805.1\|183318_183762_+\|MaoC-family-dehydratase	gnl\|CDD\|379194	pfam13452, MaoC_dehydrat_N, N-terminal half of MaoC dehydratase. It is clear from the structures of bacterial members of MaoC dehydratase, pfam01575, that the full-length functional dehydratase enzyme is made up of two structures that dimerize to form a whole. Divergence of the N- and C- monomers in higher eukaryotes has led to two distinct domains, this one and MaoC_dehydratas. However, in order to function as an enzyme both are required together.	3.68039e-31
NZ_CP015108.1\|WP_029053806.1\|183777_184203_+\|dehydratase	gnl\|CDD\|239537	cd03453, SAV4209_like, SAV4209_like. Similar in sequence to the Streptomyces avermitilis SAV4209 protein, with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.	5.58081e-41
NZ_CP015108.1\|WP_029053803.1\|178315_180742_+\|DNA-topoisomerase-IV-subunit-A	gnl\|CDD\|235503	PRK05561, PRK05561, DNA topoisomerase 4 subunit A.	0
NZ_CP015108.1\|WP_029053795.1\|169837_170092_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.12671e-11
NZ_CP015108.1\|WP_029053804.1\|181159_183304_+\|acetyl-CoA-synthetase	gnl\|CDD\|223972	COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion].	1.39174e-155
NZ_CP015108.1\|WP_029053796.1\|170223_170772_-\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	3.34007e-42
NZ_CP015108.1\|WP_081657891.1\|167996_168125_+\|YvrJ-family-protein	gnl\|CDD\|378969	pfam12841, YvrJ, YvrJ protein family. This family of short proteins are related to B. subtilis YvrJ protein. None of the members of this family have been functionally characterized.	1.83875e-07

>NZ_CP015108.1|WP_029053797.1|171148_173863_+|aconitate-hydratase-AcnA
MAKSNLHNSRQSFTVNDKTYNYYRLKALEEAGLTKVSKLPYSVRVLLESVLRQHDGYVIKDDHVEDLAKWGTVQNADAEVPFKPSRVILQDFTGVPVVVDLASLRSAMNELGGDPNEINPEIPVDLVIDHSVQVDSYGTQQALQLNMELEFERNAERYQFLSWAQKAYDNYRAVPPATGIVHQVNLEYLANVVHAVENEDGSFETYPDTLVGTDSHTTMINGIGVLGWGVGGIEAEAGMLGQPSYFPIPEVIGVKLVGDLPDGTTATDLALKVTQILRAQGVVGKFVEFFGPGVSKLPLADRATIANMAPEYGATCGFFPVDEESLNYMRLTGRDEEHIAVVKQYLIENDMFFTPEKEEPTFTKVVEINLSDIAANLSGPKRPQDLIPLTEMQQSFKDAVVAPEGTQGFGLTPKELEKKGTIKFEDGRKVELKTGDVAIAAITSCTNTSNPYVMLAAGLVAKKAVEKGLTPPAYVKTSLAPGSKVVTGYLNESGLSDYMDQIGFNTVGYGCTTCIGNSGPLLPEIEKTIGDEDLLVTSVLSGNRNFEGRVHPFVKANYLASPPLVVAYALAGTVNIDFAKDPIGTDKDGNEVFFKDIWPSTQEVNDVLNATVTPELFRKEYARVFTENEAWNAIETTDDSLYDFDESSTYIQNPPFFENLSKEPADIEQLKGLRVIGKFGDSITTDHISPAGAIGLNTPAGIYLRENGVEPRNFNSYGSRRGNHEVMMRGTFANIRIRNQIAAGTEGGFTTYWPNKEVMPIYDAAMKYQQDGTGLAILGGKDYGMGSSRDWAAKGTNLLGIKTVIVESFERIHRSNLVMMGVLPLQFINGENVESLGLTGEEEISVNIAEGVKPRSILKVTAKAPDGKETEFEVLARFDSEVEVDYYRHGGILQMVLRNKLAAK
>NZ_CP015108.1|WP_029053796.1|170223_170772_-|cysteine-hydrolase
MKKALLVVDYTVDFVDKEGALTCGEPGIALEEYIVDQTAAYLKQQLPVFVINDLHEKNDQYHPESKLFPPHNIRGTEGRNLYGKLHDLYTEQNEEMIWMDKTRYSAFAGTDLDIQLRARGITEIHLMGVCTDICILHTAVDAYNLGYTIVVHEGGVASFNAAGHDWALSHFQNTLGATVLAK
>NZ_CP015108.1|WP_029053795.1|169837_170092_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MSFLWFLIIGGIIGWLAGLILGKDIPGGIIGNIIAGIVGAWIGGALLGEWGPQISSFYFVPALIGAIVLVFIVSLIMKSMRKAS
>NZ_CP015108.1|WP_029053794.1|168855_169539_+|lytic-transglycosylase-domain-containing-protein
MKKLKKKRLSRSGRVMVAFLVLLVPVAVTLFTISAILWVNFGKHDTITETATALFHIQDRKTGEAVPQEFIPIYIEAAKEYNIPWTLLAAHHRIETRFSTMKTDVSPVGAEGPMQFMPCTFVGWDYPGCKELGKGDIPERDKIDPAVIEQYGGYGVDANGDGIADPFDIEDAIFSAANYLSDSGAADGDIQKAVFTYNHSDQYVEDVLWYYNEFEEQRIASEKQVKK
>NZ_CP015108.1|WP_029053793.1|168244_168835_+|SCO-family-protein
MYKKLLVPLTLIFVLMLSACGGGFKPDHKYKVDSFEFTNQNNETVTDEDLKGSIWLAQFVFTKCTTVCPPMMSNMVTLQEKLIDNNIEDYNIVSFSVDPDVDTPEELAKYLDMFSAPDESKWQMLTGYDMKTIEKIAASSFKQLVKQIPNDDQVIHGVSFGLVNQNNEVVKLYGGNEDVDYDTIVKDIKALIKEGK
>NZ_CP015108.1|WP_081657891.1|167996_168125_+|YvrJ-family-protein
MEDWLQLIQDVGFPIFVSFYLLHRLEVKLEAIHGVLSDIKNR
>NZ_CP015108.1|WP_029053792.1|167702_167921_+|DUF2922-domain-containing-protein
MAKVLELTFLTAANKPVKLTVDEPHEDLTEGQVEAAMQQVIASNIFLIEESPLATIKSARIVARDTQNIVSR
>NZ_CP015108.1|WP_037561773.1|167457_167679_+|DUF1659-domain-containing-protein
MAASLEFSQATARIHFNAGVNEKGHFIHKIKTYKFINDDATPANMYTALTQLASLSSYPFIQLEKVVTEDIHN
>NZ_CP015108.1|WP_037561795.1|166913_167324_-|DUF2621-domain-containing-protein
MWFIIFWGIVMIGLFAIGGFFMFRKFLKVLPKEDGKSTLDWEEHYVNESLHLWNDEAKSMLNELVTPVPELFRDVAKQKIGAKIGEIALEDRAKTIEFDHIIKGYILATPKRDHNFLRKKLNQMEIDIQPYEHLFT
>NZ_CP015108.1|WP_037561771.1|165903_166416_+|cytochrome-c-biogenesis-protein-CcdC
MHKIQELIDYVFTSIPSIYLIIGSTVIFVVMTTIVYTMRAKASNKPILAKKIILPPLFMSTGMFMFLFDEFRVPWTQVLEASLVGILFSAFLIYTTTFEMKNDRIYMKKSKAFLIILLGLLVIRMVGKIVLSNTIDIGELGGMFFILAFSMILPWRIGMLVKYKKLEKSM
>NZ_CP015108.1|WP_029053798.1|174375_174801_+|acyl-CoA-thioesterase
MFTSEKEIEVRYAETDQMGVVYHANYLVWMEIGRTTLIKDLGYEYAQLEREGYLAPVTELSVKYKAASTYGETVTVKTWVESHGKLRTVYGYEILHADGSIAATAVTEHVIVKKENFRPVSLRKIHPEWDAVYTKIQRGES
>NZ_CP015108.1|WP_029053799.1|174800_175118_+|hypothetical-protein
MAFGINRQQLKEWKNAVRREEIAFLTHYWLDDRFPTVNTVTKAGCSNVEKLIQWGRQYGLQPEWIHAREEYPHFDLLGERQVEILKQEGQLHQLTQLKNGKHNSL
>NZ_CP015108.1|WP_029053800.1|175146_175440_-|hypothetical-protein
MNIHLSELAIQWFEEDMEVAAGDYVKFFARYGGSSPLHEGFSIGITKEEPDELAVETIVNDVHYYVEERDVWFFDGHDLHIDVDTSTKELSFDYQVA
>NZ_CP015108.1|WP_029053801.1|175469_176072_-|glycerol-3-phosphate-1-O-acyltransferase-PlsY
MENYVIILAAYLLGSIPSALWIGKLFYGTDVRQHGSGNMGATNTFRVLGKKAGIVVTLLDIFKGTAAVLLPLLPFFHDTAIHPLILGVVAVLGHIFPIFAGLRGGKAVATSGGVLLGFNWPIFLLVVITFLIALKLTKMVSLTSIIVSVLGPLYCLIYYFMGGDLYLFLVVALMGFFIFYRHRDNISRIKNGTEPKVKWL
>NZ_CP015108.1|WP_029053802.1|176345_178319_+|DNA-topoisomerase-IV-subunit-B
MTKQKIQNTYDDSSIQILEGLEAVRKRPGMYIGSTDTRGLHHLVYEIVDNSVDEALAGFGNEIDVTLHKDGSISVRDYGRGMPTGKHESGKPTAEVIMTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVTIYRDGKKFLQRFEHGGKPATTLEEIGKTRETGTMIHFKPDTTIFSTIKYQYDTLAERLRESAFLLKGLKITLKEEGTDKQDIFHYESGIEAFVAYLNEEKEVLHDVAYLEGEVDGIEVEFAFQFSDGYAETILSFVNNVRTKDGGTHETGAKAAMTRVVNEYARKAGLLKEKDKNLDGSDIREGIAAIVSVRIPEEILQFEGQTKGKLGTSEARTVTDAVISQKMLYFLEENAELSANLVRKAIRAHQAREAARKAREDARSGKKRKKSDTLLSGKLSPAQSRNAAKNELYLVEGDSAGGSAKQGRDRTFQAILPLRGKVINTEKAKLEDIMKNEEINTIIHAVGGGVGADFQIEDAAYDKVIIMTDADTDGAHIQVLLLTFFYRYMKPLIEAGKVYIALPPLFKVFKGTGKSEKLAYAWTDDDLEEAIEKVGKGYMLQRYKGLGEMNADQLWETTMDPSTRTLIRVTIEDGAKSERRVTTLMGDKVEPRRKWIEENVDFGLIEEHNILDNAYIHVEGDTK
>NZ_CP015108.1|WP_029053803.1|178315_180742_+|DNA-topoisomerase-IV-subunit-A
MTQSETFQDLPLEEVIGDRFGRYSKYIIQDRAIPDARDGLKPVQRRILYAMFHEGNTHEKAFRKSAKTVGNVIGNYHPHGDTSVYDAMVRMSQSWKLRHEMIDMQGNNGSVDGDSAAAMRYTEARLSAIASEMLRDIRKETVDFAFNFDDTELEPTVLPGRFPNLLVNGSTGISAGYATDIPPHALHEVIDAVLMRLKKPNVTVDELMTVIPGPDFPTGAIIQGTDGIRTAYQTGKGRFIIRALWEIEQLKAGKSQIVITEIPYDVNKANLVKKMDELRHDRRLDGIAEIRDESDRTGMRIVVELKKEIDGTAIMQYLLKHTDLQITYNFNMIAIAGRRPMLMSLPMLLDAYIDHQKDVITRRSNFDIRKAKERLHIVDGLMKALSILDEVIKTIRASKDKKDAKLNLVNAYDFTEVQAEAIVSLQLYRLTNTDITELKREEQELRDLIKELEAILASEAKLISVLVKELKGIRKQFSEPRRSVIEEKIEELKVDLDILIPSEEVMVSVTKGGYVKRTSMRSYSASGGKGQEMKEYDYNLIESPMNTQHHLLLFTSFGNYIYQPVHELPEIRWRDLGQHLSSICGLEPGEELVDAIALEKFDENSSILTASSNGNVKISKLTDFQVQRFNRTFKAMNVKKDDRLVGARVITGKEDVLLVSKQAYSLRFALSELAITGIRTGGVKGINLKAEDELVAFEVITEQARNVFVATQRGTIKRMNISEFETSSRALRGVTIIKELKSNPYRVVDMKLVKDEEEFVIHTSKGLKIEVEPMSIKNSNRQSTGSSVVDEAKDGQIVQVVTVKKDRK
>NZ_CP015108.1|WP_029053804.1|181159_183304_+|acetyl-CoA-synthetase
MMNEVLPSNIELDPLFNPKRVAVLGASENTNKIGYLQLKALLDAGFEGEIYPIHPTAKEIGELPCYTSVGDTPERVDLAILCVGINQVEKCLIDCGESGVKAAIVFASGYSEIGEEGIIAQNRLKEIAEQYHMRLIGPNCVGLLNTTNGLMGTFSPGLTNVPLGKKREVGFVTQSGAFGVLTYIAAAQHGLTFNYFVSVGNEVDVSFSDVIEYMLHDPKTKVASGYLEGEKNAAKLRKLAKFALQINKPIVIMKSGRSSAGSRAAASHTGSLAGADKVYDGFFKQAGIVRADDYDDILSFSKLFLAKKLPTGKNTVIVTSSGGRGINEADRCESYGLNIHALSDKVRKEIEKDIPDFASASNPVDLTAAASITNPELYLAPLKVLVNDPDTDIILFPEFPIHWDENTPLLQEFVEICKNSDKFVLISNFPLKGMSIPKGVQYLEDNGIPFILGDMNPIRSLAKLVDYAEAYRKAHKINDEPARKELDVSNIRHLLPANQTLSESQSSEILSEYGIRTTKRITAKTADDAVQAANNMGYPVVMKIDSPDIPHKTEVNGIRLNVQNGQEVRQAFKEIYDSAKEHCPTANLHGISVQEMLPEGVEVIVGVTSDPTFGPVIMFGLGGVFVEVFKDVSFRVAPITRQDAIDKMESLKGYQILQGVRNKKPVDQEAIIDVLLKVSRLIEDYSDIIQEIDINPLIVYEDGIVAADALIITK
>NZ_CP015108.1|WP_029053805.1|183318_183762_+|MaoC-family-dehydratase
MDLDKSVIGLTSDEYVFEVESRHVGQFATAIGDDNPLYTDDRYAKESAYEGLVVPPTFPIAMNDGKVEMPVQLDHRRMLHGEQEFLYYKPIRIGDQLRCQIKVSDLYDKEGKSGKMQFLKLDTEMKDEAGELVCISRMNIVYRAAKN
>NZ_CP015108.1|WP_029053806.1|183777_184203_+|dehydratase
MIKDWVLEELTVDQKLEPMVKSPITKVQLAQYAGASGDFNPLHLDDGFAQKIGMDGVIAHGMLVMGFLGEYVMKIAGKEARVANFKMRFGKMTVPGDEIRCSGVVERTYEEDGKRCIALELTAEKVSGEVVGAGSAILQLT
>NZ_CP015108.1|WP_029053807.1|184232_185393_+|thiolase
MRTIKDRYAIVGVGESERSRKSGTTPLHLALDAANAAIKDAGLKATDIDGFMNYNEGDSCTSHQLATYLGVRPKYVKDIQGGGASTEMLIADAVALIEAGQLNTVLIYRSMNGSSGTRVGRGYDPDMLQGALAGGSFVIPYGSASPSQWFGMYATRHMHETGITKEHLGHVCLSFYEHAQRNPKAFLHGKPLTMENYLATPDISSPFNIHDSCLELDEGNAIIVTSAEKAEDCTSKPVYIMGMAARQCHPHAHYWNDIDHVASDYVAKELYENAGVTPDDIDVASIYDCFSWVVMRQLEAYGFAKRGEVGEFVAEGNLKIGGKLPTNTAGGMLSEGYTHGMNNAIEIVRQLRHDYDGTARQVEDCKIGICTGWAGPDIAGAMILRN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015108_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015108_2

1008656-1008731

Orphan

Consensus_repeat	Method
GGAAACTATTCTGAATTGCGCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015108_2

>merge|NZ_CP015108|2|1008656-1008731|CRISPRCasFinder
GGAAACTATTCTGAATTGCGCCATACGAACGGTACCAGGTCCCCACACAAATCGGAAACTATTCTGAATTGCGCCA

>NZ_CP015108|2|2|1008656-1008731|CRISPRCasFinder
GGAAACTATTCTGAATTGCGCCA	TACGAACGGTACCAGGTCCCCACACAAATC
GGAAACTATTCTGAATTGCGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015108.1\|WP_029055068.1\|1013222_1013594_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP015108.1\|WP_029055072.1\|1015453_1015729_-\|DUF2564-family-protein	unknown	unknown	unknown
NZ_CP015108.1\|WP_029054499.1\|996513_997098_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380061
NZ_CP015108.1\|WP_029055065.1\|1010930_1011584_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP015108.1\|WP_029055066.1\|1011585_1012476_+\|glycine/betaine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270327
NZ_CP015108.1\|WP_099662801.1\|1005086_1006252_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP015108.1\|WP_029055071.1\|1014762_1015158_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|225861
NZ_CP015108.1\|WP_029054503.1\|1000622_1001936_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_CP015108.1\|WP_029055064.1\|1009801_1010938_+\|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP015108.1\|WP_029054501.1\|999054_999591_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377866
NZ_CP015108.1\|WP_029055070.1\|1014227_1014656_-\|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|225356
NZ_CP015108.1\|WP_029055062.1\|1007617_1008538_-\|LD-carboxypeptidase	unknown	unknown	gnl\|CDD\|132882
NZ_CP015108.1\|WP_029054500.1\|997754_998954_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NZ_CP015108.1\|WP_029054504.1\|1002147_1003806_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236111
NZ_CP015108.1\|WP_029054502.1\|999830_1000472_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377294
NZ_CP015108.1\|WP_029055067.1\|1012651_1013104_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176874
NZ_CP015108.1\|WP_037562253.1\|1013654_1014041_-\|DUF1801-domain-containing-protein	unknown	unknown	gnl\|CDD\|378058
NZ_CP015108.1\|WP_029054505.1\|1004243_1005017_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|180440
NZ_CP015108.1\|WP_029055063.1\|1008848_1009112_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015108.1\|WP_029055060.1\|1006484_1007150_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP015108.1\|WP_029055068.1\|1013222_1013594_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	1.04899e-08
NZ_CP015108.1\|WP_029054499.1\|996513_997098_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380061	pfam17932, TetR_C_24, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in family members such as HTH-type transcriptional repressor KstR2 as well as fatty acid metabolism regulator proteins. In Mycobacterium smegmatis, KstR2 is involved in involved in cholesterol catabolism, while YsiA in Bacillus subtilis is involved in fatty acid degradation.	1.30891e-28
NZ_CP015108.1\|WP_029055065.1\|1010930_1011584_+\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	6.70883e-75
NZ_CP015108.1\|WP_099662801.1\|1005086_1006252_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.71385e-55
NZ_CP015108.1\|WP_029055071.1\|1014762_1015158_-\|VOC-family-protein	gnl\|CDD\|225861	COG3324, COG3324, Predicted enzyme related to lactoylglutathione lyase [General function prediction only].	1.81206e-30
NZ_CP015108.1\|WP_029055064.1\|1009801_1010938_+\|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.16607e-149
NZ_CP015108.1\|WP_029054501.1\|999054_999591_-\|hypothetical-protein	gnl\|CDD\|377866	pfam07553, Lipoprotein_Ltp, Host cell surface-exposed lipoprotein. This is a family of lipoproteins that is involved in superinfection exclusion. Proteins in this family have been shown to act at the stage of DNA release from the phage head into the cell.	6.01812e-22
NZ_CP015108.1\|WP_029055070.1\|1014227_1014656_-\|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein	gnl\|CDD\|225356	COG2764, PhnB, Uncharacterized protein conserved in bacteria [Function unknown].	1.46734e-45
NZ_CP015108.1\|WP_029054503.1\|1000622_1001936_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	0
NZ_CP015108.1\|WP_029054500.1\|997754_998954_+\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.66789e-126
NZ_CP015108.1\|WP_029054504.1\|1002147_1003806_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|236111	PRK07843, PRK07843, 3-oxosteroid 1-dehydrogenase.	0
NZ_CP015108.1\|WP_029054502.1\|999830_1000472_-\|hypothetical-protein	gnl\|CDD\|377294	pfam04307, YdjM, LexA-binding, inner membrane-associated putative hydrolase. YdjM is a family of putative LexA-binding proteins. Members are predicted to be membrane-bound metal-dependent hydrolases that may be acting as phospholipases. It is a member of the SOS network, that rescues cells from UV and other DNA-damage. Expression of YdjM is regulated by LexA.	1.529e-05
NZ_CP015108.1\|WP_037562253.1\|1013654_1014041_-\|DUF1801-domain-containing-protein	gnl\|CDD\|378058	pfam08818, DUF1801, Domain of unknown function (DU1801). This large family of bacterial proteins is uncharacterized. They contain a presumed domain about 110 amino acids in length.	1.1082e-21
NZ_CP015108.1\|WP_029055062.1\|1007617_1008538_-\|LD-carboxypeptidase	gnl\|CDD\|132882	cd07025, Peptidase_S66, LD-Carboxypeptidase, a serine protease, includes microcin C7 self immunity protein. LD-carboxypeptidase (Muramoyltetrapeptide carboxypeptidase; EC 3.4.17.13; Merops family S66; initially described as Carboxypeptidase II) family also includes the microcin c7 self-immunity protein (MccF) as well as uncharacterized proteins including hypothetical proteins. LD-carboxypeptidase hydrolyzes the amide bond that links the dibasic amino acids to C-terminal D-amino acids. The physiological substrates of LD-carboxypeptidase are tetrapeptide fragments (such as UDP-MurNAc-tetrapeptides) that are produced when bacterial cell walls are degraded; they contain an L-configured residue (L-lysine or meso-diaminopimelic acid residue) as the penultimate residue and D-alanine as the ultimate residue. A possible role of LD-carboxypeptidase is in peptidoglycan recycling whereby the resulting tripeptide (precursor for murein synthesis) can be reconverted into peptidoglycan by attachment of preformed D-Ala-D-Ala dipeptides. Some enzymes possessing LD-carboxypeptidase activity also act as LD-transpeptidase by replacing the terminal D-Ala with another D-amino acid. MccF contributes to self-immunity towards microcin C7 (MccC7), a ribosomally encoded peptide antibiotic that contains a phosphoramidate linkage to adenosine monophosphate at its C-terminus. Its possible biological role is to defend producer cells against exogenous microcin from re-entering after having been exported. It is suggested that MccF is involved in microcin degradation or sequestration in the periplasm.	1.01964e-95
NZ_CP015108.1\|WP_029054505.1\|1004243_1005017_+\|glucose-1-dehydrogenase	gnl\|CDD\|180440	PRK06172, PRK06172, SDR family oxidoreductase.	8.15568e-90
NZ_CP015108.1\|WP_029055066.1\|1011585_1012476_+\|glycine/betaine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270327	cd13609, PBP2_Opu_like_1, Substrate-binding domain of putative ABC-type osmoprotectant uptake system; the type 2 periplasmic-binding protein fold. This group includes the periplasmic substrate-binding component of a putative ABC transport system that is predicted to be involved in uptake of osmoprotectants (also termed compatible solutes) such as betaine, choline, proline betaine, carnitine, and L-proline. The relative substrate preference of this group is not known. To counteract the efflux of water, many microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.53856e-117
NZ_CP015108.1\|WP_029055067.1\|1012651_1013104_-\|hypothetical-protein	gnl\|CDD\|176874	cd08865, SRPBCC_10, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	4.85136e-20

>NZ_CP015108.1|WP_029055062.1|1007617_1008538_-|LD-carboxypeptidase
MATKPQQLKMGDTVGIVTLGSPLAANRITEGIRMLQTMGYKVVVGEHVYGANGFLAATPQQRASDLMMMFTNPEVKWILPTRGGVGVAGILPFLDFNVIKQNPKIVSGYSDITILLNVLFEYADLISFQSLLLLDFTSGTPSYNFNQFFTATSNVTAPWQIMNPPEVPLNGLVPGNVTGPIVGGNLTSFVGTLGTSYEINTEGRILVLEETHEPINTVYRYVKHLEMAGKFDDCVGIIMGQCTNCDSAYGKSYVDLINEFIVPLGKPLMTNLATAHGRYKATIPIGSRVNMNTVNRTLTVMEPVVK
>NZ_CP015108.1|WP_029055060.1|1006484_1007150_-|hypothetical-protein
MNLLNVRKGQFVYYQNKLHKVYSVKAFFKQSVHLIRLEDFEQQLATAKEINLYKPKHMDSFVVNHKRYTLHKDEKAKVGDYILIINPQPDSLDHHHLHAIEMVSSIERHGVISNKSNGIKHNEYWVMKPGLEDGANIIDMEIPDAQYNKAQVEEKSKISVPQAHQPKIGDVYQCNTKDPVLQAMVVAIQGETVYLGGNLEMNINELNDAESWSLVHRKSLS
>NZ_CP015108.1|WP_099662801.1|1005086_1006252_-|IS3-family-transposase
MGKNVYSSEVKWAVVKDKLSGELTTKEIMEKHGVKNKSQIETWMRWYRANEIYRFDQPIGKQYTFGHGPELSSEADKKERQMSHLKMENEILKKVHGDRKEIEKEIVLQIVEKLKKKYTITAILSALGVPRATYYRWRLEETDKSLSVEEEAIIELCKRTKYRNGHRKIKAFLKQEYNIELNRNTVQRLMQKHNLQCRIKPKRKWKSQGESIIIAPDLLKRNFTASEPNQKWVTDITYIQYGSTTKYLSTIMDLYNNEIVAYKLYDHQQTPLVIDTLKAALAARNHPTGVIIHSDQGSVYTSYAYQAYIKDNDLIGSMSRRGNCWDNAVIESFHSSLKSEEFQYVKFNSLRNNIVVERVIAYLNYYNEERIQEKLGYLTPIKYGVKAA
>NZ_CP015108.1|WP_029054505.1|1004243_1005017_+|glucose-1-dehydrogenase
MVGMMEGKAGLVTGSGSGIGRATAIALAKAGAKVMISDVSEEAGQETVQLIQDFGGEAAFFKCDVSNEEQVIGLVNKTVETFGKLDFAHNNAGINKGLKPIGEMDSKDWDITLKVNLYGTFYCIKHEVNAMLKTGGGAIVNTASGAGIEGSPNMAPYTASKHAIAGLTKSVALEYGQQGITINSIAPGATITPAIESWSKTSPEQYQGVLASLPAGRMSTAEEQANAVVFLCSDLARSISGVTLAVDGGYTAGKMQQ
>NZ_CP015108.1|WP_029054504.1|1002147_1003806_-|FAD-dependent-oxidoreductase
MEWDYEYDVIVVGSGASGFSAAITGKKEGLKTVLIEKEKVFGGASALSGGGVWIPNNRYLVEGGVRDSFQEAKTYLDATVGDKTSDEMKETYLKKGIDMMDYLHDTSEHMRFTYAKDYSDYYPHLEGGKGEGRSIEPTVFNLNKLGGWRGQMKKPAMDTKGFVMTGQDFRHINMITRTWKGKKRSLTLGWRLVKHLVLKANYSALGQALIGRLALTYKELGGELWLDSPFIDFTIEDDSITGIKIMKDGKETRVKASKGVIFASGGFSQKQSFREKYLPAPTDKTWTSSPQGQTGDLLDPAQMLGAKLGFMDKVWGAPSIIDHTGKPFFLVADRAIPSMIITDQDGNRYINEPTPYHEFVDTMYAHHEKTGGKAIHSWIILDHKAKKRHLFAGLFPGQDFPKEYYEHGVVLKSETIAGLEEQLAIPKGNLVKTVERFNGFAETGKDLDFHRGETKHDQYYGDPTLKNPNLDALNKGPYYALKIYPGDIGTKGGVVIDTHARVLKEDGTPIEGLYACGNCSAAVMGESYPGPGATIGPGMTFGHIAALHCKEN
>NZ_CP015108.1|WP_029054503.1|1000622_1001936_-|short-chain-fatty-acid-transporter
MKLLTRWSNTLMERYLPDPYIFVAILTLVVFGLGLGFTDSGPLDMVVHWGDGFWGLLSFTMQMVIVLVAGYVLAISPVFKKLLSTLAGVAKSPGSAIILVSVVALIACWINWGFGLVIGALFAKEIATKVPNVDYRLLIASAYSGMIIWHGGLGGSIPLSIATEDHPFADIMGVVHTSETIFSTYNMIIVVALLIAIPLLNRFMMPKPEHTVTVDPKLLEEHIEVEKDTDHTPASKLENSVIISMLIGALGLIYLIQHFITKGFDLNLNIVNFIFLILGVIFHGTPKRFLAAVTTAVKTAGGIIIQFPFYAGIMGMMVASGLAGVMSEWFVSISTGSTFPLFTFFAAGLVNFFVPSGGGQWAVQAPIMLDAAQTLGVSYSKTAMAIAWGDAWTNMIQPFWALPALAIAGLRAKDIMGFCIFVLVVSGIIISIGLYFF
>NZ_CP015108.1|WP_029054502.1|999830_1000472_-|hypothetical-protein
MKGTSHLFIGTAVGAIAGYAVQPDIKTALIGATVGGISGVVPDLDTNGLASNSITLSKKVSKWLMETAGIVILLTLIYQVFTEGLSQDIYVYGGIGLLLLIVSRIITQRRMLTITGILVMLLGFVLDQSLGILLAGSYIIIASFLPHRSYTHSIIGIVFYAYILKHVYAQWPIDGLVAAGLAGYISHLLADMKVLPVNRRGVKWFMPLWNREF
>NZ_CP015108.1|WP_029054501.1|999054_999591_-|hypothetical-protein
MEENQKKKKPFYKKWWVWVIALIIIISATNSSDEDNEVASQEASKQATTEPVQDTPKEEKTDIFEPVKEEKPVEDDVPSEYKSALKKAETYAKTMNMSKKSISEQLTSENGEKFTEEEAQYAMENLQADYNKNALAKAKTYQETMSMSPEGIRDQLTSSYGEKFTQEEANYAIENLDK
>NZ_CP015108.1|WP_029054500.1|997754_998954_+|MFS-transporter
MNRYKYGQLKSTNQVLLISAVLLVACNLRAAITSVGPIIGLLRESLSLSNGSIGILTSLPLIAFAVMSPIVPKISTRFTNETTLIAGMCTLSFGIILRSIPFIPLLFIGTMLIGVGIAISNVLLPGIIKERFPNQVPLMTSVYTTTMSLFAALASGVSIPLAVGAGLGWEFALGIWIVPALVGIGIWVYFVKQRKSADEVNMYYVKADDSKMWRSPLAWQVAIFLGLQAFSYNALMTWLPEILIDYGVTSKSAGWMLSFNQLIGLPASLLVPIIAGKFTSQRGIILILCTLAFGGYIGLLFGESYDVMIWSVGLIGVAYGGLFPLSLAFLAMRTTTAMQAAKLSGMAQAIGYSLAAIGPVLLGSLVDTTGTWTFSLSILLFVTVLTLIVGFGAGRNRVL
>NZ_CP015108.1|WP_029054499.1|996513_997098_-|TetR/AcrR-family-transcriptional-regulator
MSLREKKVERKKEEIRKSAMSVIAEKGYHATTMEDIAAKLLMTKGSVYYYFKDKESLVYESHKLLLEQSMEQLQNVLAEELTSVAKLRKAMVVHMENVITGRTDFFIGVKPDQVFEGEHLQEILHLRNQYSDCMNRLIQQGMEDGSFVQVDMKIVNYIILGAMNNAVIWYSPKGSKSIEELANSIADYLLKILL
>NZ_CP015108.1|WP_029055063.1|1008848_1009112_-|hypothetical-protein
MNYRIGNKQVFEQAQVRSVSDIPFTEEELQNGMMLAIAKKDSTLALYLVEVDGQKKFEVRWDDSHELFSGWNSAWENFTWCLDIVGN
>NZ_CP015108.1|WP_029055064.1|1009801_1010938_+|betaine/proline/choline-family-ABC-transporter-ATP-binding-protein
MLKFENVTKTYDGGFQAVKSVNFEIAEGELLVLIGPSGSGKSTTMKMINRIIPHTSGKISINGKDIKSYNAADLRRNIGYVIQQVGLFPHYTIEKNISIVPKLKNWNENKTRTRVLDLLEMVGLDPKIYASRYPKELSGGQQQRVGIARALAADPDIILMDEPFSALDPITREQLQEELLKLHKQLKKTIVFVTHDMDEALKMGDRIAIMKDGNLLQLDTPEKLLHEPAHGFVEEFMGKHRIIQNPELMPVTEIMAEKVVTTRSNTSPERAISLIRQRKITDLLVVDDQKKLLGIVSAYDLIKQIDGIKTIDEVMKPAVPFLLDTATAKDAIIMMDSSPFGMIPIVDEHHILVGLVNRGSLLSAMSSQWTDKGAVLDE
>NZ_CP015108.1|WP_029055065.1|1010930_1011584_+|ABC-transporter-permease
MNNLNIWQQLVEQTKLRWPEVLEATSIHIQLVFFSMILAVLIAVTLGIVITRVPKLKTGVLGAAGIMQTIPSLAVLGFMIPIFGIGVKTAIAALFLYSLLPIMRNTYTGIKDVDPATIEAAKGMGMTSMQILFKVELPLAIPIIMAGIRTAAVINVGNATLAAFIGAGGLGDFIFLGITRGIDGLILLGAIPAAILAIALETFFSAVERWTTPKGLR
>NZ_CP015108.1|WP_029055066.1|1011585_1012476_+|glycine/betaine-ABC-transporter-substrate-binding-protein
MKNKFTLLLVTTLLASLLSGCIFNEKDSLRLGSRNNTESIILSNIMGQLIEDRLGVDIIYKENLGGSSVVWNAMTNDHIDVIPDYTGTIVVTYYQEEPGTAEETLAATKRLVAGDNITALGTFGFNNTYTLALDEAKAEELGLVTFSDFAKVSKDFTLGAVFEFIDRPDGLPGFEKEYDIQFKDVKGMDHGMMYRAIGANEVNVINSYTTDGQLAIANLRVLEDDKSYFPPYHALPLVRDETLKEYPELEDILGLLEGQIDEETMQVMNGKVDNDGIMVELVAKEFLEDSGLIEEK
>NZ_CP015108.1|WP_029055067.1|1012651_1013104_-|hypothetical-protein
MSIHFEVKRTIDAPIEETYKGLLDLDAAKNWMQGLVRIERLDVGPMRVGSEWKETRKMYGKEASEHFEVVEMNEPNKIVLRCDGTKGTTGKGEYVFAYTIVPAGSQSEVTLNGEINGLTGVLKLFGKMMAGTFKKACAKDLDSLKHYLEK
>NZ_CP015108.1|WP_029055068.1|1013222_1013594_-|VOC-family-protein
MKLGAFSVSLTVKDIVKSKLFYEKLGFKVFGGDMNQNWVIMKNEGTVIGLFQGMFEENILTFNPGWDENAQNLDSFTDIRAIQRQLKEKGIKLLSEVDETSEGPASFSIEDPDGNTILFDQHR
>NZ_CP015108.1|WP_037562253.1|1013654_1014041_-|DUF1801-domain-containing-protein
MVNKKRNTEEVDQFISDLPKDIKSITTTLRKIILESSPELTEEFKWSMPNYSYTGLVCYLQPAKKHVNLGFHRGNELVAKDENKLLQGTGKTMRHIRIKQLEEIQVEAITLLIKDAISLNENHAIKES
>NZ_CP015108.1|WP_029055070.1|1014227_1014656_-|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein
MAIDVYLTFNGNCRDAVEFYAKVFEAEQPQIMTFGENPPNPDYPLPEEAKNLVMHTRLDIEGSNVMFSDTFPGSPFTVGNNVSLAYHSFDEGKLQKVYDRLKEGGTVEMELQETFWAKLYGKITDKFGVIWQFNLNNEETAY
>NZ_CP015108.1|WP_029055071.1|1014762_1015158_-|VOC-family-protein
MGRVVHFEIHVDDMERAKTFYGEVFGWTFQDWSEYAGMPYYGAVTGDDHEPGVNGALMQRQGPPPERNQALNGYACTMGVANYDSTEEKILSSGGSLAMPKYALPGMAWQGYYLDTEGNIFGIHQPDEDAK
>NZ_CP015108.1|WP_029055072.1|1015453_1015729_-|DUF2564-family-protein
MAKDSGPSWKKDHPGTFFSNSVEKADRAVKQAMSHPEEMAIEHAFNAIERAENAFRNAKQFNEELDMVQQHKGQLDSLKQQLNETQMKKGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP015108_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP015108_3

2014300-2014408

Orphan

Consensus_repeat	Method
CTTGCTTAAGCGCTCATAGTTCGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP015108_3

>merge|NZ_CP015108|3|2014300-2014408|CRISPRCasFinder
CTTGCTTAAGCGCTCATAGTTCGTCCTTATCCGCTCAAAGCAACCTCACAACCGCTCTAACAATCTCCGTGAGCGCTCAAACAGCTTGCTCAAGCGCTCATAGTTCGTC

>NZ_CP015108|3|3|2014300-2014408|CRISPRCasFinder
CTTGCTTAAGCGCTCATAGTTCGTC	CTTATCCGCTCAAAGCAACCTCACAACCGCTCTAACAATCTCCGTGAGCGCTCAAACAG
CTTGCTCAAGCGCTCATAGTTCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP015108.1\|WP_029053369.1\|2013397_2014135_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP015108.1\|WP_029053363.1\|2019496_2020726_-\|dicarboxylate/amino-acid:cation-symporter	unknown	unknown	gnl\|CDD\|366058
NZ_CP015108.1\|WP_029053376.1\|2004396_2005347_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP015108.1\|WP_029053362.1\|2020915_2021335_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP015108.1\|WP_029053378.1\|2002658_2003255_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP015108.1\|WP_029053372.1\|2010126_2011638_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP015108.1\|WP_029053360.1\|2022582_2023527_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP015108.1\|WP_029053373.1\|2008522_2010019_+\|DASS-family-sodium-coupled-anion-symporter	unknown	unknown	gnl\|CDD\|279307
NZ_CP015108.1\|WP_029053375.1\|2005353_2006733_-\|Na+/H+-antiporter-NhaC	unknown	unknown	gnl\|CDD\|188097
NZ_CP015108.1\|WP_029053367.1\|2014973_2016245_+\|kynureninase	unknown	unknown	gnl\|CDD\|130873
NZ_CP015108.1\|WP_029053361.1\|2021347_2022532_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341042
NZ_CP015108.1\|WP_029053366.1\|2016241_2016874_+\|arylformamidase	unknown	unknown	gnl\|CDD\|132080
NZ_CP015108.1\|WP_029053370.1\|2012684_2013401_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP015108.1\|WP_037561645.1\|2003663_2004278_-\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NZ_CP015108.1\|WP_029053359.1\|2023530_2024343_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP015108.1\|WP_037561643.1\|2017754_2019395_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239947
NZ_CP015108.1\|WP_029053374.1\|2006997_2008257_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|225035
NZ_CP015108.1\|WP_029053371.1\|2011873_2012695_+\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270429
NZ_CP015108.1\|WP_029053368.1\|2014535_2014850_-\|MGMT-family-protein	unknown	unknown	gnl\|CDD\|226219
NZ_CP015108.1\|WP_029053365.1\|2016870_2017689_+\|tryptophan-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|188272

Protein	Function_ID	Function_description	E-value
NZ_CP015108.1\|WP_029053369.1\|2013397_2014135_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	3.77613e-149
NZ_CP015108.1\|WP_029053363.1\|2019496_2020726_-\|dicarboxylate/amino-acid:cation-symporter	gnl\|CDD\|366058	pfam00375, SDF, Sodium:dicarboxylate symporter family.	8.59735e-98
NZ_CP015108.1\|WP_029053362.1\|2020915_2021335_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.15705e-14
NZ_CP015108.1\|WP_029053367.1\|2014973_2016245_+\|kynureninase	gnl\|CDD\|130873	TIGR01814, kynureninase, kynureninase. This model describes kynureninase, a pyridoxal-phosphate enzyme. Kynurinine is a Trp breakdown product and a precursor for NAD. In Chlamydia psittaci, an obligate intracellular pathogen, kynureninase makes anthranilate, a Trp precursor, from kynurenine. This counters the tryptophan hydrolysis that occurs in the host cell in response to the pathogen. [Energy metabolism, Amino acids and amines].	2.0007e-165
NZ_CP015108.1\|WP_029053372.1\|2010126_2011638_-\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	4.51839e-38
NZ_CP015108.1\|WP_029053360.1\|2022582_2023527_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.66765e-52
NZ_CP015108.1\|WP_029053373.1\|2008522_2010019_+\|DASS-family-sodium-coupled-anion-symporter	gnl\|CDD\|279307	pfam00939, Na_sulph_symp, Sodium:sulfate symporter transmembrane region. There are also some members in this family that do not match the Prosite motif, and belong to the subfamily SODIT1.	1.52766e-93
NZ_CP015108.1\|WP_029053375.1\|2005353_2006733_-\|Na+/H+-antiporter-NhaC	gnl\|CDD\|188097	TIGR00931, Uncharacterized_Na+/H+_antiporter_HI_1107, Na+/H+ antiporter NhaC. A single member of the NhaC family, a protein from Bacillus firmus, has been functionally characterized.It is involved in pH homeostasis and sodium extrusion. Members of the NhaC family are found in both Gram-negative bacteria and Gram-positive bacteria. Intriguingly, archaeal homolog ArcD (just outside boundaries of family) has been identified as an arginine/ornithine antiporter. [Transport and binding proteins, Cations and iron carrying compounds].	1.04399e-108
NZ_CP015108.1\|WP_029053378.1\|2002658_2003255_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	0.00167968
NZ_CP015108.1\|WP_029053361.1\|2021347_2022532_+\|MFS-transporter	gnl\|CDD\|341042	cd17489, MFS_YfcJ_like, Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.26138e-84
NZ_CP015108.1\|WP_029053366.1\|2016241_2016874_+\|arylformamidase	gnl\|CDD\|132080	TIGR03035, trp_arylform, arylformamidase. One of several pathways of tryptophan degradation is as follows: tryptophan 2,3-dioxygenase (1.13.11.11) uses 02 to convert Trp to L-formylkynurenine. Arylformamidase (3.5.1.9) hydrolyzes the product to L-kynurenine and formate. Kynureninase (3.7.1.3) hydrolyzes L-kynurenine to anthranilate plus alanine. Members of the seed alignment for this model are bacterial predicted metal-dependent hydrolases. All are supported as arylformamidase (3.5.1.9) by an operon structure in which kynureninase and/or tryptophan 2,3-dioxygenase genes are adjacent. The members from Bacillus cereus, Pseudomonas aeruginosa and Ralstonia metallidurans were characterized. An example from Pseudomonas fluorescens is given the gene symbol qbsH instead of kynB because of its role in quinolobactin biosynthesis, which begins with tryptophan. All members of this family should be arylformamidase (3.5.1.9). [Energy metabolism, Amino acids and amines].	2.93793e-88
NZ_CP015108.1\|WP_029053370.1\|2012684_2013401_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	2.3931e-83
NZ_CP015108.1\|WP_037561645.1\|2003663_2004278_-\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	5.19583e-41
NZ_CP015108.1\|WP_029053359.1\|2023530_2024343_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.37701e-35
NZ_CP015108.1\|WP_037561643.1\|2017754_2019395_+\|hypothetical-protein	gnl\|CDD\|239947	cd04506, SGNH_hydrolase_YpmR_like, Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.	1.10859e-19
NZ_CP015108.1\|WP_029053374.1\|2006997_2008257_+\|cytochrome-P450	gnl\|CDD\|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	2.18242e-53
NZ_CP015108.1\|WP_029053371.1\|2011873_2012695_+\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270429	cd13711, PBP2_Ngo0372_TcyA, Substrate binding domain of ABC transporters involved in cystine import; the type 2 periplasmic binding protein fold. This subgroup includes cystine-binding domain of periplasmic receptor-dependent ATP-binding cassette transporters from Neisseria gonorrhoeae and Bacillus subtilis and their related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.68768e-111
NZ_CP015108.1\|WP_029053368.1\|2014535_2014850_-\|MGMT-family-protein	gnl\|CDD\|226219	COG3695, COG3695, Predicted methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	2.28858e-38
NZ_CP015108.1\|WP_029053365.1\|2016870_2017689_+\|tryptophan-2,3-dioxygenase	gnl\|CDD\|188272	TIGR03036, trp_2_3_diox, tryptophan 2,3-dioxygenase. Members of this family are tryptophan 2,3-dioxygenase, as confirmed by several experimental characterizations, and by conserved operon structure for many of the other members. This enzyme represents the first of a two-step degradation to L-kynurenine, and a three-step pathway (via kynurenine) to anthranilate plus alanine. [Energy metabolism, Amino acids and amines].	2.07542e-157

>NZ_CP015108.1|WP_029053369.1|2013397_2014135_+|amino-acid-ABC-transporter-ATP-binding-protein
MISIQGLKKSFGSQEVIKNVDLEIEQGKVVVIIGPSGSGKSTLLRCLNVLETPNGGVLSIDGQKLDFNTSVSKKSISAFRRLTGMVFQSYNLFPHLTTTGNVTEGLTTVKGLSHKEAVKKAELLLDKVGLADHKDKHPFQLSGGQQQRVAIARALAMDPKVMLFDEPTSALDPELVGEVLRVMKDLAHEGMTMAVVTHEMRFAKEVADEVIFIDDGVIVERGAPAEIFNHPKHERTKKFLSLLQV
>NZ_CP015108.1|WP_029053370.1|2012684_2013401_+|amino-acid-ABC-transporter-permease
MYLNTIALSPERIQRFQEIASTSIGPLIEGAIKYTIPLAIIAFSIGLIIAIFTALARISSNKLLRAIARVYVSIIRGTPLLVQLFIIFYGLPTIGITIDPFPSAIIGFSLNVGAYASEIIRAAILSIPKGQWEAAYSIGMNYLQALRKIVLPQAARVSVPPLSNSFIGLVKDTSLAATILVAETFRRAQEIASMNYEFLFVYIMAALVYWVICFILSIIQGRIEIRLDRVVGKSGGLS
>NZ_CP015108.1|WP_029053371.1|2011873_2012695_+|amino-acid-ABC-transporter-substrate-binding-protein
MKKVLLPFMIVLLAAVLVACGGKEESKPNDSAEKPAEQDGLLEEVLANGVLNVGTEGTYAPFSFHDESGKLTGYDVEVTQEVAKRLGVEAKFFETQWDAVFAGLDAKRFDMIANQVGVNEERKAKYEFSQAYTHSNSVLVVREDADIAFDGMEGKKAAQTLTSNYGELAKANGAEIIKIDGFNQGVDLVVSKRVDGTYNDKLSALDYLKQKPDAPIKVVEEEEISEENQSESAFLFRQGNEDLIEEVNKALDAMREDGTLKTISEKWFGEDVS
>NZ_CP015108.1|WP_029053372.1|2010126_2011638_-|APC-family-permease
MDQGSENARRKLNKTLKPSWVFAIALGSSVGWGAFILPGDWIQSSGPLGAVIGLGIGALVMMIIASSYGVMIKKFPVSGGGFTYAFVAAGKVWAFICGWFLSLGYISIVALNASALTLLLKFLAPGFMKQGFLYSVAGWDVYIPEIIVASLLILAFAFINTTGTSISGQIQFYFSVLLVAGVIVLGIFTFAGAEQPLANLQPLFKGNQSIITSILVVLAIAPWAYVGFDNVPQAAEEFNFSPRKATMLIVASLFTSFVIYAIMIGLTSWTYPATANIGNGDLWATGEVVRSALGIGGLGIMAVAIVMGIFTGLNGFFMSSSRLLFSMARARALPNFFREMTANQTPKWGIWFVALITLPTPWFGRQALTWIVDMSSTGVSVAYFFTCLAAFKVLAWGKEEIGREIAPLKKFLALLGMVASGSFLALLLVPNSPAALTTPSYLLLLAWTVVGVIFYTVIRKRYNSLTQDETEYYILGKSIDSEVMDAATVEHDTDLPVPEATRS
>NZ_CP015108.1|WP_029053373.1|2008522_2010019_+|DASS-family-sodium-coupled-anion-symporter
MTTTQEVAPQPEKQKRNLKGLWILLAFAVLITIVLLPNPADLPVVGQRSLAILAFAVILWVTEAVPYPVSAAMILGLAAVLLGLAPNMENPEELLGTKNALRMALAGFSSPAVALVAAALFLATAMQTTNLHKRLALYILSKVGVKTGAIIFGSIVVSIVLAFFVPSATARAGAVVPILLGMVAAFGLPTNSRLGALLVITAVQSVSIWNVGIKTGAAQNMVALGFIEKEFGVSVAWSSWFLYAAPWSILMSIALFFIMKLVIKPETQVVEGGKELIQGQLKELGKIKASELRLIVVAVTLLFLWATEEKLHPFDTTTVTIVAIAILLTPKIGVFDWKTVQQMIPWGTIVVFAVGISMGTLLLDTTGAQWLSDKVFGAIGLDTMPLLATIALLSLFNILIHLGFASATSLSSALIPIFIALATTISLDVNEVGFVLIQQFVISFGFLLPVSAPQNMLAYGTGAFSVKDFLKTGVPLTIIGYLLILLFSATYWQWIGLL
>NZ_CP015108.1|WP_029053374.1|2006997_2008257_+|cytochrome-P450
MQESRPMPKLERKNQTASMIREGYQFLGNRRRGLQSNIFEAHILGEKVICLSGEQAAALFYDTEKFIRKGAMPKRFQETLTGEGGVQSLDGVAHRHRKEAFMSLMSAEKINQLKEMLKDQWERKLNDFEKQQEVNVYSEAQELLLRLACQWAGVPLKEKEVQEKKEAIIQLFESPVTLGYKQWKAKKARQELETWIGGLIKSVRKGDLIPFEGTAMKVFAFHRDEQDELLNEKIAAVEVLNIIRPIVAISIYIAFEVHAMIQHPEHQKRLASEDEKDLQDFVQEVRRLYPFFPFNAARVKEDFKWEGYAFKKGTLTMLDFYGTNHDPTIWNNPEVFDPTRFKDEPITPYNLIPQGGGEFILNHRCAGEWVTIEVMKVSLDYFANRMTFDVPKQDLSYSLVNIPSIPKSKIILKNVRRKD
>NZ_CP015108.1|WP_029053375.1|2005353_2006733_-|Na+/H+-antiporter-NhaC
MFPIKAIHTPTVKASVILTVLIVAMISASIIVFDSVPHVPILFAILLLFGYGLWKKISYKELERGLVEGASSGMSAVFLFFFIGVLVSSWMMGGTIPTLIYAGLQIITPTFFYAIVFIVTAIIGLSVGSSLTTVATIGVAFISMAHILELSLPIAAGAIVSGAFFGDKMSPLSDTTNLASSIVGVDLFEHIRNMGWTTFPAFFISLILFGVLSPNVTSSDFSTIEKYSDALIGTNLIHWYTLVPVAVLIILTFVKVPAILTLAVSALSAIIVAYIHTFYGASEVLSILFSGYEGSTGVAVVDELLSRSDGMEGMMFTISLVLLALSMGGMLFTLGIVQCLLAKIESALRKVSSVILTSALTAIGINVLIGEQYLSILLTGQAFQSSYEKVGLANKNLSRVMEDAGTVINPLVPWSVAGIFITTVLDVPTIAYLPFAFFCLLSPILTVLFGYLGKTLTRI
>NZ_CP015108.1|WP_029053376.1|2004396_2005347_+|hypothetical-protein
MRQDIQMRQNSLQEKRVNQRRLRKRLEQTSEKLLIMKQKRDQLHRQLTKEQQDVVKLGKFSFANKISEWTGRWDEKMKKEIEEAAEVELKYNEAEKDVLDLTAEVEDLRNELEKPDFMHIDEDWEDLLKEKESWIRLNDSVANQTLQKISDDRVRVYSMLREIGEAFEAGEKAERALAGAMKKLDSAEGISMWDTFLGGGIFVSALKYSEINSSDDHVHQAQRALRLYETELMDVQDAATDSFQVNKNDIFTFTDVFFDNIFSDWMVHTRITDGKKKLHAVSQDVRRIQDRLARKRAALEEEIRRLDQQQDDIIMS
>NZ_CP015108.1|WP_037561645.1|2003663_2004278_-|DUF421-domain-containing-protein
MEFDSIWKAVLIIVAGIVLLHISGRKSISQMTVGQTVLMIAVGTLLIQPVANKNLWQTLFLSFILVLTLFFFELFALKWNFFEGILRGRSKIVIENGILKKSTMKKLRLTVDELEMHLRQNGIERIDDVKWATIEMSGQLGYVLIDRKQYATKEDIARLQLLLEDMSKQLELTIPSTPKSTPVIESSNLFTEIEHPTSVPKTLE
>NZ_CP015108.1|WP_029053378.1|2002658_2003255_-|GNAT-family-N-acetyltransferase
MHWYNKLKEYFPIEEMKSQEHMETLLNDKGNVYYKEEGPKHVLMYVETEDFVFVDYLFVSSAARGEGLGKKLLDSLKTKKKPILLEVEPVDEAEPDTEKRLKFYAREEFMHAQKIGYNRRSLATGEQTILEILYWAPPQSSQADEQDVFNAMKTTYEEIHTYKDQDFYGDSYDSTDKVLQYQAKPKKNILEPFTTVSV
>NZ_CP015108.1|WP_029053368.1|2014535_2014850_-|MGMT-family-protein
MEKFTEQAVAIIQAIPPGRVMTYGQVAAEAGNPRGARQISRILHSMSAKYELPWHRIINAQGGISTPENAEGNGETQRERLLAEGVQFNANDRVSLDTYRWHPD
>NZ_CP015108.1|WP_029053367.1|2014973_2016245_+|kynureninase
MSSNTLEFAKVLDQQDSFAPYREEFYLPLEKIYMDGNSLGLLSKRAETKLFELVDTWKTLAIDGWTEGMHPWYYMAEQIGDRMAPLVGGKKSEVIATGSTTTNLHQMVSTFYRPLGKRTKLLADELNFPSDIYALQSQIRVQGLDPEEHLIRVKSEDGLTLDEKRIIEAMTEDVALIVLPSVLYRSGQVLDMKTLTQAAKERDIIIGFDLSHSVGSVPHALHEWDVDFAFWCTYKHLNGGPGSVGGLFVNERHFGKKAGLAGWFGSDKTKQFDMNHTMTAATDAGAYQIGTPHILSLAPLLGSLEMFEELGMERIREKSLKLTSFMLSCIDNELGEYSFGIGNPLDDSRGGHLLLQHKEAARICQALKAQGVVPDFRAPDGIRLAPVALYNSFEDVWQTVQILKKIMQEDVYKQFSNERGVVA
>NZ_CP015108.1|WP_029053366.1|2016241_2016874_+|arylformamidase
MTKQWIDITQPLNQRIAEWPGDTPFAYEVAVSKEQSGSVNIGKLTMSTHIGTHTDAPFHYDDGGLKILDLPVDLYIGKACLVDVTGVSCVTRADLEAFDFDGAERLLVKTGSHPTPTKFPENFTVIGEDVGPLLKERGVRLIGVDTPSVDSETSKDLLGHHSLYRNDVIIIENLVLHSLEVGNYELIALPLALEDADGSPVRAVVRRLQS
>NZ_CP015108.1|WP_029053365.1|2016870_2017689_+|tryptophan-2,3-dioxygenase
MKEKGIHTDFRDSMTYSEYLHLDQVLSSQKRLSGHHDEMLFIIIHQVNELWMKLILHELETAIELIQQGELPEAFKMLARVSKVQTQIIQAWDVLATLTPAEYMEFRDSLGKASGFQSYQNRLIEFALGYKQPQIIKIYEKDNELSKRLAKAYEAPGIYDVAIQALARAGFDIKADLLTRDFSITYKGDPSVAAAWLEVYRDVDRYWDLYQLAEKLVDIEDSHQQWRFRHMKTVERIIGFKQGTGGSSGVHYLKSVLDHRFFPELWDVRTKI
>NZ_CP015108.1|WP_037561643.1|2017754_2019395_+|hypothetical-protein
MTKKSISYVVMAFALVVQIAVMPLQASAADPEKAPTWISPINYLALGDSLAAGVTPNNELGKGYTDFLAEELAKSEDLQASNKGFSYPGYKTDDVLRDFEMDVTKPIVGIGHSDKTATLHQSVKEAHLITLTIGANDVLPKFTFDDKGTPQFNSEELQAAIMKVGMNTQKILDKIYQLNPNAQVYIMGYYNPFPYLSPQNQPLVNQLVVTLNDAIKQGMTGTTAQFVDTSKQIAEDPYTYLPNPENIHLSQAGYKVVMEAFRKSLMENYSWFAKDVLTVTAKDSTTVELNWKPVIDTGMVSMYQVYTGDKMVGEVMSPVLSYEITDLEPNKEYHFSVHAVNQNGKKSMQHLNTKYTIDQEPVEPTVMFTDITNHWAKDVIEVAAMKGIVSGYADHTFRPDTSLTRAQAMSIIVRALDLKSKSTKSAFTDLADYADSTKRDIQAAYDYGLVSGVNGHFMPNKPITRAQLALVLSRTYEIATGKPFTPTVAAPFTDIKKFSKDTQWAIAGLYQMNIATGDNGKFMPNDSTTRAHAAKMIVHSMEAIAQ
>NZ_CP015108.1|WP_029053363.1|2019496_2020726_-|dicarboxylate/amino-acid:cation-symporter
MPIWNKYKNTPFVAKITIGFIAGTLLGIFFNEYTTFLKPFGTLLLNLLSLIAIPVIFLTVVLAVNQMNLAQLGKMGGKLILYYTATTAAAVLIGLSLAMWLKPGRHLTLPTDAVVEPPHAPGFSEILLQIVPKNIFEAFTSGDLMAILFVAIIIGMAMSSMKFSKDTKLVEMGDFLDRFFNALNTMFYKILEGVLLYAPIGVFAISATAFGEQGWETLLGLLSFVGVFYLGVLILWLFVYSGFLKFFGNPVLPFYRNTKDAYTTAFFTSSSIATLPIAIESAKKAGVSENTANFALPLGAVFNSDGGALRMGISLVFAANITNLNLSAVDFIVIIAIGTLLSIGTAGVPAAGLVTLSAVLTMFGLPLEIVALIAGVDALIGMAGTASNVMGDIVGAAVVDKKTPRKKFA
>NZ_CP015108.1|WP_029053362.1|2020915_2021335_+|MarR-family-transcriptional-regulator
MQQTQQFFPEYVQLYRPLLNRLNNLLAPYQLFHSQWGILKLLWLDGEMTSAEIALRRQVEKPSVTKIVQRLLEMGLVSIRPGTDRREKWIGLTEQGQATVVNVMADLEVFYDNLLEGATVEDLEAGIRVLKIANKNLHK
>NZ_CP015108.1|WP_029053361.1|2021347_2022532_+|MFS-transporter
MNNSKIWTKDFIVTSVINFFLMLVMYLLIVTIAPYAVKEYGVSTSVAGLVSGIFIIGTLIARLAVGGLIEKVGSRNILLIGLLVTVLASVFYFGAVNLPLLMANRFFHGVGLGISSTATGTMVAQMLPPSRRGEGIGYFSLSTVLATAIGPFFGIFLSQHYHFNILFMFCLVLSISCAAMFFFVERKPTVLPKKNVQTTTKKFGVHGLLEVRALPIAFVTLLAAIAYSGVLSFISFYAEEINLVSAASFFFLVYAIAVLLSRPYTGRLLDVKGNKFVVYPSLLLFAAGLLLLSGANAGWMLLLAGGVLGLGFGNFQSSAQAIALQGVKPERLGVATSTFFIFLDFGFGFGPYVLGLLVPIIGYQHLYLVLMVIVLFALGFFMLFSRTRQRLIVE
>NZ_CP015108.1|WP_029053360.1|2022582_2023527_-|GGDEF-domain-containing-protein
MDEQMDLLPCGYFVLTSEWEFVEMNKTMREILRLDKMPRHMHDVLTVPSKVYFQTYFVPSISMHQEIREMYLNFKVVNRTLPVLMNVSKRNGLYEGIVVPITVRDEYENQLLKSKKEAEKIQQQTDEAYNKLLGLLEEVEYKQQQLQDLNGELQELATRDELTGLYNRRVFRRNLDAAINRAELFMTRSFSLLMFDIDHFKTVNDTHGHLVGDDVLREVARKLKYKIYSPHLVARIGGEEFAVLFDDPNHQKNCERAEELRCYIEKSEWNSIGITVSMGITNFRKGDQSSHIYGRADDAQYASKRNGRNCLTRI
>NZ_CP015108.1|WP_029053359.1|2023530_2024343_-|alpha/beta-hydrolase
MTIDIKKRNAVHITGSGEQTIVFAHGFGCDQTVWNHVVPAFEKQYRIVTFDYVGSGQSDKTAYSAERYASLPGYAQDVIEVCEALELKDIIYVGHSVSGMIGVLASIQRPDLMEKLIMIGPSPHYLNETDYHGGFEREDIDELLDMMEMNYKEFTKYLAPIAMKNEDRPHLSEEFESMLCTNDPGIARRFAEATFMSDVREELPKVPTRTLILQPTEDSIVPMEVGHYIKEHISDSELVIMKAKGHNPHISHPTETIDEITRFIEEDRSV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage