CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP020590	Acinetobacter baumannii strain 15A34 chromosome, complete genome	1 crisprs	DEDDh,WYL,cas3,csa3,RT	0	0	7	0
NZ_CP020589	Acinetobacter baumannii strain 15A34 plasmid p15A34_1, complete sequence	0 crisprs	NA	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020590_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020590_1

2129762-2129847

Orphan

Consensus_repeat	Method
CCAGCTTCACGAGCCTCTTCTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020590_1

>merge|NZ_CP020590|1|2129762-2129847|CRISPRCasFinder
CCAGCTTCACGAGCCTCTTCTGAGGTAAATTCATGTGCGTTACCACTGGCATGTGCAGCACGGCCAGCTTCACGAGCTTCTTCTGA

>NZ_CP020590|1|1|2129762-2129847|CRISPRCasFinder
CCAGCTTCACGAGCCTCTTCTGA	GGTAAATTCATGTGCGTTACCACTGGCATGTGCAGCACGG
CCAGCTTCACGAGCTTCTTCTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020590.1\|WP_001136759.1\|2137694_2138123_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_000107128.1\|2120045_2121005_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381147
NZ_CP020590.1\|WP_001990047.1\|2124631_2126278_+\|allantoin-permease	unknown	unknown	gnl\|CDD\|224374
NZ_CP020590.1\|WP_000983628.1\|2130478_2130892_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_000132044.1\|2136983_2137301_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_000432330.1\|2131033_2131912_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187613
NZ_CP020590.1\|WP_000376215.1\|2126336_2126792_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP020590.1\|WP_000108365.1\|2136656_2136878_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237171
NZ_CP020590.1\|WP_002017921.1\|2119394_2119508_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_000795915.1\|2128524_2128761_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_000482091.1\|2135892_2136372_+\|CinA-family-protein	unknown	unknown	gnl\|CDD\|224463
NZ_CP020590.1\|WP_001124846.1\|2127630_2128242_-\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP020590.1\|WP_000498477.1\|2137385_2137607_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_001145693.1\|2134167_2135577_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP020590.1\|WP_156878064.1\|2121001_2124466_-\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP020590.1\|WP_000885229.1\|2126948_2127560_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP020590.1\|WP_000251637.1\|2138392_2138536_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020590.1\|WP_001990041.1\|2131968_2134113_-\|catalase-HPII	unknown	unknown	gnl\|CDD\|236886
NZ_CP020590.1\|WP_001025680.1\|2119617_2119902_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379642
NZ_CP020590.1\|WP_000937460.1\|2118670_2119306_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836

Protein	Function_ID	Function_description	E-value
NZ_CP020590.1\|WP_000107128.1\|2120045_2121005_-\|response-regulator-transcription-factor	gnl\|CDD\|381147	cd19920, REC_PA4781-like, phosphoacceptor receiver (REC) domain of cyclic di-GMP phosphodiesterase PA4781 and similar domains. Pseudomonas aeruginosa cyclic di-GMP phosphodiesterase PA4781 contains an N-terminal REC domain and a C-terminal catalytic HD-GYP domain, characteristics of RpfG family response regulators. PA4781 is involved in cyclic di-3',5'-GMP (c-di-GMP) hydrolysis/degradation in a two-step reaction via the linear intermediate pGpG to produce GMP. Its unphosphorylated REC domain prevents accessibility of c-di-GMP to the active site. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	6.21476e-55
NZ_CP020590.1\|WP_001990047.1\|2124631_2126278_+\|allantoin-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	9.5172e-23
NZ_CP020590.1\|WP_000432330.1\|2131033_2131912_+\|glucose-1-dehydrogenase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.69173e-160
NZ_CP020590.1\|WP_000376215.1\|2126336_2126792_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	8.76675e-40
NZ_CP020590.1\|WP_000108365.1\|2136656_2136878_+\|hypothetical-protein	gnl\|CDD\|237171	PRK12678, PRK12678, transcription termination factor Rho; Provisional.	5.30417e-06
NZ_CP020590.1\|WP_001145693.1\|2134167_2135577_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	1.51279e-18
NZ_CP020590.1\|WP_000482091.1\|2135892_2136372_+\|CinA-family-protein	gnl\|CDD\|224463	COG1546, CinA, Uncharacterized protein (competence- and mitomycin-induced) [General function prediction only].	5.88094e-21
NZ_CP020590.1\|WP_001124846.1\|2127630_2128242_-\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	2.36027e-39
NZ_CP020590.1\|WP_156878064.1\|2121001_2124466_-\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	3.42506e-57
NZ_CP020590.1\|WP_000885229.1\|2126948_2127560_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.70108e-23
NZ_CP020590.1\|WP_000937460.1\|2118670_2119306_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	2.9036e-64
NZ_CP020590.1\|WP_001025680.1\|2119617_2119902_-\|N-acetyltransferase	gnl\|CDD\|379642	pfam14542, Acetyltransf_CG, GCN5-related N-acetyl-transferase. This family of GCN5-related N-acetyl-transferases bind both CoA and acetyl-CoA. They are characterized by highly conserved glycine, a cysteine residue in the acetyl-CoA binding site near the acetyl group, their small size compared with other GNATs and a lack of of an obvious substrate-binding site. It is proposed that they transfer an acetyl group from acetyl-CoA to one or more unidentified aliphatic amines via an acetyl (cysteine) enzyme intermediate. The substrate might be another macromolecule.	1.0722e-24
NZ_CP020590.1\|WP_001990041.1\|2131968_2134113_-\|catalase-HPII	gnl\|CDD\|236886	PRK11249, katE, hydroperoxidase II; Provisional.	0

>NZ_CP020590.1|WP_000795915.1|2128524_2128761_+|hypothetical-protein
MKNQRDAVLGYADEQHAYYIRLIENDAVLGESYGIFCENPESEAAESIMTTLFLKKSFWLNGSEFTDIVKGLHPLTHS
>NZ_CP020590.1|WP_001124846.1|2127630_2128242_-|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MPKKKEFEHGGARENAGRKAQFNEPTKVIRVPESQVNFIKNWLLNNVKTNNQTDFTSKLKIQQVHPNNDKIYHIPLATERVAAGFPSPAQDDIEQALDLNEYLIRNENATFIVKANSLSMLDAGIDIDDPLIVDRSIPAKSGDIVIALIDNDFTVKRLMIDTQFHPPKVWLKAENPDYQNIYIEEGQELVIWGVVTYNLKRMR
>NZ_CP020590.1|WP_000885229.1|2126948_2127560_+|LysE-family-translocator
MAFNIFIAFWSVSILFIITPGADWAYAISAGIKGKVVVPAVAGMLFGHFITILLVAAGVGLLVANNPTALMILTVAGSAYLLWMGINLLLTPPTPNESGSEKAQSWLRWATKGVYVSGLNPKVFLLFLALLPQFIDTTASWSVTTQILAFGVVHIISCAIIYLMVGYGSEAILKTRPQAAQLVGRFSGGLMVVIATCLLIGQI
>NZ_CP020590.1|WP_000376215.1|2126336_2126792_-|Lrp/AsnC-family-transcriptional-regulator
MDRTDKKILAELQLNGRLSITELAEKVGLSISPCHRRVKALEESGAIKGYRAELDPNLVGFEFSAIVFITLKEGDKQAVEKFENAVIEIPQIIQAQRLFGEPDYLLHVVARDLPAFQRLYDEKLSAIPSVQRLISTIVMKDVVPERLFPIG
>NZ_CP020590.1|WP_001990047.1|2124631_2126278_+|allantoin-permease
MTENDWEIDVMSVSEHPNLDTVQGADSQKAVNETLEDYTLRYAPHSFRRWSPKVVAITALGGIAYLADFSIGASIGMSYGTTNAVFSILFAAIIIFLTGIPLAYYAARYNIDLDLITRGAGFGYIGSVLTSIIFASFTFIFFALEGSIMAQGLLLGLGIPLWAGYLISTVMVIPLVIYGMKALSKLQVWTTPLWLVLMIGPVAYLIYQEPTLVSQFATFTGHEGFAPVDMAAIMLGAGICLSLIMQIGEQIDYLRFMPAKTKENSKAWWAAVISAGPGWVILGAIKQIIGAFLGFYLLTKIPGVNSTEPVQQFNAAFHDMLPGWAALTLAVILVVISQIKINVTNAYSGSLAWTSAYTRISKHYPGRIVFVIVNLAIALALMEGNMFAVLGKILGFYSNFAIAWVVVVATDISINKYVLKLSPKEPEYRRDMLYNVNPVGMVAFLVSAGLSIAAFFGLLGSFLAPYSPIIALVLAFVLTPIMGLLTKGKYYIKSHDDGVKEPRYDAEGTPVATVYHCRVCEQGYERPDIMFSHKHNGTICSLCKTLDA
>NZ_CP020590.1|WP_156878064.1|2121001_2124466_-|response-regulator
MSVMPDTSRPQQAPQRVIKTRREYNIWVADESIEDYALRYAPTSVRKWSPWTVTNTAISTVSFLAMEAIGATMLWQYGFSNALWAAIVVCTIIFLTSWPISYYAAKYNVDVDLLTRGAGFGYIGSTITSLIYASFTFILLAFEAAIMAMALELALGIPQVIGYLISALVILPLVVKGIGFINKVQAVTQPIWLLLLLLPWFFVLWKQPQILSSSLHFVGAVSNSTDFNLYYFGAACTLIFSFVIQIGEQADYLRFLPQKEKNRTAWRFAVFLGGPSWIIFGFLKVLMGMLLMVLAFQLFIPVSELDNPTYLYWVAYQQFIPNPQLALILTLALVCLAQIKINMTNAYAGSLAWSNFFARLTHSHPGRIVWLLFNVFIAIVLMEMGISHAVERILGLYSNIALAWIGAVVADLIICKPLGLSPKGIEFRRAYLYDINPVGVGALLIASVLSMLSYLGFFGLMAKGLASFIALGSAVLCVPVIAYLTTGKYYIARQPEKIQATLVANCVVCERDYELADMAGCPAYNGTICSLCCSLEARCHDLCKPDARWSVQLKKAIWHYLPERWASRLNSRVSLYLLLTLGLSIVLAVSLSLVCIQEKTYLETINAAAVPQLFTLFVKIYTILFLLMSVAAWWLVLNDESRRNAEIETHQQTALLIDEIAAHEVTSKDLQDARIAAERANDAKSRYVIGISHELRTPLNSILGYSQLLQKQEQLSEQGKMALGVISRSGQHLTSLIDGLLDLARIETGKISLNVVDVHFPNFIEQIIQMFQPQFEQKNLQFVYEIGENLPHYVRTDKKRLEQVLINLLGNALKFTTSGTITLKVEYRFQTAYFEIRDTGCGIAEADLERIFNPFERGSNVVQGGFTGIGLGLPIVKLLVDLLGGQLSVTSQLNQGSQFKIKFYLPSKEVVHPISNVYSNQITGYQGERKRILVVDNEAVDRGLVANFLKPLGFMIEEAESGIDCLRRVPIFQPNLILMDLNMPLMGGWETARLLRQNNITNVPILIISANAGEREVNPQDAVLSEDFMLKPIDLNLLLSKIGDKLGLVWIDSKSETLLENNEVQALDLNIYKQEQVAVHTLIQQPENNELLDFPQSLQQLNDLIGQGYIRGIQQTLTQCRQNFPKHNELWEQLEQAIQKFDLKHAQRLIQDKQ
>NZ_CP020590.1|WP_000107128.1|2120045_2121005_-|response-regulator-transcription-factor
MSTQHVSFQQASPNEQAVILIVDDVPENLGLLHESLDQAGYRVLVTTDGLSAIEIAHRCLPDMILLDGNMPHMDGFESCIQLKASPITQFIPVIFMTGLSETEHIVRGFQVGGVDYVTKPLNIEEVLARVKTHLAHAKLLQQQKQVIDATETAILALDVHGKIVWKTQKASDLLNQYLPELEGFEAGLKAWFSDLEHEKDPKKLTSCSYSTPSQQLQLLLLTPWETEPSVAKNYLIQIKTSTPALEMADILKYCPQLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAHINSLVQEFH
>NZ_CP020590.1|WP_001025680.1|2119617_2119902_-|N-acetyltransferase
MNIQQKDDTKHGSFSLLDGETVAGEMTYTWAGESMLIIDATDVNENYRGQGVGRQLLDALVAFVREKDVKVIPLCPYAKSVFDKDPSIGDVLRK
>NZ_CP020590.1|WP_002017921.1|2119394_2119508_+|hypothetical-protein
MCNKFIFFPIGLKLFLLDKLFYKFDKFDLAIENLQIS
>NZ_CP020590.1|WP_000937460.1|2118670_2119306_-|amino-acid-ABC-transporter-permease
MLPQFFSATLTTLKISIISIILAIIVGLICSILITYHVRVLNRIAQFYIELSRNTPLLIQLFFLYYGLPKLGIKIDGFACGVIGLTFLGGSYMAEAFRAGLQSVAKGQIDSAKSIGLKPTQIFRYVIFPQALAISIPAIGANCLFLIKESSVVSAIAVVELLFVTKDLIGMDYKTTEALFLLIMAYLIILLPVSILTSYLEHRSRKVSHGT
>NZ_CP020590.1|WP_000983628.1|2130478_2130892_+|hypothetical-protein
MMQPTHTHSTLQYIHISVPEILLSNIQIKNSWQDYNQEWSYRLDPPHASHPFQRDLYIIKSKNIETEDIKKILDNIVVKNSKNKDDLKNIVEAETVIKEILDLSNYIPIENWLNDTGNRSIVESMIDKNKVKLLDII
>NZ_CP020590.1|WP_000432330.1|2131033_2131912_+|glucose-1-dehydrogenase
MENTTNQYPSEVPAQVQPHQPGDQEKMHPEPEIIKASHKGSEKLKGKVAVISGGDSGIGRSVAVLFAREGADIAVLYLKEDQDAEITKQLIEKEGQQCLLLKGDISDPDLAKQNIDKVLQHFGKINILVNNAGVQYQQKEIESISNEQLEKTFKTNIFTMFYLTKEAIPYMEEGDSIINTTSITSYQGHDELIDYASTKGAITSFTRSLSNNLMKQKKGIRVNGVAPGPIWTPLIPSSFDAETVEKFGKDTPMGRMGQPSEVAPAYLFLASDDASYITGQVIHVNGGQIVNG
>NZ_CP020590.1|WP_001990041.1|2131968_2134113_-|catalase-HPII
MDMNDNTKSTNKTSEMAGADAANKANTTQKTEQLDTVRDDATNEALTTNQGVKIADNQNSLRAGIRGSTLLEDFILREKITHFDHERIPERIVHARGVGAHGYFQAYEGNERLTKAGFLTDPTIQTPIFVRFSTVQGPRGSADTVRDIRGFAIKFYTQEGNFDLVGNNAPVFFVQDGIKFPDFVHAVKPEPDTEIPTGATAHDTFWDFVSLVPESAHAVIWAMSDRAIPRNLRSIQGFGVHTFRLINAEGKSHFVKFHWTPKQGLSALVWDEAQKLAGKDPDFHRRDLYEAIEHGFYPEWELGVQIVEEEDEMNFDFDLLDPTKIIPEELVPVTPIGRFVLNRNVDNFFAETEQVAFCPGHVVPGIDFTDDPLLQARLFSYTDTQLSRLGGPNFHQIPINKPVCPFHNNQRDGIHQHTIHKGQAAYQPNSIDGNWPVETPPAASNGGFESYPEKISGHKLRQRSETFSDYFSQPRLYYKSLAPHEQKHVVDAYTFELSKVQRKHIRERQVQQILANIDLDLARQVGANLGIEVPDLTLSYKKTAVEKSAKLSFLAFPPEDIQGRKVAVLIHNMVKSDALEAIKNWAIKEGVILHLLAPSLAPVKDHKDNVIVADGMQMSEPSIAYDAVIIPDGDNLNTVMQDGVARHYLLEAYKHLKPIVFLGNKSDLLEPLGLVADEGTLIEDEFQHVAEKFKNLIKAHRVWSREQIAAHVPA
>NZ_CP020590.1|WP_001145693.1|2134167_2135577_-|iron-containing-redox-enzyme-family-protein
MPVVVKKRLLDLLQDNQQNYYELFVFFLDPDVSSFEKEKKARDFLVKEIDKLEMKEIDFPSDINLIKAWCENDNKKNCQEFQAYLNRRQSGQDREYFKNVAQAFEFLIKVSPTKKVDGAWLYSSVHYWNDPIFHELIITYLEELGLGEPKANHVCIYDDLLRSLGLDSFDLLLEDEYYHQAVVQLALGYAPPEFIPEIVGFNLGYEQLPLHLLISNYELAELGIDSKYFNLHITIDNIDNGHAYKAIKVIEDIYNQYRDKELFLTKLKRGFALNNHGVSSSNIIKNLNTEDFVHRIFKRKALVGQLIHNETRQFGCKTINQWLSNPDDIAGLITHLTEHKWIKFNTDPEQSVFWRMINEENGKMFGVFNPVERQIIHDWIAGSDHSSSFLAYSRELKNSQRIQDYLFSYISDGELDALQERVQQSSDLAIKICKLTPFLAPDSHHKSIGLWSTRKYVELLFPYLGTFKN
>NZ_CP020590.1|WP_000482091.1|2135892_2136372_+|CinA-family-protein
MFNKCCELLAKEKIKIAFFESASAGYLAYRFSLSPYSGDILIGSLVSYDLRVKENTLHISEELIEKYTAESMQVTVEMINKGKELLHADLYVACTGLLKKGGSETPEKPVGTFFYSIYYKNNFYNFRRVLRGPAFLKLRKLIYYVTQDIKLIILEDKRR
>NZ_CP020590.1|WP_000108365.1|2136656_2136878_+|hypothetical-protein
MSTTNNQANQRNNQQQQQQQNDNRNQQQHGNQQQNDQQQQNNQQQQQNDNRGQQQGSNQKDSGQQNSNNNQQR
>NZ_CP020590.1|WP_000132044.1|2136983_2137301_+|hypothetical-protein
MTDQNTDHAQLVAGDHNYSDSRWRESYLTRPYYQEAQLTTPDLDYDRDFSAAYELGHRARSESKEGTQFEDMEGSLQQKWEELKAESRLKWEHAKQAIKDAWDDI
>NZ_CP020590.1|WP_000498477.1|2137385_2137607_-|hypothetical-protein
MFVYFTDGTCINDSEIYGVKAKYEQNKYVVEVTIKPTHVLATTPSVQFKKEVFDDPNLANQYLSHNFNMPPFF
>NZ_CP020590.1|WP_001136759.1|2137694_2138123_-|hypothetical-protein
MPQYLKIAEKIYQNVKEKKGFTDDPMEDLNNLMIELRQEIKGTKLKLLYNYIDFAEILIKPLQESKIKLDLSLIPKSKNTQEFVLWLAGFIERITTGGQEKLPPIRAKITLPAYAYEETYPSQKKPVNNGEEIIEYFKKNQS
>NZ_CP020590.1|WP_000251637.1|2138392_2138536_-|hypothetical-protein
MVRIFCAVSMVLAIAMGMSACQDRNSRNDGMHEASDPATSHDMNKNS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

182978 : 265033

uncultured_Caudovirales_phage(22.22%)

tRNA,integrase,transposase

attL 186105:186164|attR 214944:225625

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000736396.1\|182978_183689_+\|transposase	heteromeric transposase endonuclease subunit TnsA	I6WI48	Vibriophage	4.1e-06	29.3
WP_000573060.1\|183689_185600_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002020149.1\|185604_186243_+	TniB family NTP-binding protein	NA	NA	NA	NA
186105:186164	attL	NA	NA	NA	NA
WP_000529372.1\|186617_186989_-	hypothetical protein	NA	NA	NA	NA
WP_001095006.1\|187061_187361_-	hypothetical protein	NA	NA	NA	NA
WP_000034564.1\|187428_188280_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	8.2e-70	45.9
WP_001277980.1\|188292_189759_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.3e-213	79.6
WP_087486612.1\|189762_190853_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_001046004.1\|190958_191780_+	carbapenem-hydrolyzing class D beta-lactamase OXA-23	NA	NA	NA	NA
WP_001992510.1\|192444_192999_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_000262332.1\|193006_193339_-	hypothetical protein	NA	NA	NA	NA
WP_087486612.1\|193440_194530_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_001144964.1\|194888_196685_-	hypothetical protein	NA	NA	NA	NA
WP_000370460.1\|196971_197553_-	hypothetical protein	NA	NA	NA	NA
WP_000157684.1\|197573_198737_-	hypothetical protein	NA	NA	NA	NA
WP_000192314.1\|198821_200324_-	zeta toxin family protein	NA	NA	NA	NA
WP_001085038.1\|200324_200552_-	hypothetical protein	NA	NA	NA	NA
WP_000886984.1\|200652_201585_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	1.7e-23	28.8
WP_083040601.1\|201791_202109_+	hypothetical protein	NA	NA	NA	NA
WP_000798673.1\|202154_202511_+	hypothetical protein	NA	NA	NA	NA
WP_000168733.1\|202564_202834_+	hypothetical protein	NA	NA	NA	NA
WP_000736393.1\|203145_203856_+\|transposase	heteromeric transposase endonuclease subunit TnsA	I6WI48	Vibriophage	5.3e-06	29.3
WP_000573066.1\|203856_205767_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_085940413.1\|206188_207279_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_001043260.1\|207371_208187_+	sulfonamide-resistant dihydropteroate synthase Sul2	NA	NA	NA	NA
WP_000251875.1\|208273_208576_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_071543477.1\|208469_208763_-	hypothetical protein	NA	NA	NA	NA
WP_000736396.1\|208967_209678_+\|transposase	heteromeric transposase endonuclease subunit TnsA	I6WI48	Vibriophage	4.1e-06	29.3
WP_000573060.1\|209678_211589_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_000417085.1\|211593_212514_+	TniB family NTP-binding protein	NA	NA	NA	NA
WP_000081835.1\|212543_213659_+	TniQ family protein	NA	NA	NA	NA
WP_002017214.1\|213651_215082_+	hypothetical protein	NA	NA	NA	NA
WP_000529372.1\|215456_215828_-	hypothetical protein	NA	NA	NA	NA
WP_001095006.1\|215900_216200_-	hypothetical protein	NA	NA	NA	NA
WP_000034564.1\|216267_217119_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	8.2e-70	45.9
WP_001277980.1\|217131_218598_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.3e-213	79.6
WP_087486612.1\|218601_219692_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_001046004.1\|219797_220619_+	carbapenem-hydrolyzing class D beta-lactamase OXA-23	NA	NA	NA	NA
WP_001992510.1\|221283_221838_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_000262332.1\|221845_222178_-	hypothetical protein	NA	NA	NA	NA
WP_087486612.1\|222279_223369_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_001144964.1\|223727_225524_-	hypothetical protein	NA	NA	NA	NA
WP_001089073.1\|225606_226824_-	tetracycline efflux MFS transporter Tet(B)	A0A2H4UVM2	Bodo_saltans_virus	3.0e-09	24.4
214944:225625	attR	NA	NA	NA	NA
WP_000088605.1\|226905_227529_+	tetracycline resistance transcriptional repressor TetR(B)	NA	NA	NA	NA
WP_000512977.1\|227506_227911_-	hypothetical protein	NA	NA	NA	NA
WP_001120888.1\|228148_229642_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000743213.1\|229852_230077_-	hypothetical protein	NA	NA	NA	NA
WP_000480968.1\|230196_231033_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001082319.1\|231032_231836_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
WP_001144971.1\|232218_234006_-	hypothetical protein	NA	NA	NA	NA
WP_000010465.1\|234088_234946_-	ATP-binding protein	NA	NA	NA	NA
WP_000894500.1\|235011_235239_-	accessory factor UbiK family protein	NA	NA	NA	NA
WP_000780326.1\|235518_235857_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_000738520.1\|235914_237312_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	5.4e-34	31.2
WP_000543541.1\|237469_237928_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_001292506.1\|237943_239029_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-48	36.6
WP_001083669.1\|239025_240318_+	DNA adenine methylase	A0A0P0BWH0	Ostreococcus_mediterraneus_virus	2.5e-38	32.6
WP_000493866.1\|240360_241020_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.5e-34	38.6
WP_000354154.1\|241079_241298_-	hypothetical protein	NA	NA	NA	NA
WP_001988710.1\|241428_242067_-	hypothetical protein	NA	NA	NA	NA
WP_001151592.1\|242105_242513_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_000673449.1\|242505_243954_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	5.5e-50	36.4
WP_000586912.1\|244097_245198_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_000881094.1\|245197_246268_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_000128749.1\|246393_247941_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_000942504.1\|247956_249141_+	peptidase S41	A0A0R6PIZ1	Moraxella_phage	8.3e-12	23.0
WP_000840549.1\|249144_250566_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_002001070.1\|250590_252114_-	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.3e-06	26.3
WP_000633799.1\|252169_252805_-	response regulator	NA	NA	NA	NA
WP_003384760.1\|253017_254064_+	D-alanyl-D-alanine endopeptidase PBP7/8	NA	NA	NA	NA
WP_000063593.1\|254170_255310_-	threonine synthase	NA	NA	NA	NA
WP_000805827.1\|255365_256667_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_000011159.1\|256911_257727_-	DsbC family protein	NA	NA	NA	NA
WP_000608730.1\|257873_258794_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	6.7e-33	30.7
WP_001991212.1\|258937_259201_+	ferrous iron transport protein A	NA	NA	NA	NA
WP_001278225.1\|259197_261051_+	ferrous iron transporter B	NA	NA	NA	NA
WP_000942498.1\|261071_261323_+	hypothetical protein	NA	NA	NA	NA
WP_000908243.1\|261483_262830_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000907680.1\|262854_264051_+	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_000216739.1\|264100_265033_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA

DBSCAN-SWA_2

1085832 : 1098180

Acinetobacter_phage(95.65%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000004579.1\|1085832_1086555_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	1.7e-55	88.2
WP_000147323.1\|1086551_1086959_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	7.5e-13	52.2
WP_000654846.1\|1086959_1087211_-	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	6.4e-39	100.0
WP_000698529.1\|1087212_1088145_-	hypothetical protein	A0A0P0I438	Acinetobacter_phage	2.2e-137	80.0
WP_001207474.1\|1088141_1089263_-	ATP-binding protein	A0A0N7IRE0	Acinetobacter_phage	2.8e-211	99.5
WP_000064463.1\|1089274_1089598_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	4.8e-55	95.3
WP_000656405.1\|1089590_1089881_-	hypothetical protein	A0A0P0IDU2	Acinetobacter_phage	5.1e-48	95.8
WP_001101038.1\|1089880_1090324_-	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	1.7e-71	94.5
WP_000051960.1\|1090517_1090760_+	hypothetical protein	A0A0P0I4B0	Acinetobacter_phage	5.2e-38	100.0
WP_000845537.1\|1090766_1090970_-	hypothetical protein	A0A0P0IKZ8	Acinetobacter_phage	1.2e-27	100.0
WP_001129676.1\|1091108_1091612_-	hypothetical protein	A0A0P0I896	Acinetobacter_phage	1.1e-77	100.0
WP_000048052.1\|1091613_1092621_-	hypothetical protein	A0A0P0IY33	Acinetobacter_phage	2.9e-183	100.0
WP_000370485.1\|1092672_1092888_-	hypothetical protein	A0A0P0IKK4	Acinetobacter_phage	9.4e-31	98.6
WP_000052252.1\|1092902_1093655_-	LexA family transcriptional regulator	J7I4M9	Acinetobacter_phage	5.5e-102	74.3
WP_000703023.1\|1093759_1093948_+	hypothetical protein	NA	NA	NA	NA
WP_000048916.1\|1093958_1094279_+	hypothetical protein	A0A0P0HSE9	Acinetobacter_phage	1.2e-42	87.7
WP_001180660.1\|1094340_1094613_+	hypothetical protein	J7I0V3	Acinetobacter_phage	7.2e-36	90.0
WP_000602535.1\|1094684_1094909_+	hypothetical protein	A0A0P0I444	Acinetobacter_phage	3.2e-34	97.3
WP_000064627.1\|1094901_1095783_+	replication protein	A0A0P0IKQ2	Acinetobacter_phage	3.3e-138	95.2
WP_001003671.1\|1095785_1096586_+	hypothetical protein	A0A0P0IDV1	Acinetobacter_phage	2.8e-144	95.5
WP_000647826.1\|1096582_1096921_+	hypothetical protein	A0A0P0IKW4	Acinetobacter_phage	1.1e-30	56.3
WP_000462878.1\|1096913_1097306_+	hypothetical protein	J7HXM5	Acinetobacter_phage	1.2e-07	57.8
WP_000100162.1\|1097305_1097707_+	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	2.6e-66	96.2
WP_001277128.1\|1097703_1098180_+	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3

DBSCAN-SWA_3

1102138 : 1156192

Acinetobacter_phage(85.29%)

terminase,integrase,transposase,capsid

attL 1122697:1122713|attR 1150224:1150240

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001136773.1\|1102138_1102594_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.7e-80	95.4
WP_000378523.1\|1102654_1103089_+	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	7.4e-67	84.7
WP_000435230.1\|1103057_1103699_+	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	6.3e-115	88.7
WP_000729387.1\|1103757_1104273_+	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
WP_001132930.1\|1104232_1105525_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	6.4e-215	86.0
WP_000301495.1\|1105564_1106905_+	DUF4055 domain-containing protein	A0A0P0IDW1	Acinetobacter_phage	3.4e-235	92.2
WP_000146970.1\|1106914_1108021_+\|capsid	minor capsid protein	A0A0P0IR98	Acinetobacter_phage	2.1e-190	90.2
WP_000004550.1\|1108017_1108248_+	hypothetical protein	NA	NA	NA	NA
WP_001291451.1\|1108263_1108416_+	hypothetical protein	NA	NA	NA	NA
WP_000589038.1\|1108467_1108782_+	hypothetical protein	A0A0S3UFT8	Pseudomonas_phage	5.2e-14	50.5
WP_000056390.1\|1108868_1109660_+	hypothetical protein	A0A0P0J090	Acinetobacter_phage	2.3e-90	74.2
WP_000852265.1\|1109673_1110624_+	hypothetical protein	A0A0P0HSG2	Acinetobacter_phage	3.7e-172	94.9
WP_000524488.1\|1110668_1111004_+	hypothetical protein	A0A0N7IRE4	Acinetobacter_phage	2.7e-53	100.0
WP_000008459.1\|1111007_1111388_+	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	6.9e-53	84.9
WP_000524257.1\|1111388_1111757_+	hypothetical protein	J7I467	Acinetobacter_phage	8.7e-61	92.6
WP_000540685.1\|1111825_1112023_+	hypothetical protein	NA	NA	NA	NA
WP_000235282.1\|1112030_1112324_+	hypothetical protein	NA	NA	NA	NA
WP_000248411.1\|1112375_1112786_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	7.7e-50	73.3
WP_000539749.1\|1112757_1113126_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	2.0e-52	82.8
WP_001984404.1\|1113082_1113526_+	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	2.0e-75	94.6
WP_001277696.1\|1113527_1113746_+	hypothetical protein	A0A0P0I8C2	Acinetobacter_phage	1.2e-28	94.2
WP_000749909.1\|1113854_1114376_+	SH3 domain-containing protein	NA	NA	NA	NA
WP_000064593.1\|1114472_1114826_+	hypothetical protein	A0A0D4DCF7	Acinetobacter_phage	3.3e-57	96.6
WP_000002408.1\|1114825_1116004_+	hypothetical protein	A0A0D4DCQ4	Acinetobacter_phage	1.2e-103	66.3
WP_000094278.1\|1116056_1116974_+	hypothetical protein	J7HXP7	Acinetobacter_phage	2.0e-170	100.0
WP_001185585.1\|1117043_1117559_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	2.5e-77	96.6
WP_000335868.1\|1118061_1118361_+	DUF4258 domain-containing protein	A0A0P0IE58	Acinetobacter_phage	7.4e-50	100.0
WP_000274931.1\|1118369_1118828_+	helix-turn-helix domain-containing protein	A0A0P0IRJ4	Acinetobacter_phage	1.1e-84	100.0
WP_000721572.1\|1118932_1119613_+	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
WP_001275792.1\|1119614_1119878_+	hypothetical protein	NA	NA	NA	NA
WP_000046573.1\|1120005_1124316_+	tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	98.3
1122697:1122713	attL	NA	NA	NA	NA
WP_000721057.1\|1124406_1124994_+	hypothetical protein	NA	NA	NA	NA
WP_000277448.1\|1125086_1125485_+	hypothetical protein	J7I0X8	Acinetobacter_phage	4.1e-72	97.7
WP_083040647.1\|1125484_1125991_+	DUF1833 family protein	J7HXQ5	Acinetobacter_phage	2.1e-89	95.8
WP_000835160.1\|1125987_1126350_+	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	8.1e-51	79.2
WP_000598554.1\|1126342_1129768_+	hypothetical protein	A0A0P0HSH9	Acinetobacter_phage	0.0e+00	94.2
WP_000433907.1\|1129835_1130225_+	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	3.3e-66	99.2
WP_001019739.1\|1130266_1130812_+	N-acetylmuramidase	A0A0B5L5G7	Acinetobacter_phage	4.7e-103	100.0
WP_085940413.1\|1133748_1134839_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_083040649.1\|1134923_1136570_+	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
WP_000718101.1\|1136880_1137369_-	hypothetical protein	NA	NA	NA	NA
WP_000046989.1\|1137458_1138832_-\|integrase	integrase family protein	A0A0R6PGY7	Moraxella_phage	1.9e-76	41.5
WP_000003720.1\|1139259_1139544_-	cell division protein ZapA	NA	NA	NA	NA
WP_000893185.1\|1139540_1140101_-	hypothetical protein	NA	NA	NA	NA
WP_001150150.1\|1140165_1140795_+	UPF0149 family protein	NA	NA	NA	NA
WP_000775459.1\|1140862_1142185_+	Xaa-Pro aminopeptidase	NA	NA	NA	NA
WP_001187364.1\|1142216_1143425_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_000005670.1\|1143421_1144654_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_000129799.1\|1144863_1145115_+	hypothetical protein	NA	NA	NA	NA
WP_000058923.1\|1145169_1145571_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000896577.1\|1145636_1146278_+	cation transporter	NA	NA	NA	NA
WP_000950251.1\|1146336_1146939_-	amino acid transporter	NA	NA	NA	NA
WP_000887365.1\|1147046_1147937_+	LysR family transcriptional regulator ArgP	NA	NA	NA	NA
WP_000140381.1\|1147939_1148326_-	hypothetical protein	NA	NA	NA	NA
WP_001067858.1\|1149058_1149763_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_014454105.1\|1150773_1151328_+	aminoglycoside N-acetyltransferase AAC(6')-Ib'	NA	NA	NA	NA
1150224:1150240	attR	NA	NA	NA	NA
WP_002075262.1\|1151420_1152053_+	type B-3 chloramphenicol O-acetyltransferase CatB8	A0A2R8FE91	Brazilian_cedratvirus	3.5e-25	40.1
WP_001206316.1\|1152110_1152902_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000679427.1\|1153065_1153413_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|1153406_1154246_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000050481.1\|1154650_1156192_+\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1347399 : 1365116

Acinetobacter_phage(92.31%)

integrase

attL 1340737:1340751|attR 1353417:1353431

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1340737:1340751	attL	NA	NA	NA	NA
WP_083040653.1\|1347399_1348662_+\|integrase	integrase family protein	A0A0P0IKP2	Acinetobacter_phage	5.2e-246	98.6
WP_000910238.1\|1348667_1348937_-	hypothetical protein	A0A0N7IRE8	Acinetobacter_phage	3.5e-43	100.0
WP_016062494.1\|1348937_1349291_-	hypothetical protein	J7I0Y4	Acinetobacter_phage	1.2e-62	100.0
WP_059273172.1\|1349287_1349677_-	hypothetical protein	J7HXR6	Acinetobacter_phage	2.0e-71	100.0
WP_000654847.1\|1349679_1349925_-	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
WP_001061230.1\|1349926_1350886_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.5e-176	100.0
WP_001207477.1\|1350882_1352004_-	ATP-binding protein	A0A0D4DBX7	Acinetobacter_phage	2.6e-212	100.0
WP_016062496.1\|1352014_1352338_-	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	7.9e-58	100.0
WP_083040655.1\|1352340_1352781_-	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	1.8e-73	96.6
WP_000065151.1\|1352973_1355241_-	N-6 DNA methylase	J7I0U9	Acinetobacter_phage	0.0e+00	100.0
1353417:1353431	attR	NA	NA	NA	NA
WP_000370477.1\|1355373_1355589_-	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	2.5e-31	100.0
WP_000792745.1\|1355603_1356368_-	LexA family transcriptional regulator	J7I4M9	Acinetobacter_phage	2.3e-140	98.0
WP_000165919.1\|1356445_1356631_+	hypothetical protein	J7HXD2	Acinetobacter_phage	1.4e-27	98.4
WP_000041063.1\|1356640_1356997_+	hypothetical protein	J7I452	Acinetobacter_phage	8.8e-58	98.3
WP_001095601.1\|1357052_1357328_+	hypothetical protein	A0A0P0IVP2	Acinetobacter_phage	6.3e-40	96.7
WP_001084140.1\|1357324_1357621_+	hypothetical protein	A0A0P0HSJ2	Acinetobacter_phage	8.9e-48	98.0
WP_156878061.1\|1357617_1357971_+	hypothetical protein	A0A0P0IVS7	Acinetobacter_phage	3.5e-51	96.4
WP_083040659.1\|1358033_1358933_+	hypothetical protein	A0A0D4DBT2	Acinetobacter_phage	1.9e-157	98.7
WP_002053037.1\|1358929_1359700_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	4.0e-148	100.0
WP_000159938.1\|1359696_1359831_+	putative phage replication protein	A0A0D4DCC7	Acinetobacter_phage	5.6e-18	100.0
WP_000648413.1\|1359817_1360240_+	hypothetical protein	A0A0P0I8A5	Acinetobacter_phage	1.0e-76	100.0
WP_095357150.1\|1360289_1360652_+	hypothetical protein	A0A0N7IRE2	Acinetobacter_phage	3.3e-68	99.2
WP_002052057.1\|1360723_1361794_+	site-specific DNA-methyltransferase	A0A1B0VM49	Pseudomonas_phage	4.6e-110	59.6
WP_031944289.1\|1361870_1362914_+	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	4.3e-28	52.8
WP_000994866.1\|1362910_1363675_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	6.7e-63	48.8
WP_000990950.1\|1363671_1364205_+	hypothetical protein	NA	NA	NA	NA
WP_001136753.1\|1364660_1365116_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.2e-53	68.9

DBSCAN-SWA_5

2243212 : 2314204

uncultured_Caudovirales_phage(22.22%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085940413.1\|2243212_2244302_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_000342966.1\|2244477_2244765_-	hypothetical protein	NA	NA	NA	NA
WP_001007559.1\|2245191_2245851_+	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_085916980.1\|2246168_2246624_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000204295.1\|2246703_2247861_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000813815.1\|2247994_2249173_-	cyanate transporter	NA	NA	NA	NA
WP_000646729.1\|2249172_2249655_-	nucleoside deaminase	S4VYT2	Pandoravirus	8.3e-19	40.6
WP_085916981.1\|2249670_2250318_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_000460184.1\|2250490_2251342_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000972583.1\|2251344_2252298_-	M15 family metallopeptidase	A0A0H4TGB9	Bacillus_phage	2.8e-10	33.3
WP_000046451.1\|2252305_2252908_-	hypothetical protein	NA	NA	NA	NA
WP_000083625.1\|2252920_2253727_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_000471445.1\|2253744_2255109_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_000020713.1\|2255125_2256220_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_156190132.1\|2256243_2258925_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	2.3e-81	30.6
WP_000168112.1\|2259144_2259408_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_083028564.1\|2259424_2260192_-	OmpA family protein	NA	NA	NA	NA
WP_000557241.1\|2260194_2261154_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_000556914.1\|2261191_2265016_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_000591882.1\|2265046_2266459_-	hypothetical protein	NA	NA	NA	NA
WP_001190395.1\|2266455_2267454_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_000568832.1\|2267417_2269229_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_001047031.1\|2269245_2269722_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_000653195.1\|2269801_2270305_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_001066523.1\|2270354_2271836_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_001119042.1\|2271828_2272332_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_000869709.1\|2272348_2273041_-	hypothetical protein	NA	NA	NA	NA
WP_000070792.1\|2274129_2274531_+	hypothetical protein	NA	NA	NA	NA
WP_000542525.1\|2274626_2275571_+	ABC transporter permease	NA	NA	NA	NA
WP_001000091.1\|2275570_2276452_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-37	38.2
WP_000591252.1\|2276503_2277526_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000916831.1\|2277522_2279334_-	allophanate hydrolase	NA	NA	NA	NA
WP_001118704.1\|2279346_2279781_-	transcriptional regulator	NA	NA	NA	NA
WP_001000631.1\|2279785_2279911_-	hypothetical protein	NA	NA	NA	NA
WP_000821714.1\|2280082_2280622_-	hypothetical protein	NA	NA	NA	NA
WP_001196271.1\|2281155_2281692_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_000475274.1\|2281730_2285336_-	urea carboxylase	NA	NA	NA	NA
WP_000217385.1\|2285338_2285992_-	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_001090541.1\|2286007_2286748_-	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_001202390.1\|2287061_2288225_-	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	5.3e-11	26.7
WP_000921216.1\|2288477_2288909_+	SRPBCC family protein	NA	NA	NA	NA
WP_001133095.1\|2288968_2289529_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001117238.1\|2290206_2290509_+	hypothetical protein	NA	NA	NA	NA
WP_000414792.1\|2290705_2291056_-	hypothetical protein	NA	NA	NA	NA
WP_000465125.1\|2291189_2292098_-	sel1 repeat family protein	NA	NA	NA	NA
WP_000698627.1\|2292207_2293428_-	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	1.2e-32	29.7
WP_001090993.1\|2293729_2295448_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_001211799.1\|2295447_2297031_-	5-oxoprolinase/urea amidolyase family protein	NA	NA	NA	NA
WP_000276191.1\|2297063_2297870_-	putative hydro-lyase	NA	NA	NA	NA
WP_000496072.1\|2297881_2298646_-	LamB/YcsF family protein	NA	NA	NA	NA
WP_001989322.1\|2298680_2299934_-	divalent metal cation transporter	NA	NA	NA	NA
WP_001049897.1\|2300278_2301190_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_014462757.1\|2301473_2301782_-	hypothetical protein	NA	NA	NA	NA
WP_001010300.1\|2302222_2302753_-	hypothetical protein	NA	NA	NA	NA
WP_000015582.1\|2302769_2307677_-	RHS domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	9.3e-49	52.4
WP_000934999.1\|2307686_2310863_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	9.7e-257	64.1
WP_001989630.1\|2311485_2312730_+	serine hydrolase	NA	NA	NA	NA
WP_156878065.1\|2312985_2314204_+\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	4.8e-79	53.2

DBSCAN-SWA_6

2628283 : 2643080

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000566784.1\|2628283_2628859_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	3.2e-110	100.0
WP_000960548.1\|2628954_2631654_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	100.0
WP_000281127.1\|2631733_2634466_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	99.9
WP_001982145.1\|2634821_2635871_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
WP_000608304.1\|2635880_2636687_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	7.9e-147	100.0
WP_000066126.1\|2636696_2637392_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
WP_001164226.1\|2637402_2638386_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.0e-189	100.0
WP_001076817.1\|2638392_2640768_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	100.0
WP_000893683.1\|2640769_2642269_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	6.1e-286	100.0
WP_001187844.1\|2642531_2643080_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	1.7e-97	100.0

DBSCAN-SWA_7

3282098 : 3355244

Pseudomonas_phage(21.21%)

plate,integrase,tRNA,transposase,protease,tail,head

attL 3319343:3319358|attR 3360557:3360572

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000003709.1\|3282098_3282527_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	2.9e-31	50.0
WP_000863325.1\|3282544_3283201_+	hypothetical protein	NA	NA	NA	NA
WP_000672534.1\|3283303_3285244_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_000175513.1\|3285262_3286099_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_000673016.1\|3286109_3287267_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_000154072.1\|3287309_3288923_-	acetyl-CoA carboxylase carboxyltransferase subunit	NA	NA	NA	NA
WP_000344603.1\|3288925_3289828_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.1e-06	22.3
WP_001164927.1\|3289833_3290034_-	hypothetical protein	NA	NA	NA	NA
WP_083028592.1\|3290079_3291639_-	DUF1446 domain-containing protein	NA	NA	NA	NA
WP_000562187.1\|3291825_3292425_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_001176662.1\|3292456_3293620_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_000988422.1\|3293756_3294320_-	DUF4256 domain-containing protein	NA	NA	NA	NA
WP_001198600.1\|3294490_3294886_-	DUF2007 domain-containing protein	NA	NA	NA	NA
WP_001125219.1\|3300858_3301926_-	hypothetical protein	NA	NA	NA	NA
WP_000180205.1\|3301944_3302778_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_001109438.1\|3302819_3303677_-	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_000556102.1\|3303794_3304400_+	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_000021434.1\|3304467_3304995_+	hypothetical protein	NA	NA	NA	NA
WP_000462894.1\|3305043_3305289_-	DUF2789 domain-containing protein	NA	NA	NA	NA
WP_000813006.1\|3305451_3306438_-	malate dehydrogenase	NA	NA	NA	NA
WP_000877281.1\|3306649_3307312_-	hypothetical protein	NA	NA	NA	NA
WP_000792523.1\|3307369_3309313_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	7.5e-10	39.7
WP_000218140.1\|3309601_3311053_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_001986628.1\|3311135_3312179_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	1.1e-47	44.9
WP_000703571.1\|3312188_3312665_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_000914776.1\|3312754_3313639_-	energy transducer TonB	NA	NA	NA	NA
WP_001193958.1\|3313869_3314541_+	hypothetical protein	NA	NA	NA	NA
WP_000201548.1\|3314698_3315412_+	DUF3108 domain-containing protein	NA	NA	NA	NA
WP_000543071.1\|3315484_3316060_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_000465826.1\|3316112_3316736_-	NAD(P)H:quinone oxidoreductase	NA	NA	NA	NA
WP_000893466.1\|3316993_3318241_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_000392676.1\|3318261_3319176_-	DMT family transporter	NA	NA	NA	NA
WP_083040810.1\|3319302_3320574_-	hypothetical protein	E5EYU2	Acinetobacter_phage	1.3e-05	40.0
3319343:3319358	attL	NA	NA	NA	NA
WP_000142501.1\|3320570_3321107_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_083040811.1\|3321103_3322150_-\|plate	baseplate J/gp47 family protein	A0A0M3LQN4	Mannheimia_phage	7.3e-28	27.4
WP_032007158.1\|3322153_3322516_-	phage GP46 family protein	NA	NA	NA	NA
WP_000973841.1\|3322523_3323006_-\|plate	phage baseplate assembly protein	A0A0M3LPA3	Mannheimia_phage	9.8e-12	39.3
WP_083040813.1\|3323002_3324058_-	hypothetical protein	NA	NA	NA	NA
WP_083040814.1\|3324047_3325223_-	DNA circularization N-terminal domain-containing protein	F6MIL2	Haemophilus_phage	9.4e-16	21.4
WP_057692685.1\|3325310_3327407_-\|tail	phage tail tape measure protein	A0A0M3LPB6	Mannheimia_phage	1.5e-40	31.6
WP_024436600.1\|3327410_3327644_-	hypothetical protein	NA	NA	NA	NA
WP_000439581.1\|3327673_3327985_-	hypothetical protein	NA	NA	NA	NA
WP_001287673.1\|3327986_3328364_-	hypothetical protein	NA	NA	NA	NA
WP_083040816.1\|3328489_3329299_-\|tail	phage tail protein	A0A2H4JFT7	uncultured_Caudovirales_phage	2.2e-16	28.7
WP_000382697.1\|3329295_3329511_-	hypothetical protein	NA	NA	NA	NA
WP_083040817.1\|3329510_3330863_-	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_041114749.1\|3330881_3333227_-	CotH kinase family protein	H7BUR7	unidentified_phage	9.4e-07	22.8
WP_002004678.1\|3333237_3333585_-	hypothetical protein	NA	NA	NA	NA
WP_000609245.1\|3333584_3334196_-	DUF1834 family protein	NA	NA	NA	NA
WP_000271340.1\|3334192_3334624_-	DUF1320 family protein	A0A0M3LP98	Mannheimia_phage	7.4e-19	37.3
WP_000237123.1\|3334635_3335568_-\|head	Mu-like prophage major head subunit gpT family protein	A0A2P9JZJ2	Alteromonadaceae_phage	7.8e-90	55.4
WP_046882895.1\|3335571_3335991_-	hypothetical protein	NA	NA	NA	NA
WP_083040819.1\|3335987_3337076_-	hypothetical protein	A0A0M5N0Q6	Ralstonia_phage	3.8e-35	32.9
WP_057047116.1\|3337164_3337668_-	phage virion morphogenesis protein	B7SDN8	Haemophilus_phage	3.3e-10	33.1
WP_057047117.1\|3337664_3338915_-\|head	phage head morphogenesis protein	I6PBD2	Pseudomonas_phage	1.4e-73	38.1
WP_083040821.1\|3338914_3340534_-	DUF935 domain-containing protein	A0A0M5MS00	Ralstonia_phage	1.4e-102	40.2
WP_000035039.1\|3340756_3341026_+	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_000968697.1\|3341003_3341207_-	hypothetical protein	NA	NA	NA	NA
WP_000069781.1\|3341291_3342851_-	hypothetical protein	A0A2H4JF57	uncultured_Caudovirales_phage	3.3e-157	55.5
WP_000090430.1\|3342850_3343396_-	DUF3486 family protein	Q6QIC2	Burkholderia_phage	1.4e-43	49.7
WP_000006949.1\|3343404_3343716_-	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	3.8e-25	52.0
WP_000155183.1\|3343712_3344057_-	hypothetical protein	Q6QIC4	Burkholderia_phage	2.6e-14	40.4
WP_001037051.1\|3344053_3344437_-	hypothetical protein	NA	NA	NA	NA
WP_000028719.1\|3344433_3344934_-	glycoside hydrolase family 108 protein	A0A0M3LSH2	Mannheimia_phage	8.8e-56	65.8
WP_002008043.1\|3345017_3345569_-	hypothetical protein	NA	NA	NA	NA
WP_000151899.1\|3345568_3346216_-	hypothetical protein	A0A2I7S9A5	Vibrio_phage	6.1e-25	35.5
WP_000550335.1\|3346316_3346523_+	DNA-binding protein	A0A0S4L0D0	Pseudomonas_phage	3.0e-10	54.5
WP_001249250.1\|3346566_3346734_+	hypothetical protein	NA	NA	NA	NA
WP_001985437.1\|3346717_3347014_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000064374.1\|3347026_3347911_+	DUF3102 domain-containing protein	Q6QID9	Burkholderia_phage	2.8e-28	34.5
WP_000184212.1\|3347913_3349665_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q5ZR04	Pseudomonas_phage	1.1e-100	36.5
WP_000810199.1\|3349674_3350952_+	AAA family ATPase	Q6QIE1	Burkholderia_phage	3.6e-93	47.3
WP_000752926.1\|3351140_3351359_+	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_024436641.1\|3351355_3351586_+	hypothetical protein	NA	NA	NA	NA
WP_024436642.1\|3351575_3352247_+	hypothetical protein	A0A2H4JFV8	uncultured_Caudovirales_phage	9.5e-29	48.0
WP_024436643.1\|3352246_3352750_+	host-nuclease inhibitor Gam family protein	A0A2K9VGT9	Faecalibacterium_phage	3.8e-14	32.3
WP_057047121.1\|3352772_3352952_+	hypothetical protein	NA	NA	NA	NA
WP_024436644.1\|3352944_3353220_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	9.5e-20	61.8
WP_000370225.1\|3353212_3353539_+	hypothetical protein	A0A0S4L5D5	Pseudomonas_phage	1.6e-29	66.7
WP_057047122.1\|3353551_3353731_+	hypothetical protein	NA	NA	NA	NA
WP_004716177.1\|3353870_3354584_+	DUF2786 domain-containing protein	A0A2H4JCP9	uncultured_Caudovirales_phage	4.5e-29	40.1
WP_001004234.1\|3354580_3354805_+	hypothetical protein	NA	NA	NA	NA
WP_004716174.1\|3354806_3355244_+	regulatory protein GemA	Q6QIE7	Burkholderia_phage	1.9e-22	43.2
3360557:3360572	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

30200 : 37787

Alteromonadaceae_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000389917.1\|30200_30890_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	3.4e-13	30.9
WP_000072937.1\|30894_31131_+	hypothetical protein	A0A2H4J8L3	uncultured_Caudovirales_phage	2.2e-09	43.1
WP_065285204.1\|31136_31343_-	hypothetical protein	NA	NA	NA	NA
WP_000794252.1\|31855_32947_+	phosphoadenosine phosphosulfate reductase family protein	H7BVI4	unidentified_phage	1.1e-15	32.2
WP_000844619.1\|33004_33778_+	hypothetical protein	A0A2K9VK66	Klebsiella_phage	1.3e-53	44.5
WP_001067229.1\|34258_34756_+	hypothetical protein	NA	NA	NA	NA
WP_001086346.1\|34784_35561_+	SAM-dependent DNA methyltransferase	A0A2K9V411	Faecalibacterium_phage	7.6e-22	34.3
WP_000724906.1\|35753_36527_+	ParA family protein	A0A1X9I765	Streptococcus_phage	4.8e-08	24.5
WP_000096599.1\|36530_37787_+	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	7.2e-06	28.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020590

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP020589

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection