CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP020740	[Pseudomonas] mesoacidophila strain ATCC 31433 plasmid pATCC31433, complete sequence	0 crisprs	PD-DExK	0	0	0
NZ_CP020738	[Pseudomonas] mesoacidophila strain ATCC 31433 chromosome 2, complete sequence	1 crisprs	cas3,Cas14u_CAS-V,csa3,DinG,2OG_CAS,WYL	0	2	1
NZ_CP020737	[Pseudomonas] mesoacidophila strain ATCC 31433 chromosome 1, complete sequence	4 crisprs	csa3,cas3,RT,DEDDh,Cas14u_CAS-V,DinG	1	1	3
NZ_CP020739	[Pseudomonas] mesoacidophila strain ATCC 31433 chromosome 3, complete sequence	0 crisprs	NA	0	0	39

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020738_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020738_1

97173-97285

Orphan

Consensus_repeat	Method
AGCCCCCGAAAAAGCTCACCT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP020738_1

>merge|NZ_CP020738|1|97173-97285|PILER-CR
AGCCCCCGAAAAGCCTCACCCTTGACCATTTTTTCGAGCAAATACCTCTCCCGAAAATGCTCACCTTTAGGGCCACAGGTCGACCTCCGGCAAGGCCCCGAAAAAGCTCACCT

>NZ_CP020738|1|1|97173-97285|PILER-CR
AGCCCCCGAAAAGCCTCACCC	TTGACCATTTTTTCGAGCAAATACCTCT
CCCGAAAATGCTCACCTTTAG	GGCCACAGGTCGACCTCCGGCAAGGC
CCCGAAAAAGCTCACCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020738.1\|WP_084906952.1\|94893_96258_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP020738.1\|WP_026044369.1\|86763_87132_-\|response-regulator	unknown	unknown	gnl\|CDD\|381124
NZ_CP020738.1\|WP_084906966.1\|106597_107236_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|173926
NZ_CP020738.1\|WP_042584728.1\|93090_93753_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854
NZ_CP020738.1\|WP_084906958.1\|101178_101790_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
NZ_CP020738.1\|WP_084906950.1\|93776_94838_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NZ_CP020738.1\|WP_084906953.1\|98111_99293_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378704
NZ_CP020738.1\|WP_084906949.1\|91394_91589_+\|zf-HC2-domain-containing-protein	unknown	unknown	gnl\|CDD\|379219
NZ_CP020738.1\|WP_088511562.1\|104250_106023_-\|potassium-transporting-ATPase-subunit-KdpA	unknown	unknown	gnl\|CDD\|235494
NZ_CP020738.1\|WP_084906961.1\|103163_104192_+\|L-threonine-3-dehydrogenase	unknown	unknown	gnl\|CDD\|180054
NZ_CP020738.1\|WP_084906940.1\|86081_86771_-\|chemotaxis-protein	unknown	unknown	gnl\|CDD\|381738
NZ_CP020738.1\|WP_084906947.1\|90817_91414_+\|RNA-polymerase-factor-sigma-70	unknown	unknown	gnl\|CDD\|183584
NZ_CP020738.1\|WP_084906955.1\|99432_100446_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|334163
NZ_CP020738.1\|WP_084909884.1\|91901_92258_-\|arsenate-reductase-(glutaredoxin)	unknown	unknown	gnl\|CDD\|239332
NZ_CP020738.1\|WP_084906944.1\|87607_89857_+\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP020738.1\|WP_084906968.1\|107488_108103_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP020738.1\|WP_084906960.1\|101951_103151_+\|glycine-C-acetyltransferase	unknown	unknown	gnl\|CDD\|235893
NZ_CP020738.1\|WP_084906956.1\|100599_100980_-\|DUF2471-domain-containing-protein	unknown	unknown	gnl\|CDD\|371166
NZ_CP020738.1\|WP_084906946.1\|89893_90448_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223508
NZ_CP020738.1\|WP_167389835.1\|106154_106565_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP020738.1\|WP_084906952.1\|94893_96258_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.98228e-18
NZ_CP020738.1\|WP_026044369.1\|86763_87132_-\|response-regulator	gnl\|CDD\|381124	cd17593, REC_CheC-like, phosphoacceptor receiver (REC) domain of uncharacterized response regulators containing a CheC domain. This subfamily is composed of uncharacterized proteins containing an N-terminal REC domain and a C-terminal CheC domain that may function as the output/effector domain of a response regulator. CheC is a CheY-P phosphatase, affecting the level of phosphorylated CheY which controls the sense of flagella rotation and determine swimming behavior of chemotactic bacteria. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.35521e-58
NZ_CP020738.1\|WP_084906966.1\|106597_107236_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|173926	cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.	1.05038e-07
NZ_CP020738.1\|WP_042584728.1\|93090_93753_+\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	1.47402e-36
NZ_CP020738.1\|WP_084906958.1\|101178_101790_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	6.54357e-20
NZ_CP020738.1\|WP_084906950.1\|93776_94838_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	1.38723e-16
NZ_CP020738.1\|WP_084906953.1\|98111_99293_+\|DNA-binding-protein	gnl\|CDD\|378704	pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term. The broad host-range plasmid RK2 is able to replicate in and be inherited in a stable manner in diverse Gram-negative bacterial species. It encodes a number of co-ordinately regulated operons including a central control korF1 operon that represses the kfrA operon. The KfrA polypeptide is a site-specific DNA-binding protein whose operator overlaps the kfrA promoter. The N-terminus, containing an helix-turn-helix motif, is essential for function. Downstream from this family is an extended coiled-coil domain containing a heptad repeat segment which is probably responsible for formation of multimers, and may provide an example of a bridge to host structures required for plasmid partitioning.	9.1729e-16
NZ_CP020738.1\|WP_084906949.1\|91394_91589_+\|zf-HC2-domain-containing-protein	gnl\|CDD\|379219	pfam13490, zf-HC2, Putative zinc-finger. This is a putative zinc-finger found in some anti-sigma factor proteins.	4.47586e-06
NZ_CP020738.1\|WP_088511562.1\|104250_106023_-\|potassium-transporting-ATPase-subunit-KdpA	gnl\|CDD\|235494	PRK05482, PRK05482, potassium-transporting ATPase subunit A; Provisional.	0
NZ_CP020738.1\|WP_084906961.1\|103163_104192_+\|L-threonine-3-dehydrogenase	gnl\|CDD\|180054	PRK05396, tdh, L-threonine 3-dehydrogenase; Validated.	0
NZ_CP020738.1\|WP_084906940.1\|86081_86771_-\|chemotaxis-protein	gnl\|CDD\|381738	cd17910, CheC_ClassII, chemotaxis protein CheC, Class II. This family contains class II CheC proteins found in proteobacteria, which diverge from class I CheCs in sequence conservation and lack critical well-conserved residues for CheD binding. These proteins are likely to be dedicated phosphatases. The class II cheC genes are not found in chemotaxis operons, but in operons containing more archetypical two-component signaling components, non-signaling operons, or as orphans. Thus, class II CheCs appear to be involved in non-chemotactic two component systems. Class II CheCs lack the first of the two phosphatase active sites of class I CheCs, and retain the second active site of class I CheCs.	1.10087e-42
NZ_CP020738.1\|WP_084906947.1\|90817_91414_+\|RNA-polymerase-factor-sigma-70	gnl\|CDD\|183584	PRK12545, PRK12545, RNA polymerase factor sigma-70.	3.72536e-139
NZ_CP020738.1\|WP_084906955.1\|99432_100446_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	3.18115e-10
NZ_CP020738.1\|WP_084909884.1\|91901_92258_-\|arsenate-reductase-(glutaredoxin)	gnl\|CDD\|239332	cd03034, ArsC_ArsC, Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.	7.27218e-51
NZ_CP020738.1\|WP_084906944.1\|87607_89857_+\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	1.85476e-87
NZ_CP020738.1\|WP_084906968.1\|107488_108103_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.21961e-12
NZ_CP020738.1\|WP_084906960.1\|101951_103151_+\|glycine-C-acetyltransferase	gnl\|CDD\|235893	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.	0
NZ_CP020738.1\|WP_084906956.1\|100599_100980_-\|DUF2471-domain-containing-protein	gnl\|CDD\|371166	pfam10616, DUF2471, Protein of unknown function (DUF2471). The function of this family is unknown. Members all come from Burkholderia spp. BDAG_04162 is annotated as Serine/threonine-protein kinase, but this could not be confirmed.	1.59953e-36
NZ_CP020738.1\|WP_084906946.1\|89893_90448_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|223508	COG0431, COG0431, Predicted flavoprotein [General function prediction only].	1.56976e-45

>NZ_CP020738.1|WP_084906952.1|94893_96258_-|replication-initiation-protein
MATKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKLFNVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQKPGRKWGISTLIADAEILEDPATRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRSSAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVKLGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAAALFKDALKKGYAPPVEAVEALPAGTAPGKAAAAQPDDLKARLLSEYSAYRRKEAKALYDEQGEAEREVARESFESEALPTMGSHLREDWRKRGLDSKLTETAFFDWLARKTWGEPTDGDLLSFTLNQSRAA
>NZ_CP020738.1|WP_084906950.1|93776_94838_+|ParB/RepB/Spo0J-family-partition-protein
MKPSQFAKGFQARPDMTTSEKRTALDRLNAIDGLVKSETPASAPTKSAKKDNVAPLAPDITIDASTDESSQYRAWRLENRYAPGQVIELSLKAIKHSPFNPRHFYLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGLYFVSDGGRRVRALKEANKESVKAIVIDLPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELAEHLGLDESTVAVALSIGKLPESIMQEMVARPDRFGSNMAYQVGRYHNARGTDATLRLINKIVSDDLSTRQVSDIVKGRAAAQETPKPASRQRYAQRLEIKLGGKSVGDLKSYGEDRIELRLRGLPKEKRDAILEQLERMLLSD
>NZ_CP020738.1|WP_042584728.1|93090_93753_+|AAA-family-ATPase
MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVVDADGQNTLVHWSSASGDSETGIPFPVVNLAEAGGQIHREIKKFINDYDVIVVDCPPSITEKVSGVVLLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKRALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGAKLAAAEIRACADEIVAMLP
>NZ_CP020738.1|WP_084909884.1|91901_92258_-|arsenate-reductase-(glutaredoxin)
MITIYHNPRCSKSRETLALVEALNPSGAPVNVIEYLKTPPTVEELEALHRQLARPVRDLLRDNEEPYKTLDLGRADLTDAQAYEAIAAHPILLQRPIVVYQGKAAIGRPPESVRELFE
>NZ_CP020738.1|WP_084906949.1|91394_91589_+|zf-HC2-domain-containing-protein
MLPGKCKDVTRLLSDALDRHLTVHERVQVRVHLPTCSGCRQYREQIALLRAAAKAAAGQGGGEG
>NZ_CP020738.1|WP_084906947.1|90817_91414_+|RNA-polymerase-factor-sigma-70
MPSAYDDPAYLEQLRHDLLRFARLQLRDADAAEDAVQEALTAAWTHVADFAGLSAHKTWVFGILRNKLIDVLRARQRTVNLSALDAELDGESLLDRELFKDNGHWAAHAKPRPWPRPETLLQQQQFWMLFEICLNHLPEQIGRVFMMREFLDVEIDDICTELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDATGEM
>NZ_CP020738.1|WP_084906946.1|89893_90448_-|NAD(P)H-dependent-oxidoreductase
MAHRIAVIVGSLRRGSWNRALARAVISLAPAELAFEFVEIGELPLYSQDYDADFPEVAKRFKQVIEAADGLLFVTPEYNRSIPGVLKNALDWGSRPWGANSWAGKPGAVLGTSPGATGTALSQQHLRNVLAYLDVATLGQPEMFIKHDPTRIDDEGRIVNDDTRKFLQGFVDRYAAWVRLNKAA
>NZ_CP020738.1|WP_084906944.1|87607_89857_+|hybrid-sensor-histidine-kinase/response-regulator
MTSDRPADSRHHASADDWQDEGAYPSGAPEHDFAVRRVTLIVLLIAAIVLPCIYVAVMAYNDLKSREAAASDVTMRTVRVAEEHALKVFDLSETLDARIADLVQDMDDAAVRKDESDIHDALNEIGGGYPQVAAVSIFGASGRLLANSLYFPAPHTSIANRDDFLGIRDGKVIEHISRVMQGPRRLADTPVFNTGVARRHSDGSFAGMVSIALKSSYFNAFYRDLLGGAKTPMTMALARADGAVLASYPPPPAAAEAYRALSFGDEHGDPRGGVVRVRHDAGSEIVAYRQVGSYPVYVSCAYRTSAIWREWYEHLTVLFVSMFAPSFALWSVIWLSLKRLKAEEAAWDRWQAEASMRRSIESAYRQSRKMQALGNLVGSVAHDFNNLLTIISTNVQIARHRGVQQLDTELGAIERALKNGQSLTRQLLGVARKQPLHNETIDMGQWVGTCRELLKTSLGSKSSLSVAIEPGVWPIRVDVAELELAVINLAVNARDAMQIGGRFTVSARNVTLRREDGFPLTGDFVQISLDDTGSGMAPDVLARAFEPLFTTKPHGMGTGLGLPQVFAFCERSGGLATIDSAVGAGTSVRLYLPRANPLEATVARPPIPVAPMQSASPPAGLHVLLVEDNSEVAAGTEALLTLLGHRVTYAATADDALRLVEAAPANDGFDLVISDIHMPGRLNGIDLAEAIGRRPEKLAVILVTGYAEELDRTRGVNVRVLSKPFDIALLDEILQGIRNARDARHTAGI
>NZ_CP020738.1|WP_026044369.1|86763_87132_-|response-regulator
MPLPIVIADDSLLARKLLTKALPGDWDVDIAYAANGREALALYRDGKASVMFLDLTMPDMNGYQVLETLRHEDLNTFVIVVSADIQPQARERVRELGAIAFVAKPVTSEALLPILKEYGLYA
>NZ_CP020738.1|WP_084906940.1|86081_86771_-|chemotaxis-protein
MPDSVFTAEQRDALQEIANLAMGRAAARLAALLGRFIELSVPRVRVVQASDAGKALREMTGIHDNVTAVRQGFRSDIKGEALVLCRTANVTGLAALVDHTFGDAAAGERTRDDDEVDEAGVETAAARGETSSQDELVFDVANVLMGACVSSILDELGRTPVFFPPGLLGANVSFDDVFQPTVLAWSVALLLEVNLGLEDDAFRAHFVMLMAEDSIRLMGDALDALLSAL
>NZ_CP020738.1|WP_084906953.1|98111_99293_+|DNA-binding-protein
MTLDEMRQVIRKELESLRAAGARRQELSLHACKRLFFDLGIRPSAANVRDLTQTGSASDIPKDIDHFWERIRSASKVRLEGAAIPKVVEEKAGALLGALYEEALKVARDSLDADREQVRTDVAQAEQQLRDAAVRQETLEAAIARSETRNEQLQTRLTELEVQLASQNTHGSANEATLLTTVTRLERDLAATTGRVDAEQTQNAALRDRIDALQAELQQRTEHYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQAGLRDVQRKEFDFLQQLSAAKTRADRLEEQVRSQSDELAAATREMNTLRANREMNPEIAGLIRRLADAGKLDADAFAVIGTALDFDIPVPNQCPHCDGEPELSHTNEGFEVSCPECEYASGAWPSRFEAVTRFGSN
>NZ_CP020738.1|WP_084906955.1|99432_100446_-|tyrosine-type-recombinase/integrase
MSLPAPTHAPLPTEEKDLFDRGASDWIASPEAAFDAWLAMQDYRQSSADVYRAQWGAFLTWLRTHQKNLATVDTASIAHFVGELPIKKTQRMRYLRLIERVLDHIRRSEFGSTNPARFIAQDGEATWRKARDNEPTGFLAPAERAKLLAYLFSPIGVTGAAHWKERRDRALVAAFLGAGVKTGEARVLSISCINPGGTSLQIPSTHPDFARETHLASFAIALFDAWLAERKRQDIPGDLVFPASHAGRPMHKATMLRAVDAIVEAADIATARTARASPQTLRNTYAAELFENDVPPERVGTWLGFMQPISSNRLHRAWKNWRDSVIEGEVPSEPESH
>NZ_CP020738.1|WP_084906956.1|100599_100980_-|DUF2471-domain-containing-protein
MTEEQDLAALSFKAAAHDLEQIVRHIAERYIRQQVPLTWRLLHAIEAEALADLGFASRHEAGMRQLFERPSDMTFPETDDPTDFGKSNALPAVFSFAVIAYEAAARKRDVQPPSVKTARVAKGWRG
>NZ_CP020738.1|WP_084906958.1|101178_101790_-|helix-turn-helix-transcriptional-regulator
MASSSGSRRTPVDAAPPPAAATPPRVGEQIQRLRNERKLTLDDLSRAAGVSKSMLSEIERDKANPTIAVAWRLTNALGITLDELFSQPKSQETIRVDGPHDIPTLAGHDGRYQLRVWGPIDLAGRFEWYELTLPGGGALVSNAHEPGTREHLTVLQGTMEIEAAAAVRRLKSGDTARYPADAPHAIRNPGKAEARALLIVIHR
>NZ_CP020738.1|WP_084906960.1|101951_103151_+|glycine-C-acetyltransferase
MRDAFLAQVRGTLDQIRADGFYKTEREIASPQAAAVRLAGGAGVLNFCANNYLGLANDPRLIAAAKAGLDQDGFGMASVRFICGTQTVHKQLESALATFLGTDDSILYSSCFDANGGLFETLLDEKDAVISDELNHASIIDGIRLCKAQRYRYKNNDLADLEAKLKEADAAGVRHKLIATDGVFSMDGIIADLKGICDLADRYGALVMVDDSHAVGFIGTHGRGTPEYCGVEGRIDIITGTLGKALGGASGGYVAARREIVELLRQRSRPYLFSNTLTPSIAAASLKVLELLGSDEGAALRERVRENGARFRQQMTEAGFTLVPGAHPIIPVMLGDAQLATNMADALLAEGVYVIGFSFPVVPRGRARIRTQMSAAHTPEQIDQTVAAFVRVGKSLGIV
>NZ_CP020738.1|WP_084906961.1|103163_104192_+|L-threonine-3-dehydrogenase
MKALAKLERGPGLSLTRVKRPEVGHNDVLIKIHRTAICGTDIHIWKWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRDVMTDLHMTEGFDVGLEMSGVPSAFTSMLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAVDDYEKGFAAMLSGESGKVILDWTV
>NZ_CP020738.1|WP_088511562.1|104250_106023_-|potassium-transporting-ATPase-subunit-KdpA
MIGNAWTQVGVFLFVLTFLVKPLGTYIARIALGDLPGPLRRLAGVEHAIYRLAGVAPDAEMDWKRYAVALVAFNALGAVALYLLQRIQVWLPLNPQHLPNVEPGLAFNTAVSFATNTSWQAYAGETTLSHLTQMLGIGVQAFLSAASGMVVMLALIRGLVRRGSQTIGNVWVDLTRMTLYVLVPLAALFAAAFIGQGVLQNFAPNRDIAIVQPHPSMPAASAQSAQPSSTTVQTLPMGPVASQESIKLMSGDGGGFFNANSAHPYENPTPIANFLQMLAMLVLPAALCYTFGTMIQDRRQGWTIYAAMLTLFVAAAAMAIRAEQAVGPALNVPGIDAVASASQPGGNMEGKETRFGIVSSALYATVSTSSGDGAVDSMHDSFTPLGGLVPMVLMQTGEVVFGGPGSGLYSMLMVVLLAVFVAGLMIGRAPEYVGKKIDAYEMKMVSIAILATPAIVLVGTAIAAVTPAGVAGLGNPGAHGFSEMLYAFSSAANNNGSAFAGLSANTTFYNTALAAAMWFGRFTVIVPVLAIAGSLAAKQRRAAGAGTLPTHGPLFLCMLLSTVVLVTLVTFLPALALGPIAEHLAMTVGR
>NZ_CP020738.1|WP_167389835.1|106154_106565_-|hypothetical-protein
MPPDPPASPDEASRLALRNARLRAAIRLRGLAKLALVTIAVAHLLTLAFEFALVSAGFVPEAATLLLFRFISCALVSYWLQADALRACRDALELGFIAFGGPDEEPVRVAPRCPRRWLVLLNLQLDPKWIENKPLR
>NZ_CP020738.1|WP_084906966.1|106597_107236_-|GNAT-family-N-acetyltransferase
MPHSEPARRARSYAAYAKQLDERVVLRRFDPRIDSYESLAALQQRAFAPLGALGFPYPAADRSAAGTRERTLAGACFVALSKGHLVATLTMRLSDPDSPCDPYRSRRVATIRELAVDPVWQARGIGRSLLAFAEQWSASHRASHLALDVPQEAGRLVAFCVGEGFQPIDVMRFAGRGYDSAVLCKPIGATNRNAAVHGAVAIRPVRRQAASS
>NZ_CP020738.1|WP_084906968.1|107488_108103_+|TetR/AcrR-family-transcriptional-regulator
MTSYEPQPGEPGARDRLLDAAEALIYSGGIHATGVDAIVKRSGAARKSFYSHFESKEALVVAALERRDERWMRWFVDATLARGKTPRTQLLGMFDVLRDWFMQPDFHGCAFLNASGEIADADDPVRIVARAHKARLLAFVRERLDALADDAGIERRVLARVARQWLVLIDGAIGVALVSGDATAARDARATAELLLDAVSRPSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MN234223	Mycobacterium phage Philly, complete genome	18275-18300	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	KP027207	Mycobacterium phage Chandler, complete genome	19183-19208	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MN096360	Mycobacterium phage Rita1961, complete genome	18405-18430	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MG839014	Mycobacterium phage RagingRooster, complete genome	18410-18435	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	KJ194581	Mycobacterium phage Audrey, complete genome	18409-18434	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	KR080203	Mycobacterium phage OrangeOswald, complete genome	18409-18434	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MH513976	Mycobacterium phage Morty007, complete genome	19191-19216	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MH051265	Mycobacterium phage Yahalom, complete genome	18419-18444	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MH316565	Mycobacterium phage Mortcellus, complete genome	19047-19072	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MT310871	Mycobacterium phage Jackstina, complete genome	18335-18360	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MK359357	Mycobacterium phage RomaT, complete genome	19189-19214	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	JF704095	Mycobacterium phage Daisy, complete sequence	18430-18455	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	EU816589	Mycobacterium phage Phaedrus, complete genome	18325-18350	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MN096359	Mycobacterium phage Obutu, complete genome	18404-18429	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MK061414	Mycobacterium phage Marley1013, complete genome	19191-19216	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MT952851	Mycobacterium phage Gervas, complete genome	18390-18415	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MG925353	Mycobacterium phage Nozo, complete genome	19171-19196	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	KJ194584	Mycobacterium phage Heathcliff, complete genome	18371-18396	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MN444872	Mycobacterium phage SynergyX, complete genome	18410-18435	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MH576977	Mycobacterium phage Tydolla, complete genome	19147-19172	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MG925338	Mycobacterium phage ChaChing, complete genome	18424-18449	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	NC_023742	Mycobacterium phage Akoma, complete genome	18407-18432	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MG920059	Mycobacterium phage Baloo, complete genome	18406-18431	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	NC_023686	Mycobacterium phage Gadjet, complete genome	18413-18438	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	KR080205	Mycobacterium phage Corofin, complete genome	18434-18459	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	NC_041965	Mycobacterium phage Athena, complete genome	19172-19197	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	DQ398049	Mycobacterium phage Pipefish, complete genome	19291-19316	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	KF493879	Mycobacterium phage Bernardo, complete genome	18406-18431	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MT310892	Mycobacterium phage Compostia, complete genome	18842-18867	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	JN699018	Mycobacterium phage Kamiyu, complete genome	18378-18403	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	NC_012027	Mycobacterium phage Phlyer, complete genome	19144-19169	5	0.808
NZ_CP020738_1	1.2\|97243\|26\|NZ_CP020738\|PILER-CR	97243-97268	26	MN444873	Mycobacterium phage Abinghost, complete genome	18409-18434	5	0.808
NZ_CP020738_1	1.1\|97194\|28\|NZ_CP020738\|PILER-CR	97194-97221	28	NC_001949	Lactococcus lactis DPC3147 plasmid pMRC01, complete sequence	1843-1870	7	0.75

1. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MN234223 (Mycobacterium phage Philly, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

2. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to KP027207 (Mycobacterium phage Chandler, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

3. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MN096360 (Mycobacterium phage Rita1961, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

4. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MG839014 (Mycobacterium phage RagingRooster, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

5. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to KJ194581 (Mycobacterium phage Audrey, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

6. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to KR080203 (Mycobacterium phage OrangeOswald, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

7. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MH513976 (Mycobacterium phage Morty007, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

8. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MH051265 (Mycobacterium phage Yahalom, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

9. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MH316565 (Mycobacterium phage Mortcellus, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

10. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MT310871 (Mycobacterium phage Jackstina, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

11. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MK359357 (Mycobacterium phage RomaT, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

12. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to JF704095 (Mycobacterium phage Daisy, complete sequence) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

13. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to EU816589 (Mycobacterium phage Phaedrus, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

14. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MN096359 (Mycobacterium phage Obutu, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

15. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MK061414 (Mycobacterium phage Marley1013, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

16. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MT952851 (Mycobacterium phage Gervas, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

17. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MG925353 (Mycobacterium phage Nozo, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

18. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to KJ194584 (Mycobacterium phage Heathcliff, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

19. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MN444872 (Mycobacterium phage SynergyX, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

20. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MH576977 (Mycobacterium phage Tydolla, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

21. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MG925338 (Mycobacterium phage ChaChing, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

22. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to NC_023742 (Mycobacterium phage Akoma, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

23. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MG920059 (Mycobacterium phage Baloo, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

24. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to NC_023686 (Mycobacterium phage Gadjet, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

25. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to KR080205 (Mycobacterium phage Corofin, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

26. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to NC_041965 (Mycobacterium phage Athena, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

27. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to DQ398049 (Mycobacterium phage Pipefish, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

28. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to KF493879 (Mycobacterium phage Bernardo, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

29. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MT310892 (Mycobacterium phage Compostia, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

30. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to JN699018 (Mycobacterium phage Kamiyu, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

31. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to NC_012027 (Mycobacterium phage Phlyer, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

32. spacer 1.2|97243|26|NZ_CP020738|PILER-CR matches to MN444873 (Mycobacterium phage Abinghost, complete genome) position: , mismatch: 5, identity: 0.808

ttagggccacaggtcgacctccggca	CRISPR spacer
ggcgagccagaggtcgacctccggca	Protospacer
   *.**** ****************

33. spacer 1.1|97194|28|NZ_CP020738|PILER-CR matches to NC_001949 (Lactococcus lactis DPC3147 plasmid pMRC01, complete sequence) position: , mismatch: 7, identity: 0.75

ttgaccattttttcgagcaaatacctct	CRISPR spacer
gataccattttttcgagcaattacacca	Protospacer
   ***************** *** .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2255254 : 2293351

Burkholderia_phage(71.88%)

protease,portal,tail,holin,terminase,capsid,integrase,head

attL 2253557:2253582|attR 2293571:2293596

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2253557:2253582	attL	NA	NA	NA	NA
WP_084909045.1\|2255254_2255926_-	DUF159 family protein	Q8W6R8	Burkholderia_virus	1.9e-101	75.7
WP_084909046.1\|2255979_2256471_+	hypothetical protein	C7BGE3	Burkholderia_phage	3.1e-61	70.6
WP_084909047.1\|2256508_2257312_-	hypothetical protein	Q3HQV2	Burkholderia_phage	6.0e-46	40.6
WP_084909048.1\|2257368_2257860_-	DUF2514 family protein	Q6J1Q4	Burkholderia_virus	1.5e-36	57.4
WP_084909049.1\|2257856_2258276_-	glycoside hydrolase family protein	A0A1Q1PW74	Pseudoalteromonas_phage	2.0e-21	43.5
WP_059616700.1\|2258278_2258563_-\|holin	holin	C7BGD7	Burkholderia_phage	6.6e-40	91.5
WP_084909050.1\|2258617_2259337_-	hypothetical protein	A4JX18	Burkholderia_virus	6.9e-102	75.3
WP_084909051.1\|2259336_2259645_-	hypothetical protein	Q3HQU6	Burkholderia_phage	2.4e-48	88.2
WP_084909052.1\|2259641_2262953_-	host specificity protein J	Q3HQU5	Burkholderia_phage	0.0e+00	81.9
WP_084910056.1\|2262949_2263531_-\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	2.2e-82	83.5
WP_084909053.1\|2263533_2264280_-	C40 family peptidase	Q3HQU3	Burkholderia_phage	7.3e-123	81.4
WP_084909054.1\|2264328_2265012_-\|tail	phage minor tail protein L	A4JX13	Burkholderia_virus	3.2e-109	81.1
WP_133117931.1\|2265008_2266148_-	hypothetical protein	Q3HQU1	Burkholderia_phage	1.5e-18	35.5
WP_084909055.1\|2266157_2266496_-\|tail	phage tail protein	Q3HQU0	Burkholderia_phage	4.0e-52	85.7
WP_084909056.1\|2266495_2270020_-\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	2.1e-66	31.0
WP_059616679.1\|2270043_2270424_-	hypothetical protein	NA	NA	NA	NA
WP_084909057.1\|2270452_2270767_-	hypothetical protein	NA	NA	NA	NA
WP_063894703.1\|2270763_2271153_-	hypothetical protein	A0A2P1N0J3	Streptomyces_phage	9.4e-05	30.1
WP_084909058.1\|2271230_2271671_-	hypothetical protein	NA	NA	NA	NA
WP_059776123.1\|2271676_2272033_-	DUF3168 domain-containing protein	C4ML11	Xanthomonas_virus	1.4e-10	39.8
WP_084909059.1\|2272019_2272373_-\|head	phage head closure protein	NA	NA	NA	NA
WP_084909060.1\|2272375_2272915_-\|head,tail	phage gp6-like head-tail connector protein	C7BGH1	Burkholderia_phage	8.1e-23	43.4
WP_133117930.1\|2272927_2273296_-	hypothetical protein	NA	NA	NA	NA
WP_084909062.1\|2273355_2274636_-\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	6.7e-132	59.3
WP_084909063.1\|2274702_2275479_-\|protease	Clp protease ClpP	C7BGG9	Burkholderia_phage	4.1e-60	63.8
WP_084909064.1\|2275447_2276722_-\|portal	phage portal protein	C7BGG8	Burkholderia_phage	3.4e-120	51.9
WP_060363949.1\|2276718_2278362_-\|terminase	terminase large subunit	C7BGG7	Burkholderia_phage	4.3e-232	70.6
WP_059969840.1\|2278406_2278739_-	hypothetical protein	C7BGG6	Burkholderia_phage	9.4e-46	80.2
WP_084909065.1\|2279160_2279526_-	HNH endonuclease	C7BGG5	Burkholderia_phage	4.9e-40	60.2
WP_157721107.1\|2279526_2279718_-	hypothetical protein	NA	NA	NA	NA
WP_084909067.1\|2279881_2280289_-	hypothetical protein	C7BGG3	Burkholderia_phage	6.1e-31	51.1
WP_084909068.1\|2280301_2281312_-	hypothetical protein	C7BGG2	Burkholderia_phage	1.0e-63	43.4
WP_060025250.1\|2281350_2282721_-	replicative DNA helicase	C7BGG1	Burkholderia_phage	3.1e-151	60.7
WP_084910058.1\|2282747_2283299_-	hypothetical protein	C7BGG0	Burkholderia_phage	2.2e-44	57.1
WP_060063693.1\|2283835_2284300_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157721108.1\|2284686_2284827_+	hypothetical protein	C7BGF5	Burkholderia_phage	4.7e-07	69.6
WP_084909070.1\|2284980_2285187_+	hypothetical protein	C7BGF3	Burkholderia_phage	9.0e-23	82.4
WP_084909071.1\|2285502_2286057_+	PRTRC system protein E	NA	NA	NA	NA
WP_084909072.1\|2286075_2286558_+	PRTRC system protein C	NA	NA	NA	NA
WP_157721109.1\|2286736_2287816_+	PRTRC system protein F	NA	NA	NA	NA
WP_084909074.1\|2287812_2288523_+	PRTRC system protein B	NA	NA	NA	NA
WP_088511542.1\|2288527_2289331_+	PRTRC system protein A	NA	NA	NA	NA
WP_084909075.1\|2289327_2289708_+	hypothetical protein	NA	NA	NA	NA
WP_084909076.1\|2289692_2290478_+	PRTRC system ThiF family protein	NA	NA	NA	NA
WP_084909077.1\|2290479_2291283_+	hypothetical protein	C7BGF1	Burkholderia_phage	1.5e-81	62.6
WP_084909078.1\|2292076_2293351_-\|integrase	site-specific integrase	C7BGE7	Burkholderia_phage	1.2e-229	89.9
2293571:2293596	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020737

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020737_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020737_1

93770-93842

Orphan

Consensus_repeat	Method
GCTAAAGCGCTAACGCTGGTCGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020737_1

>merge|NZ_CP020737|1|93770-93842|CRISPRCasFinder
GCTAAAGCGCTAACGCTGGTCGACCGCGAAGCATGGGACCAGCGTAAGTGCTAAAGCACTAACGCTGGTCGAC

>NZ_CP020737|1|1|93770-93842|CRISPRCasFinder
GCTAAAGCGCTAACGCTGGTCGAC	CGCGAAGCATGGGACCAGCGTAAGT
GCTAAAGCACTAACGCTGGTCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020737.1\|WP_084899459.1\|92134_93649_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143404
NZ_CP020737.1\|WP_084906306.1\|99841_100816_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP020737.1\|WP_084899467.1\|96028_96808_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP020737.1\|WP_084899478.1\|101714_102872_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380556
NZ_CP020737.1\|WP_084899449.1\|88274_88583_-\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NZ_CP020737.1\|WP_084899457.1\|91090_91990_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP020737.1\|WP_084899481.1\|103065_104121_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP020737.1\|WP_084899484.1\|104125_105910_+\|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|223488
NZ_CP020737.1\|WP_084899444.1\|85520_87008_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|182388
NZ_CP020737.1\|WP_084899486.1\|105906_106662_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP020737.1\|WP_084899473.1\|97636_98836_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380550
NZ_CP020737.1\|WP_084899452.1\|88703_89666_-\|phenylalanine-4-monooxygenase	unknown	unknown	gnl\|CDD\|237020
NZ_CP020737.1\|WP_006401494.1\|87137_87830_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP020737.1\|WP_084899470.1\|96804_97560_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP020737.1\|WP_084899447.1\|87953_88184_+\|DUF3717-domain-containing-protein	unknown	unknown	gnl\|CDD\|378869
NZ_CP020737.1\|WP_084899463.1\|93854_95540_+\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|235000
NZ_CP020737.1\|WP_084899476.1\|98957_99842_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223633
NZ_CP020737.1\|WP_084899441.1\|84917_85439_+\|SET-domain-containing-protein-lysine-N-methyltransferase	unknown	unknown	gnl\|CDD\|380916
NZ_CP020737.1\|WP_010093131.1\|89735_90221_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP020737.1\|WP_084899454.1\|90287_90821_-\|class-IV-adenylate-cyclase	unknown	unknown	gnl\|CDD\|143628

Protein	Function_ID	Function_description	E-value
NZ_CP020737.1\|WP_084899459.1\|92134_93649_+\|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase	gnl\|CDD\|143404	cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD.	0
NZ_CP020737.1\|WP_084906306.1\|99841_100816_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.31298e-64
NZ_CP020737.1\|WP_084899467.1\|96028_96808_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	2.02925e-110
NZ_CP020737.1\|WP_084899478.1\|101714_102872_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380556	cd06333, PBP1_ABC_RPA1789-like, type 1 periplasmic binding-protein component (CouP) of an ABC system (CouPSTU; RPA1789, RPA1791-1793), involved in active transport of lignin-derived aromatic substrates, and its close homologs. This group includes RPA1789 (CouP) from Rhodopseudomonas palustris and its close homologs in other bacteria. RPA1789 (CouP) is the periplasmic binding-protein component of an ABC system (CouPSTU; RPA1789, RPA1791-1793) that is involved in the active transport of lignin-derived aromatic substrates. Members of this group has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP).	1.62958e-155
NZ_CP020737.1\|WP_084899449.1\|88274_88583_-\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	8.59463e-49
NZ_CP020737.1\|WP_084899457.1\|91090_91990_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.5655e-37
NZ_CP020737.1\|WP_084899481.1\|103065_104121_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	3.5488e-42
NZ_CP020737.1\|WP_084899484.1\|104125_105910_+\|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|223488	COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.65191e-114
NZ_CP020737.1\|WP_084899444.1\|85520_87008_-\|sensor-histidine-kinase	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	2.22021e-51
NZ_CP020737.1\|WP_084899486.1\|105906_106662_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	7.46626e-117
NZ_CP020737.1\|WP_084899473.1\|97636_98836_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380550	cd06327, PBP1_SBP-like, periplasmic substrate-binding domain of active transport proteins (substrate binding proteins or SBPs). Periplasmic substrate-binding domain of active transport proteins found in gram-negative, gram-positive bacteria, and archaea. Members of this group are initial receptors in the process of active transport across cellular membrane, but their substrate specificities are not known in detail. However, they closely resemble the group of AmiC and active transport systems for short-chain amides and urea (FmdDEF), and thus are likely to exhibit a ligand-binding mode similar to that of the amide sensor protein AmiC from Pseudomonas aeruginosa. Moreover, this binding domain has high sequence identity to the family of hydrophobic amino acid transporters (HAAT), and thus it may also be involved in transport of amino acids.	0
NZ_CP020737.1\|WP_084899452.1\|88703_89666_-\|phenylalanine-4-monooxygenase	gnl\|CDD\|237020	PRK11913, phhA, phenylalanine 4-monooxygenase; Reviewed.	8.03979e-159
NZ_CP020737.1\|WP_006401494.1\|87137_87830_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.18094e-72
NZ_CP020737.1\|WP_084899470.1\|96804_97560_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.86386e-105
NZ_CP020737.1\|WP_084899447.1\|87953_88184_+\|DUF3717-domain-containing-protein	gnl\|CDD\|378869	pfam12512, DUF3717, Protein of unknown function (DUF3717). This family of proteins is found in bacteria. Proteins in this family are typically between 75 and 117 amino acids in length. There is a conserved AIN sequence motif. There are two completely conserved residues (L and Y) that may be functionally important.	1.89185e-30
NZ_CP020737.1\|WP_084899463.1\|93854_95540_+\|choline-dehydrogenase	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_CP020737.1\|WP_084899476.1\|98957_99842_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|223633	COG0559, LivH, Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism].	3.97548e-71
NZ_CP020737.1\|WP_084899441.1\|84917_85439_+\|SET-domain-containing-protein-lysine-N-methyltransferase	gnl\|CDD\|380916	cd10518, SET_SETD1-like, SET domain (including post-SET domain) found in SET domain-containing proteins (SETD1A/SETD1B), histone-lysine N-methyltransferases (KMT2A/KMT2B/KMT2C/KMT2D) and similar proteins. This family includes SET domain-containing protein 1A (SETD1A), 1B (SETD1B), as well as histone-lysine N-methyltransferase 2A (KMT2A), 2B (KMT2B), 2C (KMT2C), 2D (KMT2D). These proteins are histone-lysine N-methyltransferases (EC 2.1.1.43) that specifically methylate 'Lys-4' of histone H3 (H3K4me).	2.90021e-35
NZ_CP020737.1\|WP_010093131.1\|89735_90221_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	9.80851e-42
NZ_CP020737.1\|WP_084899454.1\|90287_90821_-\|class-IV-adenylate-cyclase	gnl\|CDD\|143628	cd07890, CYTH-like_AC_IV-like, Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily. This subgroup contains class IV ACs and similar proteins. AC catalyzes the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. cAMP is a key signaling molecule which conveys a variety of signals in different cell types. In prokaryotes, cAMP is a catabolite derepression signal which triggers the expression of metabolic pathways including the lactose operon. Six non-homologous classes of ACs have been identified (I-VI). Class IV ACs are found in this group. In bacteria, the gene encoding Class IV AC has been designated cyaB and the protein as AC2. AC-IV occurs in addition to AC-I in bacterial pathogens such as Yersinia pestis (plague disease). The role of AC-IV is unknown but it has been speculated that it may be a factor in pathogenesis, perhaps providing cAMP for a secondary internal signaling function, or for secretion and uptake into host cells, where it may disrupt normal cellular processes. This subgroup belongs to the CYTH/triphosphate tunnel metalloenzyme (TTM)-like superfamily, whose enzymes have a unique active site located within an eight-stranded beta barrel.	3.0037e-41

>NZ_CP020737.1|WP_084899459.1|92134_93649_+|CoA-acylating-methylmalonate-semialdehyde-dehydrogenase
MSETELRPRLLTHFIGGRAVDGASDRYGDVFNPALGEVAARVPLASAAEVDAAVAAAQVAFPAWSEMAPIKRARVMFRFKELLDRHHDELAELITREHGKVFSDAKGEVMRGIEVVEFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVVGVTPFNFPMMVPCWMFPVALACGNTFVLKPSERDPSASLRLAQLLQEAGLPDGVFNVVHGDKTAVDALIAHPDVAALSFVGSTPIAEYIYTEGTKRGKRVQALGGAKNHLVVMPDADLDQAVDALIGAAYGSAGERCMAISVAVAVGDVGDALIERLVPRVRALKITNGMDPAAEMGPLVTATHRAKVAGYIDAGVAAGAKLVVDGRDHVVAGHEKGFFLGGTLFDRVTTDMSIYRDEIFGPVLAIVRVPDFASAVKLVNAHEFANGVSCFTSDGGIARAFSRQIQVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGVRFYTRYKSIMQRWPDSIAKGAEFTMPVAK
>NZ_CP020737.1|WP_084899457.1|91090_91990_-|LysR-family-transcriptional-regulator
MDLTLLRAFAAVAREGNLTRAAEQLHLTQPAVSLQIKHLQETLGVVLFTRTSRGLALTRDGQTLLPHAERALAAAADVQRAAAALRHEVRGRLRIGTILDPGFLRLGGFLRTLVETHPQIETALRHGMSGWVLEQVRAQALDVGYYIGQPGEDDPRDGALFHTVTLTHFQYRVLAPAGWKERVQRAQDWRALAALPWIWTPPQSAHHRLLTRRFADARAQPVKVAEVDQEQSMLDLVKSGIGLTLARDSTALAEAHAHALTIVERVTVPTELTFVTLAARRDEPAIAAALRLIETQWAG
>NZ_CP020737.1|WP_084899454.1|90287_90821_-|class-IV-adenylate-cyclase
MARNIEIKAHAREFDQLRERAAALATEAPLFYRQQDFFYDVPRGRLKLRRFEDGTPAELIFYQRDDRDGPKASYYTRSPVTNPDAMHALLATALTTRGIVTKERHVYLAGRTRIHLDRVDGLGDFIELEVVLAPDDDEAGGEAEAHDVFAKLGVSHDDLVAVAYVDLLNAGAPETAA
>NZ_CP020737.1|WP_010093131.1|89735_90221_+|Lrp/AsnC-family-transcriptional-regulator
MLELDHFDLALLDVLQRFGRATHQQLGEEVPLSPSQIGRRLQRLEAAGVIEGYRVMLRPEKLGLGVTAFTSLKLKHHGDSIIEQFQQQIDVLPEVLECHAVVGDADYLLRIVAPDLNALSQFVMKKLMRVPGVDSVRSNIVLTTFKRNGPLPLAHLEPGAA
>NZ_CP020737.1|WP_084899452.1|88703_89666_-|phenylalanine-4-monooxygenase
MRPSRADAALHLHASQPQRAEPNMSTVVTAKLQEQFDAGLETRADFTIDQPLERYGQVDHAVWSQLYARQTVLLQGRACDAFVSGLAKIDLPADRVPSFADVNRQLKPATGWEIVAVPGLVPDRVFFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMQAYGRIALAVADDPDALARLARLYWYTVEFGLIRDPRGTNGLSIYGAGIVSSKGESLYSLESAKPNRLGFDLERVMRTQYRIDTFQQTYFVIDDFAQLFALAHVDGRALADRLAGRPEHPAGAVLDTDRVLHRGTGAGWPDDAHA
>NZ_CP020737.1|WP_084899449.1|88274_88583_-|4a-hydroxytetrahydrobiopterin-dehydratase
MIHKLTSEERKTQLERLPHWTAMPGRDAIQRSLRFADFNEAFGFMTRVAIKAQEMNHHPEWFNVYNRVDVTLSTHDADGLTERDIALAHFIDQAGAHATPAA
>NZ_CP020737.1|WP_084899447.1|87953_88184_+|DUF3717-domain-containing-protein
MSDISIHDLEAAINFWRARSPSSGDELKLCEEASALSKPYALLIVQRQSAIQLEGLDPKARKAWDAYVHLKDGLES
>NZ_CP020737.1|WP_006401494.1|87137_87830_-|response-regulator-transcription-factor
MRLLLIEDDRPIARGIQSSLEQAGFTVDMVHDGIFAEQALAQNRHELVILDLGLPGIDGMTLLTRFRQTNRHTPVIVLTARDELNDRIQGLNSGADDYMLKPFEPAELEARIRAVMRRSGPHSDMPRPEVSLGGVRLSGVDRRIFNDDKPLELSPREFAVLEMLLLRHGRVVSKAQLQDHLTHFGGDLGDTAIEVYVHRVRKKLEQCRVEIVTVRGFGYLLQEIRQTASV
>NZ_CP020737.1|WP_084899444.1|85520_87008_-|sensor-histidine-kinase
MSSDPAVTSLRRSLLRRLAAPLSMLALMSGLIAYWLAWQYTQHVIDRSLADLATAISKQIQIAGPDAPFTVPPLAQAMFSDPAEALIYRISDGEQELAGDPKLPLQGTNVRRMHYAYVFEAEYDNRAVRVAQVRVDEVDGGKPMVVEVAQPVRHRYRIAAEFLVAIMMPLLLLLLAGWGIVWRVVNQQLGPLTHLADSLNRQTHTSLEPVDETDVPLEIRPLTSAMNALLGRLKTALDAQRKFIADAAHQLRTPLTAVKLHAEQAAIARDPQQTFAAVRELRAAADRAVRLSNQLLSLARAEPGEQAARFVDVDLAAMAFETGAEWVPRALAAHVDLGFQRSDDPPDDDQALLVRGNPVLLREVIANLLDNALKYVPLARPHGARITVNVGRAMLDAGAPAAEIVVEDNGPGVPASQQADLFKRFFRGDAQSGNGVETGAGLGLAIVHDIIAMHGGSVSYTDAPEGGSRFVVKVPLVAQAAQPASNAAPAAAPTH
>NZ_CP020737.1|WP_084899441.1|84917_85439_+|SET-domain-containing-protein-lysine-N-methyltransferase
MSSRRIAVRRSGVHGRGVFAVAPIKAGERVVEYKGERISWKEALRRHPHDPNEPNHTFYFALEEGGVIDGKVDGNSARWINHSCAPNCEAEELDGRVFIHALRDIEPEEELFYDYGLVIDAKLTKKLKREYACHCGAASCRGTLLATSDTDADAKKKKKQKDDAKSKDKKKKK
>NZ_CP020737.1|WP_084899463.1|93854_95540_+|choline-dehydrogenase
MNTERTLEGEFDYVIVGAGTAGCVLANRLTEDPDVSVLLLEAGGKDDYHWIHIPVGYLYCIGNPRTDWLYKTQPEAGLNGRALAYPRGRVLGGSSSINGMIYMRGQREDYDGWARDTGDAGWSWDSVLPIFRRSEDHHAGASDVHGAGGCWRVEKQRLRWEILESFAHAAQETGIPATDDFNGGDNAGVGYFEVNQKRGVRWSASKAFLRPAMSRPNLTVITGAQAQRVIFDGRRATGVEYRGDGTAFVARARAEVLLTSGAVNSPQLLELSGIGDGRRLQAFGIDVVQDLRGVGENLQDHLQLRMAFRVEGVRTLNTLAAHWWGKLAIGAEYALLQRGPMSMAPSQLGAFAKSDPDDPTLTRPDLEYHVQPLSLERFGEPLHSFNAFTASVCHLRPTSRGSIHIASADPGAAPAIAPNYLSTDHDRHVAANALRLTRRIASAPALARYRPEEILPGPRYRTEAELIEAAGAVGTTIFHPVGTCRMGRADDDGAVVDSRLRVRGVAGLRVVDASVMPSITSGNTNSPTLMIAERASDMIRADRRASRDAALVGRDAAVSAA
>NZ_CP020737.1|WP_084899467.1|96028_96808_+|ABC-transporter-ATP-binding-protein
MILGDTILETRGLTKEFKGFTAVNGVNLRVRRGAIHALIGPNGAGKTTCFNLLTKFLTPTAGQIVFNGIDITDERPAQVARRGIIRSFQISAVFPHLSALHNVRLGLQRALGTEFHFWRSERTLKALDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALEIATTLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVASGRTILMVEHNMNVIAGISDTITVLQRGEVLAEGSYAEVSKNPLVIEAYMGSADAALAGAHA
>NZ_CP020737.1|WP_084899470.1|96804_97560_+|ABC-transporter-ATP-binding-protein
MKRSEREERELSGVESGTPALEISGLEAWYGESHILHGVDLTVHRGEVVTLLGRNGAGRTTTLRAIMGLTGRRSGSIKVAGNETIGLATHRIAHYGVGYCPEERGIFSSLSCEENLMLPPLIGPREHAMSLDDIYAMFPNLASRRQSQGTRLSGGEQQMLAVARILRTGANLLLLDEISEGLAPVIVQTLAKMIVALKARGYTIVMVEQNFRFAAPLADRFYVMEHGRIVEHFGARELASKMPVLHDLLGV
>NZ_CP020737.1|WP_084899473.1|97636_98836_+|ABC-transporter-substrate-binding-protein
MKMKTLARACLALAAAAFTAGAAQAADTVKIGFITDMSGLYADIDGQGGLEAIRMAVADFGGKVLGKPIEVVYADHQNKADIAASKAREWMDRGGLDLLVGGTNSGTALAMNQVAAEKKKVYINIGAGADTLTNEQCTPYTVHYAYDTMALAKGTGSAVVKQGGKSWFFLTADYAFGKALEKNTSDVVKAHGGQVLGYVRHPLSASDFSSFLLQAQASKAQILGLANAGGDTINAIKAAKEFGITKTMKLAALLMFINDVHSLGLETTQGLVLTDSWYWNRDAASRQWAQRYFGKMKKMPSSLQAADYSSVTTYLKAVQAAGTTDSDKVMAELKKAKVNDFYAKGYIRADGSMIHDMYLMEVKKPSESKEPWDYYKVLATIPGDQAFTTKQETRCALWK
>NZ_CP020737.1|WP_084899476.1|98957_99842_+|branched-chain-amino-acid-ABC-transporter-permease
MEIFGIPLPAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFAHGALFMLGAMLAWMGLSYFGLPYWAMLVIAPVIVGAFGVVIERSMLRWLYKLDHLYGLLLTFGLTLVVEGVFRSIYGASGQPYDVPSQLAGATNLGFMFLPNYRAWVVVASLGVCLVTWFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMITLTYGFGVALAAFAGVLAAPVIQVSPLMGQPMIITVFAVVVIGGMGSILGSILTGLMLGVIEGFTRVFYPEASATVVFVIMAIVLLIRPAGLFGKER
>NZ_CP020737.1|WP_084906306.1|99841_100816_+|branched-chain-amino-acid-ABC-transporter-permease
MQRKVLYGVLLAALLVAPFAGAYPVFVMKVLAFALFAAAFNLLIGYTGLLSFGHAMFLATSGYLTGYTLQTLGFTPELGVLAGTAAATLLGLVVGLFAIRRQGIYFAMITLAFAQMVYFIYLQAPFTHGEDGLQGVPRGRLFGVLDLSSDLVLYYVVLAIIVAACAFIVRIVHSPFGQVLVAIKENEARAVSLGYDTDRFKLLAFVLSAGLAGLAGSLKVLVLGFETLGDAYWTMSGLVVLMTLVGGMGTLFGPLLGAALIVMLEDRLGDIGEWLASLTGIGWFHSLGESATIVTGVIFIACVLAFRRGIVGEMIARFKPLRAS
>NZ_CP020737.1|WP_084899478.1|101714_102872_+|ABC-transporter-substrate-binding-protein
MKMNRWMEAVLAAGLVCAAATASAQVKIGVTLSATGPAASLGIPEKNTIALLPKEIAGKSVQYVVLDDASDTSRAVQNVRKLIDEDHVDAIIGSSVTPNSLAMLDPVSQAKTPAISLAASAQIIAPMDAKRAWMFKVPQNDRLMADAIAGYMAKHGVKTIGFIGFADAYGDSWYSTFSAAAAANGLKIVSNERYNRTDASVMGQVLKLTSSNPDAVLIAGSGTPAALPAKTLKERGYKGKVYQTHGVANNDFLRVCGKDCEGEILPAGPVLVTDQLPDSNPVKKPSQAYKAAYEKAYGAGSVSTFGGHAWDAGQLLQRAIPEALKKGQPGTEAFREALRAALENVKDLPVSHGVINMTPADHNGFDTRARVMVQIVDGKWKLQTD
>NZ_CP020737.1|WP_084899481.1|103065_104121_+|branched-chain-amino-acid-ABC-transporter-permease
MDLSIAAILAQDGITTGAIYALLSLALVLVFSVTRVIFIPQGEFVAYGALTLAALQAQKFPATCWLLFVMGIACFVLEIGGLIRHRTRRHQLGRTLTTLGSRYVLLPLAVFALTRSYAAQPLPMLAQIALTLAIVVPMGPFVYRLVYQPVAEATTLLLLIVSVALHFAMVGLGLVMFGAEGSRTNAFSDATLSVGSLAISLQSVLVVVTAFVLIAALYVYFGRTIAGKALRATSVNRLGARLVGIGTTEAGRLAFTLAAGLGVLSGVLVGPLTTIYYDSGFLIGLKGFVGAIIGGLVSYPLAAAGSLLVGVLESYSSFWASAYKEVIVFTLIIPVLLWRSFATPHAEEDEE
>NZ_CP020737.1|WP_084899484.1|104125_105910_+|branched-chain-amino-acid-ABC-transporter-ATP-binding-protein/permease
MKKIVRNKAIWLFLVALFALPVLPGVLRVPEYWITLLNYIGLYAIVAIGLVLLTGVGGMTSFGQAAFVGIGAYATAYLTTRYGVSPWLGLIAGVVLTALVALVLGAVTMRLSGHFLPLGTIAWGLALFYLFGNLELLGKYDGINGIPALNLFGVVLDSGRSLYFLIWAVVLAAIVSVQNLLNSRPGRAIRALHGGGVMAEAMGVNTAWMRVVIFVYAAVLAAVSGFLYAHLQRAVNPTPFGLNHGIEFLFMAVVGGVAHVWGAVLGAAILTVLQDYLQTLLPKLLGSEGNFEVIVFGVLMVLLLQYARQGVWPFVARLFPRGSRAHVPHDAEPLPQRTRPATGETLLVVDTARKQFGGLVAVNDVSFEVNAGQIIGLIGPNGAGKSTTFNLVTGVLRPTSGAITFRGERIDGLTSREIVRRGIGRTFQHVKLLPGMTVLENVALGAHLRGTTGVWRSVVRLNAHEEAQLLAEAARQIRRVGLDAHMYDEAGSLALGQQRILEIARALCCDPTLLLLDEPAAGLRYKEKQQLADLLRRLKSEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGLPQDVQQDPAVLEAYLGGVE
>NZ_CP020737.1|WP_084899486.1|105906_106662_+|ABC-transporter-ATP-binding-protein
MMADTMPILDVHGLSVRYGKVEALHGAAIKVGAGQIVSVIGPNGAGKSTLLNAIMGALPVTGHASGVVVYRGTDVGALPVEQRVARGMCLVPEKRELFGTMSVEDNLVLGAYRRKQAGEANFLDQLDHVFALFPRLKERRNQAAGTLSGGERQMLAVGRALMGKPDLLMLDEPSLGLAPLIVKEIFHIISALRGTGVATLLIEQNARAALQISDYGYVLETGEFALEGQAAELAQNPQVIETYLGLAKKTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020737_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020737_2

1208671-1208822

Orphan

Consensus_repeat	Method
GCCGACAAGCCTGCCGACCGCGCCGA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP020737_2

>merge|NZ_CP020737|2|1208671-1208822|CRISPRCasFinder
GCCGACAAGCCTGCCGACCGCGCCGATGCCGCCCCGAAACCCGCCGACAAGGCCGTCGAGCGGACCGATGCCGCGCCGCGTGCAGCCGACAAGCCTGCCGACCGCGCCGACACCGCGCCTCACGCGGCCGACAAGGCCGCCGAGCGCGCCAC

>NZ_CP020737|2|2|1208671-1208822|CRISPRCasFinder
GCCGACAAGCCTGCCGACCGCGCCGA	TGCCGCCCCGAAACCC
GCCGACAAGGCCGTCGAGCGGACCGA	TGCCGCGCCGCGTGCA
GCCGACAAGCCTGCCGACCGCGCCGA	CACCGCGCCTCACGCG
GCCGACAAGGCCGCCGAGCGCGCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020737.1\|WP_084901730.1\|1218874_1219462_+\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|182763
NZ_CP020737.1\|WP_084901698.1\|1202995_1204468_+\|DegQ-family-serine-endoprotease	unknown	unknown	gnl\|CDD\|273938
NZ_CP020737.1\|WP_084901700.1\|1204478_1204715_+\|glutaredoxin-family-protein	unknown	unknown	gnl\|CDD\|368604
NZ_CP020737.1\|WP_084901690.1\|1198813_1200046_+\|beta-ketoacyl-ACP-synthase-II	unknown	unknown	gnl\|CDD\|235987
NZ_CP020737.1\|WP_084901705.1\|1204849_1206643_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_CP020737.1\|WP_084901720.1\|1213164_1214550_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP020737.1\|WP_084901693.1\|1200057_1200522_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020737.1\|WP_084901695.1\|1201922_1202978_+\|sugar-dehydratase	unknown	unknown	gnl\|CDD\|225570
NZ_CP020737.1\|WP_084901717.1\|1212024_1213053_+\|beta-N-acetylhexosaminidase	unknown	unknown	gnl\|CDD\|235417
NZ_CP020737.1\|WP_059757398.1\|1208979_1209879_+\|GTPase-Era	unknown	unknown	gnl\|CDD\|234624
NZ_CP020737.1\|WP_084901708.1\|1206659_1207553_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|182787
NZ_CP020737.1\|WP_084906446.1\|1201297_1201918_+\|sigma-E-factor-negative-regulatory-protein	unknown	unknown	gnl\|CDD\|367705
NZ_CP020737.1\|WP_084901712.1\|1209865_1210705_+\|DNA-repair-protein-RecO	unknown	unknown	gnl\|CDD\|234622
NZ_CP020737.1\|WP_084901725.1\|1215508_1216702_-\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	unknown	unknown	gnl\|CDD\|378385
NZ_CP020737.1\|WP_084901714.1\|1211559_1212009_+\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NZ_CP020737.1\|WP_084901727.1\|1216780_1218793_+\|excinuclease-ABC-subunit-UvrC	unknown	unknown	gnl\|CDD\|234792
NZ_CP020737.1\|WP_084901722.1\|1214820_1215378_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NZ_CP020737.1\|WP_004197638.1\|1198423_1198663_+\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|179197
NZ_CP020737.1\|WP_076481645.1\|1210701_1211475_+\|pyridoxine-5'-phosphate-synthase	unknown	unknown	gnl\|CDD\|235380
NZ_CP020737.1\|WP_010091835.1\|1200613_1201213_+\|RNA-polymerase-sigma-factor-RpoE	unknown	unknown	gnl\|CDD\|131985

Protein	Function_ID	Function_description	E-value
NZ_CP020737.1\|WP_084901730.1\|1218874_1219462_+\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	gnl\|CDD\|182763	PRK10832, PRK10832, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase.	4.12056e-48
NZ_CP020737.1\|WP_084901698.1\|1202995_1204468_+\|DegQ-family-serine-endoprotease	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0
NZ_CP020737.1\|WP_084901700.1\|1204478_1204715_+\|glutaredoxin-family-protein	gnl\|CDD\|368604	pfam05768, DUF836, Glutaredoxin-like domain (DUF836). These proteins are related to the pfam00462 family.	4.39436e-19
NZ_CP020737.1\|WP_084901690.1\|1198813_1200046_+\|beta-ketoacyl-ACP-synthase-II	gnl\|CDD\|235987	PRK07314, PRK07314, beta-ketoacyl-ACP synthase II.	0
NZ_CP020737.1\|WP_084901714.1\|1211559_1212009_+\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	1.48424e-54
NZ_CP020737.1\|WP_084901720.1\|1213164_1214550_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	8.33696e-132
NZ_CP020737.1\|WP_084901705.1\|1204849_1206643_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_CP020737.1\|WP_084901695.1\|1201922_1202978_+\|sugar-dehydratase	gnl\|CDD\|225570	COG3026, RseB, Negative regulator of sigma E activity [Signal transduction mechanisms].	4.84293e-82
NZ_CP020737.1\|WP_084901717.1\|1212024_1213053_+\|beta-N-acetylhexosaminidase	gnl\|CDD\|235417	PRK05337, PRK05337, beta-hexosaminidase; Provisional.	0
NZ_CP020737.1\|WP_059757398.1\|1208979_1209879_+\|GTPase-Era	gnl\|CDD\|234624	PRK00089, era, GTPase Era; Reviewed.	2.8004e-170
NZ_CP020737.1\|WP_084901708.1\|1206659_1207553_+\|signal-peptidase-I	gnl\|CDD\|182787	PRK10861, PRK10861, signal peptidase I.	1.33796e-89
NZ_CP020737.1\|WP_084906446.1\|1201297_1201918_+\|sigma-E-factor-negative-regulatory-protein	gnl\|CDD\|367705	pfam03872, RseA_N, Anti sigma-E protein RseA, N-terminal domain. Sigma-E is important for the induction of proteins involved in heat shock response. RseA binds sigma-E via its N-terminal domain, sequestering sigma-E and preventing transcription from heat-shock promoters. The C-terminal domain is located in the periplasm, and may interact with other protein that signal periplasmic stress.	3.42538e-15
NZ_CP020737.1\|WP_084901712.1\|1209865_1210705_+\|DNA-repair-protein-RecO	gnl\|CDD\|234622	PRK00085, recO, DNA repair protein RecO; Reviewed.	5.35683e-81
NZ_CP020737.1\|WP_084901725.1\|1215508_1216702_-\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	gnl\|CDD\|378385	pfam10093, EarP, Elongation-Factor P (EF-P) rhamnosyltransferase EarP. This entry includes family members such as EarP enzymes which are essential for post-translational activation of elongation factor P(EF-P). It was identified as EF-P arginine R32 specific rhamnosyl transferase in Shewanella oneidensis using dTDP-beta-L-rhamnose as donor substrate. This was further confirmed for Pseudomonas aeruginosa, Pseudomonas putida, and Neisseria meningitidis. As for S. oneidensis and P. aeruginosa, EarP enzyme acts as an inverting glycosyltransferase, thus mediating the formation of an alpha-L-rhamnosidic linkage. Structural analysis show that EarP is composed of two opposing domains with Rossmann folds, thus constituting a B pattern-type glycosyltransferase (GT-B) and provide basis for arginine glycosylation by EarP. Mutational analysis of efp and earP genes, resulted in a substantial decrease in the production of rhamnolipids and pyocyanin (important factors for colonization and invasion during infection) of P. aeruginosa. Collectively this indicates that EarP and EF-P are essential for P. aeruginosa pathogenicity.The protein family is also annotated in the CaZy Database as GT104.	0
NZ_CP020737.1\|WP_084901727.1\|1216780_1218793_+\|excinuclease-ABC-subunit-UvrC	gnl\|CDD\|234792	PRK00558, uvrC, excinuclease ABC subunit UvrC.	0
NZ_CP020737.1\|WP_084901722.1\|1214820_1215378_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	4.22976e-95
NZ_CP020737.1\|WP_004197638.1\|1198423_1198663_+\|acyl-carrier-protein	gnl\|CDD\|179197	PRK00982, acpP, acyl carrier protein; Provisional.	4.90677e-35
NZ_CP020737.1\|WP_076481645.1\|1210701_1211475_+\|pyridoxine-5'-phosphate-synthase	gnl\|CDD\|235380	PRK05265, PRK05265, pyridoxine 5'-phosphate synthase; Provisional.	3.59369e-150
NZ_CP020737.1\|WP_010091835.1\|1200613_1201213_+\|RNA-polymerase-sigma-factor-RpoE	gnl\|CDD\|131985	TIGR02939, Sigma_factor_ECF_subfamily, RNA polymerase sigma factor RpoE. A sigma factor is a DNA-binding protein protein that binds to the DNA-directed RNA polymerase core to produce the holoenzyme capable of initiating transcription at specific sites. Different sigma factors act in vegetative growth, heat shock, extracytoplasmic functions (ECF), etc. This model represents the clade of sigma factors called RpoE. This protein may be called sigma-24, sigma-E factor, sigma-H factor, fecI-like sigma factor or alternative sigma factor AlgU.	1.65388e-102

>NZ_CP020737.1|WP_084901708.1|1206659_1207553_+|signal-peptidase-I
MNFALILFVLVALTGVAWVADKMVFLPQRRRAADAAIDAFDQQQSRIDKRFADENAVQTRSKLRDEKLRQPWWLEYTASFFPVILAVFVVRSFIVEPFKIPSGSMVPTLLVGDFILVNKFDYGLRMPITNTKITQGRPLERGDVVVFRYPKDESVDYIKRVIGLPGDTVAYQDKQLTINGKPVPETPLADFFDDERQNYAKQFEESLGGRKNAILNNPAVPPFVMGAYDYPYRDNCTYNSRGVICKVPAGHYFMMGDNRDNSADSRYWGFVPDQNIVGRAFFIWMNFSDLKRIGSFN
>NZ_CP020737.1|WP_084901705.1|1204849_1206643_+|elongation-factor-4
MDHIRNFSIIAHIDHGKSTLADRIIQVCGGLADREMEAQVLDSMDIERERGITIKAQTAALSYRARDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPAANPENAIEEIEDVIGIDAMDATRCSAKTGLGVEDVLEALIAKVPPPKGDPAAPLQALIIDSWFDNYVGVVMLVRIVNGTLRPKEKIKLMATGAQYPVEHVGVFTPKSRNLESLSAGQVGFIIAGIKELNAAKVGDTVTHAAKSAAEPLPGFKEVKPQVFAGLYPVEANQYDALRESLEKLKLNDASLQYEPEVSQALGFGFRCGFLGLLHMEIVQERLEREFDMDLITTAPTVVYEVVQSDGTTIMVENPAKMPEPARIGEIREPIVTVNLYMPQDYVGSVITLCEQKRGVQINMQYHGRQVQLTYEIPMAEIVLDFFDRLKSVSRGYASMDYEFKEYRSADVVKVDMLINGDKVDALSIIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQAAIGAHIIARENIKALRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKQVGSVEIPQEAFLAILRVEDK
>NZ_CP020737.1|WP_084901700.1|1204478_1204715_+|glutaredoxin-family-protein
MFTLYGRGWCHLCDDMRDALAPVAAEFGVAVDYVDIDADAALVARYDEDVPVLLLDGAEVCRHRFDEIRVRNALAARR
>NZ_CP020737.1|WP_084901698.1|1202995_1204468_+|DegQ-family-serine-endoprotease
MMKLTLRKWLAVAAVAACLPLMPHSAAAAPAASLPDFADLVEKVGPAVVNIRTTANVPTGGPRGVLPPGFDNGDMSEFFRRFFGIPLPQAPGNPKNAPQQPDNPPDTEQNRGVGSGFIVSADGYVMTNAHVVDDADTIYVTLTDKREFKAKLIGVDDRTDVAVVKIQASNLPVVAIGDSNKVRVGEWVVAIGSPFGLDNTVTAGIVSSKSRNTGDYLPFIQTDVAVNPGNSGGPLINMQGEVIGINSQIYSRTGGFMGISFAIPIDEAMRVADQLKATGKVTRGRIAVAIGEVTKDVADSIGLPKAEGALVSSVEPGGPADKAGVQPGDIILKFNGKPVDTASDLPRMVGDTKPGVKATISVWRKGQARDLPIMIAETPADTAAKADPGKKTPQKPRQSNALGLTVSDISADQLKALKLKSGVQVDGVDGPAARAGLQRGDIVLRVGDTDITSAKQFADVTAQLDPQKAVAVLVRRGDNTQYFPLRPRQK
>NZ_CP020737.1|WP_084901695.1|1201922_1202978_+|sugar-dehydratase
MRTLRLNHTISGWKRLPALLLCAAALLSVQSLQANAQQPDDPVATRKAVADWLDRIQQAAQQQSYEGTFVYQRGGYVQSSRIAHVAARDGEFERIESLDGKPRKLLRHNDELYTFVPERKLCVVERRQARDSFPALLGASGEHVMSVYDAKLLGKDRVAGLDAQVVELAPKDGYRFTYKLWADARTGLLLRSQTLDASDHVLEQIAFSQLQMGGAGAADKSAIMSGMRNLGGWTVVRPPVAPVDMEAQGWQLAPSIAGFQKIREVRRPMAARDAGDPPIPVDQAVFTDGLATVSVFVEPAEKNTRKEGAGSTGATHVLVKRRGGYWITVLGEVPPATLQQFASAIEYKSSK
>NZ_CP020737.1|WP_084906446.1|1201297_1201918_+|sigma-E-factor-negative-regulatory-protein
MGSVNTQSQACPRGERLSALVDGEMFDGPDHGQFLAELDRADRAAWAHYHLIGDALRSDELALAPAMSASFTARLSVRLEAEPHLLAPAAAPVSRRLLSLRRRVVPAFAVAAAAATLTWIVVPQMQTASAPGAVQVASAGAPQQNGLQRVTVAQAPSQQGLQEANIIRDASLDQYLEAHQQFAQQPVVTGSMPLIRAAVTTTTPSQ
>NZ_CP020737.1|WP_010091835.1|1200613_1201213_+|RNA-polymerase-sigma-factor-RpoE
MSEKEIDQVLVERVQKGDKAAFELLVSKYHRKIIRLISRLVRDPAEVEDVAQDAFIKAYRALPQFRGESAFYTWLYRIAVNTAKNYLATQGRRAPTSTEADAEEAETFSDADQLRDINTPESMLMSKQIAETVNAAMAVLPEELRQAITLREIEGLSYEEIAEMMGCPIGTVRSRIFRAREAIAAKLRPLLDTPEGKRW
>NZ_CP020737.1|WP_084901693.1|1200057_1200522_+|hypothetical-protein
MTNPVGITAGCPQRFTLRASAVLYVVLAVFVASAAVAVHLFVAPRAGVAAGAGAMAATAALLAFGTVRACARRLPAELRVDAFGEVAAFGRAGQLLARGRVTGYAHWSSLLLVLSVGQGGRRARPLLLPADALDAPSFSALSVLARTATAERPA
>NZ_CP020737.1|WP_084901690.1|1198813_1200046_+|beta-ketoacyl-ACP-synthase-II
MSRRRVVVTGLGLISPVGNSVADGWANLVAGKSGIATVTKFDPSNLAVHFAGEVKGFSAEEYIPAKEARNMDTFIHYGIAAGVQAFKDSGLEVTEANAERIGVMVGSGIGGLPMIEDTHQTYIDRGARRISPFFVPGSIINMISGHLSIMFGLKGPNLAAVTACTTGLHSIGLAARLIQAGDADVMVAGGAESTVSPLGIGGFAAARALSTRNDDPATASRPWDKDRDGFVLGEGAGVMVLEEYESAKARGAKIYAEVAGFGMTGDAYHMTAPNMDGPRRCMVAALRDAGMNPDEVQYLNAHGTSTPLGDKNESDAVKAAFGDHAYKLVVNSTKSMTGHLLGGAGGLESVFTVLALHNNVSPPTINIFNQDPECDLDYCANTARDMKIDVAVKNNFGFGGTNGTLVFKRA
>NZ_CP020737.1|WP_004197638.1|1198423_1198663_+|acyl-carrier-protein
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEAEKITTVQQAIDYARANVKA
>NZ_CP020737.1|WP_059757398.1|1208979_1209879_+|GTPase-Era
MNATAPTGFRCGMIAIVGRPNVGKSTLMNALVGQKISITSRKAQTTRHRITGINTTEDAQFIFVDTPGFQTRHSTALNRSLNRAVTSTLTSVDAILFVIEAGRFGPDDQKVLDLIPPGVPTLLIANKLDRVNDKTTLYPFMQQVSALREFTEIVPLSAKHVEDIQRLMQTVKPYLPEGEPIYGEDDLTDRSSRFLAAEILREKVFRWTGDELPYTSTVIIDKFEEEGRLKRVFATILVERDTHKAMVIGKKGAKLKQISTEARMDMEKLFDGPVYLETFVKVKSGWADNEAGLRAYGYE
>NZ_CP020737.1|WP_084901712.1|1209865_1210705_+|DNA-repair-protein-RecO
MGTNDALTSTEDAVAPGADDAPPPAAPPAPPRKARRATSRTSDFRVAEQPAFVLHSYPYRETSLIIDVLTRDHGRLALVAKGAKRPHSALRGVLQTFQPLLLSWSGKSEMRTLTGAEWVGGMLPLAGDALLCGFYANELLVKFCAREDPQPPLFNHYVVTLTRLAHGEPAVQVLRSFERVLLRETGYAMALNRTVARRAVEADRLYVFDPERGVRGADDDVPSHWPVVSGQTLLDMEQDDYHRVQTVAQSKTLMRFLLNTYLGGTPLATRQILIDLQNL
>NZ_CP020737.1|WP_076481645.1|1210701_1211475_+|pyridoxine-5'-phosphate-synthase
MSFFLTSPTAIDLGVNIDHVATLRNARGTTYPDPIRAALAAEEAGADAITLHLREDRRHIVDADVRKLRPLLKTRMNLECAVTAEMLDIACEVKPHDACLVPEKREELTTEGGLDVAGRFEAVRAACKQLADAGVRVSLFIDPDETQIRAAHEAGAPVIELHTGRYADAHDAAEQQREYERIVAGVQAGAQLGLKVNAGHGLHYTNVQQIAAIDGIVELNIGHAIVAHAIFAGWDNAVREMKAIMVAARVAALHGAR
>NZ_CP020737.1|WP_084901714.1|1211559_1212009_+|holo-ACP-synthase
MAIYGIGTDIVQVSRIAAVLERTGGRFAEKVLGPDELRVFHARRARSEARGIAFLATRFSAKEAFSKAIGLGMHWPMTWRALQTLNQPSGEPYVVASGELADWLAARGITARVTVSDERDYAVSFVIAETGMRAADLPAATPPVPRSSS
>NZ_CP020737.1|WP_084901717.1|1212024_1213053_+|beta-N-acetylhexosaminidase
MKTTPGPVMLDVVGTALTRDDARRLAHPNTGGVILFARHFQNRAQLTALTDAIRAIREDVLIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDQDVLRATKVATAVGYILAAELRACGIDMSFTPVLDLDYGHSKVIGDRAFHRDPRVVTMLAKSVNHGLSLAGMANCGKHFPGHGFAEADSHVALPTDDRPLDTILKQDVAPYDWLGLSLAAVIPAHVIYTQVDARPAGFSRVWLQDILRGRLGFTGAIFSDDLSMEAAREGGTLTQAAEAALAAGCDMVLVCNQPEAAETVLNGLKAQPSADSVRRLKRMRARGKPARWDKLIAQPEYLGAQALLRDAFA
>NZ_CP020737.1|WP_084901720.1|1213164_1214550_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MPHALIVEDDPNSLSGLTALLAADGFSVDTATSLAEARTALGRSIPDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTGNATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRASLRHLGRFGALVGRSEAMQHVCDMIEHNARTETAVLFSGEAGTGKKLAARTLHDLSRRRKGPFVAFDCRTLAQVEHHGAALDSVLFGHERGAYDGAERRESGLFEQASGGTLFLDEITALPLVLQEALLQALDSQNFMRIGGTSPVASDFRLIAATRRPAREAVASGTLREDLWLRLDAASITMPPLRERDGDALSIADALIDELNREARATGRSTTDKRAAPGFVRECLSYEWPGNVRELQERVRFAYDASGDFIDTLRAGEASFSAGAALNGSSVQIKVGTPLSDVEDLLIRATLDAVGGTRHRAATLLGISPKTLYNKLQRMKVN
>NZ_CP020737.1|WP_084901722.1|1214820_1215378_-|elongation-factor-P
MKTAQELRVGNVVQIGSDAWVIAKTEYNKSGRNAAVVKMKMKNLLTNAGQESVYKADDKFDVVVLDRKEVTYSYFADPMYVFMDADYNQFEVEAEMMGDALHYLEDGMACEVVFYNEKAISVELPTILVREITYTEPAVKGDTSSGKVLKNAKLATGFELQVPLFCNTGDKIEIDTRTHEYRSRA
>NZ_CP020737.1|WP_084901725.1|1215508_1216702_-|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP
MPRTAPRPHDPTPRAPDETVACDIFCTVVDNFGDIGVCWRLARQLAHEHGWQVRLIVDDLRTFARLLPGVEPDALRQTADGVVIEHWHAEVGDAIEIADVVIEAFACELPAPYLAAMARRERRPVWINLEYLSAEDWVADFHLRPSPHPRYPLVKTFFFPGLSAGTGGVLKERDLDARRAAFDADTHARAAWWRRATGDAPPAPGTTVISLFAYENPAVDALLAQWRDSPSPVVALVPEGRVSPAVARFFGVESFGAGARASRGNLAAYGLAFVPQSDYDPLLWVGDLNLVRGEDSFVRAQWARKPFVWHIYPQADDAHLPKLDAALAHVGAGLADAPRDALARFWHAWNGAGTPDWADFWQHRAALQANADHWADALAAVGDLAGKLAEYAKSQLK
>NZ_CP020737.1|WP_084901727.1|1216780_1218793_+|excinuclease-ABC-subunit-UvrC
MTSPEAPEAPFEPKKILAQLPHLPGVYRYYDAAGAVLYVGKARDLKKRVSSYFTKTQLSPRIAMMVTRIARVETTVTRSEAEALLLENNLIKALAPRYNILFRDDKSYPYLKLTAHRFPRMAYYRGAVDKQNQYFGPFPSAWAVRESIQILQRVFQLRTCEDSVFNNRTRPCLLHQIGRCTAPCVGAISDEDYARDVSNAARFLLGRQSEVMKELEQKMHGFAAELKFEQAAAVRNQMSSLATVLHQQAIEVGSDSDVDILAVVAQGGRVCVNLAMVRGGRHLGDKAYFPTHVESALTLAEGGLEVEAEPAVEALPDQPEEDAAGARHAQASVEAEVLDAFIAQHYLGNRVPPVLVVSHAPASRDLLDLLSEQAGHKVALVRQPQGQRRAWLSMAEQNAGLALARLLSEQGSQQARTRALADTLSFENDDLAHLRIECFDISHTMGEATQASCVVYHHHKMQSGEYRRYNITGITPGDDYAAMRQVLTRRYEKMVEQAAQAAAVDDAAGIDGETTRQAEAASLLPNIVLIDGGKGQVEIARQVFTELGLDTSMLVGVAKGEGRKVGLETLVFADGRAPLELGKESAALMLVAQIRDEAHRFAITGMRAKRAKARQTSRLEELEGVGAKRRQRLLARFGGLRGVVAASVDELASVEGISRALAEQIYRQLH
>NZ_CP020737.1|WP_084901730.1|1218874_1219462_+|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase
MPFNFPIFLTWVRIVLIPLVVGVFYLPDTVMGGAHRNLAAALIFILAALTDWFDGYLARKWNQTSSFGAFLDPVADKLMVTAALLILVQISRVDAAIALVIVGREIAISALREWMAQIGASKSVAVNQLGKFKTACQMVAIPMLLYYGPLPLGFATLDTRVWGEWLMYLAAVLTIWSMLYYMKLAWPQIRERSRV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020737_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020737_3

2355817-2355935

Orphan

Consensus_repeat	Method
AGCGAGCGTGGGGGTCGTGCCAGCCTCCGCCGGGCCGCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020737_3

>merge|NZ_CP020737|3|2355817-2355935|CRISPRCasFinder
AGCGAGCGTGGGGGTCGTGCCAGCCTCCGCCGGGCCGCCCCCAGGAGGCTGGCCGCCCCCTCGGGGGGCAGCGAGCAAAGCGAGCGTGGGGGTCGTGCCGGCCTCCGCCGGGCCGCCCC

>NZ_CP020737|3|3|2355817-2355935|CRISPRCasFinder
AGCGAGCGTGGGGGTCGTGCCAGCCTCCGCCGGGCCGCCCC	CAGGAGGCTGGCCGCCCCCTCGGGGGGCAGCGAGCAA
AGCGAGCGTGGGGGTCGTGCCGGCCTCCGCCGGGCCGCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020737.1\|WP_084903868.1\|2349554_2350964_-\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NZ_CP020737.1\|WP_084903866.1\|2347583_2348048_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP020737.1\|WP_084903898.1\|2363846_2365376_-\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP020737.1\|WP_084903858.1\|2345619_2346033_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|225016
NZ_CP020737.1\|WP_084903887.1\|2359797_2360130_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|131894
NZ_CP020737.1\|WP_084903885.1\|2359176_2359527_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235777
NZ_CP020737.1\|WP_084903880.1\|2355996_2357040_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226642
NZ_CP020737.1\|WP_084903875.1\|2353033_2354662_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226641
NZ_CP020737.1\|WP_084903882.1\|2357092_2358967_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173862
NZ_CP020737.1\|WP_084903864.1\|2346690_2347569_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP020737.1\|WP_084903895.1\|2362757_2363645_-\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP020737.1\|WP_084903872.1\|2352227_2352905_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|223862
NZ_CP020737.1\|WP_084903877.1\|2354658_2355756_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226690
NZ_CP020737.1\|WP_084903861.1\|2346068_2346566_-\|ribonuclease-E-activity-regulator-RraA	unknown	unknown	gnl\|CDD\|236487
NZ_CP020737.1\|WP_084903900.1\|2365813_2367058_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223717
NZ_CP020737.1\|WP_084903890.1\|2360130_2360745_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_CP020737.1\|WP_084903893.1\|2360744_2362754_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP020737.1\|WP_084903903.1\|2367619_2368672_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP020737.1\|WP_084906590.1\|2343902_2345495_+\|malate-synthase-A	unknown	unknown	gnl\|CDD\|236432
NZ_CP020737.1\|WP_084903871.1\|2351215_2352139_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666

Protein	Function_ID	Function_description	E-value
NZ_CP020737.1\|WP_084903868.1\|2349554_2350964_-\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NZ_CP020737.1\|WP_084903866.1\|2347583_2348048_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	7.50703e-10
NZ_CP020737.1\|WP_084903898.1\|2363846_2365376_-\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	0
NZ_CP020737.1\|WP_084903858.1\|2345619_2346033_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|225016	COG2105, COG2105, Uncharacterized conserved protein [Function unknown].	1.56794e-19
NZ_CP020737.1\|WP_084903887.1\|2359797_2360130_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|131894	TIGR02847, Cytochrome_bo3_ubiquinol_oxidase_subunit_4, cytochrome o ubiquinol oxidase subunit IV. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	1.01823e-35
NZ_CP020737.1\|WP_084903885.1\|2359176_2359527_-\|hypothetical-protein	gnl\|CDD\|235777	PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein.	0.00118628
NZ_CP020737.1\|WP_084903880.1\|2355996_2357040_-\|ABC-transporter-permease-subunit	gnl\|CDD\|226642	COG4174, COG4174, ABC-type uncharacterized transport system, permease component [General function prediction only].	0
NZ_CP020737.1\|WP_084903875.1\|2353033_2354662_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226641	COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only].	0
NZ_CP020737.1\|WP_084903882.1\|2357092_2358967_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173862	cd08497, PBP2_NikA_DppA_OppA_like_14, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP020737.1\|WP_084903864.1\|2346690_2347569_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.15091e-31
NZ_CP020737.1\|WP_084903895.1\|2362757_2363645_-\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	2.97032e-155
NZ_CP020737.1\|WP_084903872.1\|2352227_2352905_-\|C40-family-peptidase	gnl\|CDD\|223862	COG0791, Spr, Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane].	1.0913e-40
NZ_CP020737.1\|WP_084903877.1\|2354658_2355756_-\|ABC-transporter-permease	gnl\|CDD\|226690	COG4239, COG4239, ABC-type uncharacterized transport system, permease component [General function prediction only].	1.54162e-168
NZ_CP020737.1\|WP_084903861.1\|2346068_2346566_-\|ribonuclease-E-activity-regulator-RraA	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	1.26292e-92
NZ_CP020737.1\|WP_084903900.1\|2365813_2367058_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223717	COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion].	9.35843e-42
NZ_CP020737.1\|WP_084903890.1\|2360130_2360745_-\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	1.23729e-96
NZ_CP020737.1\|WP_084903893.1\|2360744_2362754_-\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP020737.1\|WP_084903903.1\|2367619_2368672_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.6426e-73
NZ_CP020737.1\|WP_084906590.1\|2343902_2345495_+\|malate-synthase-A	gnl\|CDD\|236432	PRK09255, PRK09255, malate synthase; Validated.	0
NZ_CP020737.1\|WP_084903871.1\|2351215_2352139_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	7.58726e-66

>NZ_CP020737.1|WP_084903877.1|2354658_2355756_-|ABC-transporter-permease
MSQAAAPSRLDAARARVSPSPARRVWRRFTQQRLGYWSFVIFIVAFAASLAAPLWSNDKPLVVRYDGHYYFPMFNTYPETTFGGDFPTPADYLDPYVRKRLEAPGNFVVYPPNRYHYDTLNYFSNVPNPAPPSRENWLGTDAQGRDLLARLVYGFRVSVEFGLVLTLIGTLLGIAAGAVQGFFGGRVDIVGQRLIEIWSSLPELYLLIIFASIFEPSFVLLIVLLSLFGWIGLADYVRAEFLRNRTQDYVRAARAMGLTNWQIIWRHVLPNSLTSVITFLPFRMSGAILALTSLDFLGLGVPPPTPSLGELLAQGKGNLDAWWISLSTFGVLVATLLLLTFMGDALRNALDTRIADSVRAAGGQR
>NZ_CP020737.1|WP_084903875.1|2353033_2354662_-|ABC-transporter-ATP-binding-protein
MSAATVSAPSQDEPLLSLERLQVRFGDTVAVDDVTLAIGHGERVALVGESGSGKSVTALAILRLLRDAEVGGTIRFAGQDLAARSEREMRGLRGSDIAMIFQEPMTALNPLYTIGAQIGETIQLHDGVPAAQARRRAIALLARTGIAEPERRVDSYPHQLSGGQRQRAMIAMALACRPRLLLADEPTTALDVTIRAQIVELLLELQREEAEKRGMAILMITHDLNLVRHFAERVAVMERGRLVESGAVERVFAAPEHPYTQRLLNSRPQRAVVPVMPIAPVLLDARHVSVQFARKRPGLAGWFKSAPVAAVSDVSVSVRQGETLGVVGESGSGKSTLAMALLGLQKTAHGEIEFQGRALSSYRGREQAALRSNLQVVFQDPFSSLSPRHTIERIVGEGLELHRPDLSADARRAKSLAVLREVGLDRTVMHRYPHEFSGGQRQRIAIARALVLEPRILILDEPTSALDVSIQQQVLKLLASLQQKYNLGYVFISHDLEVIGAMAHRVAVMQGGAIVESGDVADIFTKPSHPYTQKLLKAVWKA
>NZ_CP020737.1|WP_084903872.1|2352227_2352905_-|C40-family-peptidase
MQHRSLTQACARAVAGMFIGVLFAATSGAFADEAGSFNQNATNSTQSGSASTQNTQANASSSTGGAKSFLSGMAGKAGDVVVGALNMIGVRYRWGGNTPDSGLDCSGFVRYVFQDTLGMSLPRRAEEMSRVGEKVRVSELKPGDLVFFNTMRRTFSHVGIYIGDNKFVHSPSTGSTIRVDDLDSTYWEKRFNGARRIETQFPMKADDLRQRVRATLGDDAANGSN
>NZ_CP020737.1|WP_084903871.1|2351215_2352139_+|patatin-like-phospholipase-family-protein
MSSPRLSRRQFTIACASASLAACTSLGGKSRPDNAATGQPHDKPVKIAIALGGGAARGFAHIGVLKGLEARGIPIEIVAGTSAGSVVGALYASGMNALQLNKLALEMDQSAISDWALPFRSRGLLQGVALQNFINKSLNNRPIEKMAKPLGVVATDLQNGQPILFQQGNTGLAVRASCSVPSVFEPVKIGNREYVDGGLVSPVPASYARKMGATFVIAVDISSRPDGAPTGNPIEMLLQTFTIMGQTIKTYELDKYADVVIRPNLNAMGGSDFNQRNAAILAGEEAVARIMPELQRKLAAATAATAA
>NZ_CP020737.1|WP_084903868.1|2349554_2350964_-|glutamate--tRNA-ligase
MTRPVRTRFAPSPTGFIHLGNIRSALYPWAFARKMKGTFVLRIEDTDVERSSTEAVDAILEGMQWLDLDFDEGPFYQMQRMDRYREVLAKMLEEGLAYPCYMSTEELDALRERQREAGLKPRYDGTWRPEPGKVLPEPPAGVKPVLRFRNPLTGTVAWDDAVKGRVEISNEELDDLVIARPDGTPMYNFCVVVDDLDMGITHVIRGDDHVNNTPRQINILRALGGEVPVYAHLPTVLNEQGEKMSKRHGAMSVMAYRDAGYLPEAVVNYLARLGWSHGDAEIFSREQFVEWFDLEHLGKSPAQYDHNKLNWLNNHYIKEADNARLAALSKPFFDALGIDDAALASGPDLDAVIGLMKDRASTLKEIAEGAAMFYRAPAPDAEALAQHVTDAVRPALAELAAALKTAEWSKEAISAALKAALAAHKLKMPQLAMPVRLLVAGTTHTPSIDAVLMLFGRDAVVSRIEAALA
>NZ_CP020737.1|WP_084903866.1|2347583_2348048_-|GNAT-family-N-acetyltransferase
MLDPTDLRLLYQLRPAEPGDFPFAEALTHGNMGGYYKRHGLVWRSDLFYASWRESENFILEADGERIGVLRVTEEGDSLHIRDVQIAAGHRGHGAGTYLLEMSHRWARARGLNELQLRVFVDNPAARLYLRMGYRVTGSRFAQFGAIRHMVRRV
>NZ_CP020737.1|WP_084903864.1|2346690_2347569_+|helix-turn-helix-transcriptional-regulator
MNPSARADEPAHRDTIDIPPEFAPTPVHPMRVRARPVPAGARIPRHTHAWAQLAYASRGVLRMATTGTTWMVPPSRAIWVPPHVTHEVLIVEDAYLRTLYIDESIVPGGLDACRVVEVTGLLRELIVALDARDLGAARERLLCALVLDELSHAEPLPLSVPMPDEKRLRTLCEAVLAQPAHAESLEHWAGEVGASTRTISRLFKQELGVSFSQWRQQALLARAIPLLNQGRPLSHIARELGYQSQSAFSAMFRRAFGESPRAFMLRGHAHEAAEDVTGSDGHPNDDAADRQP
>NZ_CP020737.1|WP_084903861.1|2346068_2346566_-|ribonuclease-E-activity-regulator-RraA
MTTFATTDLCDAHEERLTAGTLRVLAPALRPYGGAARFAGPAATLKLFEDNTLVRAALEQDGAGRVLVVDGGGSQRCALVGGNLGALAEKNHWAGIVVYGCVRDSAELRACNVGVLALATHPRKSDKRGAGERDVPVTVLGTRIAPGEWIYADEDGVLVSATPLT
>NZ_CP020737.1|WP_084903858.1|2345619_2346033_-|gamma-glutamylcyclotransferase
MRHVFVYGTLRAGEANDIAHAAARHGIAAPTLVGAAALPGELYDFGTYPGMVAVADRKTLVWGDVYEVDERLVPVLDEIERVYPGVDTLFSQEAANVELGGRQYACLYYPVAAHAVSDQPRIVSGDWVQHRREREAA
>NZ_CP020737.1|WP_084906590.1|2343902_2345495_+|malate-synthase-A
MTTTLTLPQGMAITGEIRPGYEAILTPAALELVAALHRTFEPRRHALLQARVERTKRLDAGERPDFLADTKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFEDSNAPSWTNQIDGQINLKDAIRRTISLEQNGKSYKLNDKVATLIVRPRGWHLDEKHVTVDGQRVSGGIFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQEQVGIPRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDLDFCLADRSKITMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDGYDGGWVAHPGLVPIAMDEFVKVLGDKPNQIAKQRDDVQIEGRNLLDFQPEAPITEAGLRNNINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELVRDYAKAELENVKRSVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
>NZ_CP020737.1|WP_084903880.1|2355996_2357040_-|ABC-transporter-permease-subunit
MWSYILKRLLLMIPTLVGVLTLTFVVIQFVPGGPVEQAVQELRKGATEQGAAPFGMRARTGVDPQQVAQLKVLYGFDKPPLERYVLMLKHFARFDLGDSYFRHQSVWSLIVQKLPVSISIGLWTFFLTYLISVPLGIAKAVRNGSPFDVATSLVVLVGYAIPGFVLGVLLLVLFGGGSFWQLFPLRGLTSDSFAQLSIAGKVLDYLWHIALPITASVVGNFAIITMLTKNAFLDEIRRQYVLTARAKGLSERRVLWKHVFRNAMLPLIVGFPGAFIGAFFTGSLLIETLFTLDGLGLLSYESVVRRDYPVVLGTLYLFTLIGLATKLISDLCYVWVDPRIQFENLER
>NZ_CP020737.1|WP_084903882.1|2357092_2358967_-|ABC-transporter-substrate-binding-protein
MTKGSPRSAAAPARSGVARAAGRAAAALLMQAVLAASAAHAAYAIAQYGEPKYPPGFTHFDYVNPDAPKGGTLVLANPSRMTSFDKFNPYTMRGNPAPGIEMLFESLATGSLDEPASAYGLLADDIAVAPDRLSVTFHLNPRARFSNGDPVTAADVKYSFDTLKSKQAAPQFAAYLGDIARAVIVDPATVRFEFRQRNRELPLIAASVPVFSRKWGLRADGTRIAFDQLAFEQPIGSGPYLIERNDNGRNITYRRNPTYWGADLPVRVGTHNFERIVYKLYGDNVTRLQGFKAGEYDVLVENIARNWVRHDVGKRFDSGELVKREFRQHNGAGMQGFMMNLRRPLFRDVRVRQALDLALDFEWLNRQLFYGGYTRLDSYFADTDLQATGMPGPGELALLDPLRAQLDPAVFGPMVAQPNTNPPGSLRANLLKARALLAQAGWTYRDGALRNAQGEPFTFEILDDAGSAFEPVVIAYQRNLAKLGITVKFRTADYALLQKRLDAFDYDMTTIRYLGVQVPGAEQFSRYSSKFADQPGSDNVIGLKSPAVDALLKALDAAQTREQLVDATRALDRVLMHGYYAVPQWYSTTHRVAYKRTLGYPQTLPLYYSAESWVVSTWWVKPGS
>NZ_CP020737.1|WP_084903885.1|2359176_2359527_-|hypothetical-protein
MKTLRVASLITGTAALLLSGAAMAGVNVGINVGVPAPVYVAPAPVYAPPPVVYQPAPVYGAPVYAAPAPAIVIGWHGDRYWDGRRYWGRDDWYRHHRGWDDRGHWDHDRGRHNGWR
>NZ_CP020737.1|WP_084903887.1|2359797_2360130_-|cytochrome-o-ubiquinol-oxidase-subunit-IV
MAHSHSSQLEAGHGSVGGYIAGFILSVLLTAASFGLVLGGVLSPHASLIALAVLAFVQIVVHLVYFLHMNSSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVTMNMMSR
>NZ_CP020737.1|WP_084903890.1|2360130_2360745_-|cytochrome-o-ubiquinol-oxidase-subunit-III
MLQKTLSANLVDHADDHDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAVETAALLLSSITYGFAMLGAHRGKRGTTLVWLAVTFVLGAAFLAMELREFSHLIAEGAGPQRSAFLSAFFTLVGTHGLHVTAGLVWMIVLAAQIAFGHALTERDIRRLTCLSLFWHFLDVVWICVFSFVYLASVI
>NZ_CP020737.1|WP_084903893.1|2360744_2362754_-|cytochrome-o-ubiquinol-oxidase-subunit-I
MFGKLTLSAIPFDQPIIMGAGAFMGLVVLGILAALTITGRWKWLWSEWLTSVDHKKIGVMYIIVAFIMLLRGFADAIMMRLQLALSYNAPGFLPPHHYDQIFTAHGVIMIFFMAMVFMVGLMNLIVPLQIGARDVAFPFINSLSFWMTAVSAILINISLVIGEFAQTGWLAYPPLSELQYSPGVGVDYYLWALQISGVGTLLTGVNFFVTIIKMRAPGMSLMKMPVFTWTALCTNVLIMASFPILTATLALLGLDRYFGMHFFTNEAGGNAMLYLNLIWAWGHPEVYILILPAFGIFSEVIATFAKKPLFGYKTMVYATCAIMVLSFLVWLHHFFTMGSGANVNAFFGIMTMIIAIPTGVKVFNWLFTMYRGRIEFTTPVLWTIGFMVTFTLGGMTGVMMAIPGADFVLHNSLFLIAHFHNVIIGGVLFGYLAGFNYWFPKAFGFKLNEKLGKAAFWFWQVGFYVAFVPLYVLGFMGMTRRLNHYDNPAWHPWLLVAAFGAVLVAIGIACQLLQLVVSIRNRNLPENRDTTGDPWGGRTLEWATTSPPPAYNFATIPQVRALDAFADMKARGEGQGKSAAYRDIHMPSNTCAGLVIGVFSLALGFALVWHIWWLAIAGLAGIVATLVIYSSRNNDGYYIPASTVRRIEEPRHAARTTAQRVDDVELETN
>NZ_CP020737.1|WP_084903895.1|2362757_2363645_-|ubiquinol-oxidase-subunit-II
MKRKALKGASRLLPLAVTLSLSGCNLDVLNPKGSIGAAEKSLIATSTWAMLIVVVPVILLTLFFAWRYRASNRNATYAPDWSHSTAIEVVIWTVPTLIILFLGVLTWKTTHELDPYKPLESSVKPIDVEVVALDWKWLFIYPELGIASVNQLAIPVGTPVNFRITSDSVMNSFFIPQLGGQVYAMAGMQTRLHLIADEAGDYAGTSANFSGRGFSDMKFRTLAEPREQFDAWVQKVKASSDRLDMTAYGTVAQPSEKAPVRYFSSVDPKLFHNIIAKYNDGHVLDLKDAACGTKG
>NZ_CP020737.1|WP_084903898.1|2363846_2365376_-|NADH-quinone-oxidoreductase-subunit-M
MQAFPILSLAIWVPILFGAFLLRAGSDRHPRRTRLIALAGALAGLAAVVPLVAGFDTHSAAMQFVEHHDWLAAFGSGWRVGIDGASLWLVVLTAFTTLVIVVASWESVTVRVAQYLASFLILSGLMVGVFAAQDGLLFFIFFEATLIPLYLLIGTWGRENRVHAAVKFFFISFAGSLLLLMAMLYLYAKSHTFDMSVWRTLQLGFAPQLLVFLGFFAAFAVKVPMWPVHTWLRDVYSDGPTGAALMLGMLKLGGYGFLRFALPITPDASHFFAPAVIALSLFAIIYASLLALAQTDLGKLLAYSTVAHMGLVTLGLFLFNRIGVEGAIVQLVSYGFVAGAMLLCVSVLSDRTNTRAIAEYGGVANVMPRFATFTLLFSMANVGLPGTSGFVGEFMIIMGAIRFNFWIGALAALTLILSASYTLWMLKRVVFGKVASPRIAQLVDLNRREIVVFASLALIVLMVGVDPKPFTDAIDPTVARLIDEAGQSKVPDGDGATPAQSSFVASVHD
>NZ_CP020737.1|WP_084903900.1|2365813_2367058_-|NAD(P)/FAD-dependent-oxidoreductase
MNETNSGPVEVDVAIIGAGPAGAVAAGLLRKAGRSVLVLERQHFPRFSIGESLLPQSMQYLDEAGMLQPVIEAGFQFKNGAYFVHRDRMASFDFRDKFTPGWGTAYQVERAAFDDLLIRCAAQQGAEVRFGHTVRAFAPGDRPTLDVVDEAGRDYRVQASFVLDASGFGRVLPRLLDLEAPTRMPTRAAIFSHVEDRLPAGSTDRDKICIAVHPERRDVWFWMIPLTNGRSSVGCVAEASFLDVPEARREPLLRELLRTEPTLALLVGDKPFVMPVRHIGGYASNVERLHGPGYALLGNAGEFLDPIFSSGVTIALRSSHLAVRALERQLRGEAVDWHRDYDVALRKGIDVFREFVEHWYSGALQDVVFYDHKAQEVRRMICSILAGYAWDESNPFVREPGRRLAVLAELCRNR
>NZ_CP020737.1|WP_084903903.1|2367619_2368672_-|iron-ABC-transporter-permease
MSAPVRVARLRAGIALPLLAVLLAVSAVLSAAFGSAPIAPAQAVRIVVTHVAAAFGHAAPLDGALAGNLGDDSIVWLIRIPRALLAALVGATLASVGVALQAATANRLADPHLLGVSAGAMLGAVAATLGFGAAFGPFTLSMAAFAGALAATACVIALAYRRGRLESDRLLLAGVSVSFMMAALGNLMLYLGDPRATASVLFWMLGGVGLARWDLLPVPAVCAVLAGVALYARRRELNALMSGDVAAAALGVPSARMRREVFVIASFATGAMVAVSGAIGFVGLVTPHLCRRIVGAEHGRLLPVAALTGAILLVWADVAARTLAAPEDLPIGVVTALFGSLFFVVLLRRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020737_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020737_4

3435938-3436070

Orphan

Consensus_repeat	Method
TCGGAGGCCGGATATCCACATCGGGCTGGCGAAACGTTCGATCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP020737_4

>merge|NZ_CP020737|4|3435938-3436070|CRISPRCasFinder
TCGGAGGCCGGATATCCACATCGGGCTGGCGAAACGTTCGATCGAGGGCTCACTCTCACCGTTAGAATCCACAGCCGTCCGAGTGGCCTCGGAGACCGGATATCCACATCGGGCTGGCGAAACGTTCGATCGA

>NZ_CP020737|4|4|3435938-3436070|CRISPRCasFinder
TCGGAGGCCGGATATCCACATCGGGCTGGCGAAACGTTCGATCGA	GGGCTCACTCTCACCGTTAGAATCCACAGCCGTCCGAGTGGCC
TCGGAGACCGGATATCCACATCGGGCTGGCGAAACGTTCGATCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020737.1\|WP_084905800.1\|3431536_3435109_-\|indolepyruvate-ferredoxin-oxidoreductase-family-protein	unknown	unknown	gnl\|CDD\|237279
NZ_CP020737.1\|WP_088511455.1\|3437310_3438129_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030
NZ_CP020737.1\|WP_084905802.1\|3436955_3437366_-\|DUF1311-domain-containing-protein	unknown	unknown	gnl\|CDD\|377758
NZ_CP020737.1\|WP_157721065.1\|3427841_3427979_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020737.1\|WP_088511456.1\|3440445_3441639_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239032
NZ_CP020737.1\|WP_084905784.1\|3420669_3421932_+\|prolyl-oligopeptidase-family-serine-peptidase	unknown	unknown	gnl\|CDD\|223489
NZ_CP020737.1\|WP_084905796.1\|3428158_3429445_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP020737.1\|WP_084905815.1\|3444420_3444801_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350220
NZ_CP020737.1\|WP_084905806.1\|3439244_3440216_-\|Inward-rectifier-potassium-channel	unknown	unknown	gnl\|CDD\|375232
NZ_CP020737.1\|WP_084905813.1\|3443505_3444399_+\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|188637
NZ_CP020737.1\|WP_084905810.1\|3441649_3442009_+\|cytochrome-c	unknown	unknown	gnl\|CDD\|379187
NZ_CP020737.1\|WP_084905788.1\|3423702_3424920_+\|8-amino-7-oxononanoate-synthase	unknown	unknown	gnl\|CDD\|235655
NZ_CP020737.1\|WP_167389804.1\|3444800_3445028_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|226603
NZ_CP020737.1\|WP_084905792.1\|3425670_3426690_+\|biotin-synthase-BioB	unknown	unknown	gnl\|CDD\|185063
NZ_CP020737.1\|WP_084905790.1\|3424916_3425636_+\|dethiobiotin-synthase	unknown	unknown	gnl\|CDD\|234625
NZ_CP020737.1\|WP_084905795.1\|3426857_3427580_-\|copper-homeostasis-protein-CutC	unknown	unknown	gnl\|CDD\|225684
NZ_CP020737.1\|WP_084905811.1\|3442034_3443057_-\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
NZ_CP020737.1\|WP_084905798.1\|3429777_3431445_+\|Na+/H+-antiporter	unknown	unknown	gnl\|CDD\|129911
NZ_CP020737.1\|WP_084905804.1\|3438617_3439232_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|239344
NZ_CP020737.1\|WP_084906740.1\|3422359_3423706_+\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	unknown	unknown	gnl\|CDD\|235894

Protein	Function_ID	Function_description	E-value
NZ_CP020737.1\|WP_084905800.1\|3431536_3435109_-\|indolepyruvate-ferredoxin-oxidoreductase-family-protein	gnl\|CDD\|237279	PRK13030, PRK13030, indolepyruvate ferredoxin oxidoreductase family protein.	0
NZ_CP020737.1\|WP_088511455.1\|3437310_3438129_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	4.12022e-09
NZ_CP020737.1\|WP_084905802.1\|3436955_3437366_-\|DUF1311-domain-containing-protein	gnl\|CDD\|377758	pfam07007, LprI, Lysozyme inhibitor LprI. This family consists of several bacterial proteins of around 120 residues in length. Members of this family contain four highly conserved cysteine residues. Family members include lipoprotein LprI from Mycobacterium, which binds to and inhibits macrophage lysozyme, which may aid bacterial survival.	1.23637e-07
NZ_CP020737.1\|WP_088511456.1\|3440445_3441639_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239032	cd02114, bact_SorA_Moco, sulfite:cytochrome c oxidoreductase subunit A (SorA), molybdopterin binding domain. SorA is involved in oxidation of sulfur compounds during chemolithothrophic growth. Together with SorB, a small c-type heme containing subunit, it forms a hetrodimer. It is a member of the sulfite oxidase (SO) family of molybdopterin binding domains. This molybdopterin cofactor (Moco) binding domain is found in a variety of oxidoreductases, main members of this family are nitrate reductase (NR) and sulfite oxidase (SO). Common features of all known members of this family are that they contain one single pterin cofactor and part of the coordination of the metal (Mo) is a cysteine ligand of the protein and that they catalyze the transfer of an oxygen to or from a lone pair of electrons on the substrate.	7.40261e-167
NZ_CP020737.1\|WP_084905784.1\|3420669_3421932_+\|prolyl-oligopeptidase-family-serine-peptidase	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	3.77139e-16
NZ_CP020737.1\|WP_084905796.1\|3428158_3429445_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	6.77692e-59
NZ_CP020737.1\|WP_084905815.1\|3444420_3444801_-\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350220	cd09872, PIN_Sll0205-like, VapC-like PIN domain of Sll0205 protein and homologs. Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of the Synechocystis sp. (strain PCC 6803) Sll0205 protein and other uncharacterized homologs are included in this subfamily. They are similar to the PIN domains of the Mycobacterium tuberculosis VapC and Neisseria gonorrhoeae FitB toxins of the prokaryotic toxin/antitoxin operons, VapBC and FitAB, respectively, which are believed to be involved in growth inhibition by regulating translation. These toxins are nearly always co-expressed with an antitoxin, a cognate protein inhibitor, forming an inert protein complex. Disassociation of the protein complex activates the ribonuclease activity of the toxin by an, as yet undefined mechanism. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	1.32195e-49
NZ_CP020737.1\|WP_084905806.1\|3439244_3440216_-\|Inward-rectifier-potassium-channel	gnl\|CDD\|375232	pfam17655, IRK_C, Inward rectifier potassium channel C-terminal domain. This cytoplasmic C-terminal domain has an Ig fold.	1.08731e-30
NZ_CP020737.1\|WP_084905813.1\|3443505_3444399_+\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|188637	cd00950, DHDPS, Dihydrodipicolinate synthase (DHDPS). Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.	9.95902e-113
NZ_CP020737.1\|WP_084905810.1\|3441649_3442009_+\|cytochrome-c	gnl\|CDD\|379187	pfam13442, Cytochrome_CBB3, Cytochrome C oxidase, cbb3-type, subunit III.	0.000288294
NZ_CP020737.1\|WP_084905788.1\|3423702_3424920_+\|8-amino-7-oxononanoate-synthase	gnl\|CDD\|235655	PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed.	0
NZ_CP020737.1\|WP_167389804.1\|3444800_3445028_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|226603	COG4118, Phd, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	3.61359e-11
NZ_CP020737.1\|WP_084905792.1\|3425670_3426690_+\|biotin-synthase-BioB	gnl\|CDD\|185063	PRK15108, PRK15108, biotin synthase; Provisional.	1.29742e-179
NZ_CP020737.1\|WP_084905790.1\|3424916_3425636_+\|dethiobiotin-synthase	gnl\|CDD\|234625	PRK00090, bioD, ATP-dependent dethiobiotin synthetase BioD.	4.57096e-90
NZ_CP020737.1\|WP_084905795.1\|3426857_3427580_-\|copper-homeostasis-protein-CutC	gnl\|CDD\|225684	COG3142, CutC, Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].	3.23585e-58
NZ_CP020737.1\|WP_084905811.1\|3442034_3443057_-\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	6.89752e-174
NZ_CP020737.1\|WP_084905798.1\|3429777_3431445_+\|Na+/H+-antiporter	gnl\|CDD\|129911	TIGR00831, Putative_Na+/H+_exchanger_Rv2287/MT2345/Mb2309., Na+/H+ antiporter, bacterial form. The Monovalent Cation:Proton Antiporter-1 (CPA1) Family (TC 2.A.36) The CPA1 family is a large family of proteins derived from Gram-positive and Gram-negative bacteria, blue green bacteria, yeast, plants and animals. Transporters from eukaryotes have been functionally characterized, and all of these catalyze Na+:H+ exchange. Their primary physiological functions may be in (1) cytoplasmic pH regulation, extruding the H+ generated during metabolism, and (2) salt tolerance (in plants), due to Na+ uptake into vacuoles. This model is specific for the bacterial members of this family. [Transport and binding proteins, Cations and iron carrying compounds].	2.35722e-114
NZ_CP020737.1\|WP_084905804.1\|3438617_3439232_+\|glutathione-S-transferase	gnl\|CDD\|239344	cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S. cerevisiae GST protein, GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GTT1, a homodimer, exhibits GST activity with standard substrates and associates with the endoplasmic reticulum. Its expression is induced after diauxic shift and remains high throughout the stationary phase. S. pombe GST-III is implicated in the detoxification of various metals.	1.03689e-30
NZ_CP020737.1\|WP_084906740.1\|3422359_3423706_+\|adenosylmethionine--8-amino-7-oxononanoate-transaminase	gnl\|CDD\|235894	PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional.	0

>NZ_CP020737.1|WP_084905800.1|3431536_3435109_-|indolepyruvate-ferredoxin-oxidoreductase-family-protein
MTARLPIDGTPALSDYRLTDNLTATRGRIFLTGTQALVRLLLMQRAADAAQGLNTAGFVSGYRGSPLGMVDQQLWKAKKLLDGGGVRFLPAINEELGGTAVLGTQRVEADPERTVDGVYAMWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMIAWHMPVVNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDAVQTHWPAPQGFTPPAGGLHNRWPDLPSLTIEARLAAKLDAVRHFARTHSIDKWIAPSAQANVGIVTCGKAHLDLMEALRRLDLTVADLDAAGVRIYKVGLSYPLEMTRIETFVDGLAEVLVIEEKGPVIEQQIKDYLYNRADGARPRVLGKHDAEGACLLSELGELRPSRILPVFATWLARHKPALDRRERVVDLVAPQILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMDRDTTGLIQMGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAIRQAVAAKANITYKILYNDAVAMTGGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHGLFPKGTTFHHRSELDAVQRELRETAGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINDAVCEGCGDCGVQSNCLSVEPLETPLGRKRRIDQSSCNKDFSCVNGFCPSFVTVEGAALKKAAGAAFDEAVLAARVDALPVPATHLDAAPYDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFVRIAARDEWLNQVRIDTQQADVLLACDMVVGASAEALQTVRHERSRIVVNTHRIPNASFVQNPDANLHADALLEKMRHAAGDGFLSSCDAQALAAKFLGDSIGANILMLGYAWQLGLVPVSHAALMRAIELNNVAVPMNKLAFAVGRMAAGDPVGLDALWNARHTVATHAAPETLAELIADREARLAEYGGARYVERYRALVDAARAKGDDALARAVATTFYRLLAVKDEYEVARLYADGALRTALEAQFEGVPGQDYRVKFNLAPPTVAKGGSDGSAPKKRVFGQWMWPVLGVLARVRSLRGTWLDPFGRTVERRMERALADDYETTLTRALAATTADNAASVAQLADLHARVRGFGHVKLRNLAGVKRAERELALQLGIDAATSAHVQHALDEVKGAGMLKGIPVVVAK
>NZ_CP020737.1|WP_084905798.1|3429777_3431445_+|Na+/H+-antiporter
MEIVFTVLVLLLTVALSGALTRVLPLRLPLPLMQIAFGAILAWPKFNLHVTFDPEIFMLLFIPPLLFADGWRIPKRELYLQRRAILMLAFGLVFMTVLAVGYFAHWLIPELPLPIAFALAAVLSPTDAVALSGIAGKGRIPPQLMHILEGEALMNDASGLVALKFAVAAALTGMFSLRDASLTFVIVAAGGLVTGAAVSWLFSALSTRFLNAEQEGDPAPGIVMTLLVPFAAYLIAEHLDLSGVLAAVAAGMMMNYTSFSRKSTVASRVRAESTWAMIEFVFNGMVFIMLGLQLPHIIGRALVDAHHTSDALVGRMIFNVLAMMLALYAIRFMWVWLLRWIASRRAARQGLAGTMAGLRTIAVMTVGGVRGAVTLAGVLSIPVALADGTPLPGRDTAIFVASAVILGSLIFAVIGLPLLLRGVRSTRNPLADEERHARAAAAQAAIRAIDSSHGAISTDLDESGAARCADISARVMDQYRRRLAALAEDGPTPRAQAQQSETMELQMRIAAVRAERSVLYRLRGESRISDETLTKLIREIDLSETALSTRKKGIV
>NZ_CP020737.1|WP_084905796.1|3428158_3429445_-|EAL-domain-containing-protein
MTIVQQERPAAASPYRFEREVTSGLERLATQHHDLTLTSVFQPIFSLSHQRAVGYEALLRAHDTLDRPVSPLDVFGDAARHGELLQLDRLAQALHLENFALLGAEREWLFLNVHPGVLTDPFQAAALLANLKRLDMPPRRIVLEVLEQRADDHERLADAMREFRAQGFLLALDDFGAGHSNLERIWQLNPDIVKLDRIMLSHAAHRTGLTAILHGLVTLLHEAGKLVLVEGIETEHEAQIALSCEADFVQGYFFGRPAPGLSDSAAANACIGELTERFRRQTEAHERRDAQRLAPYLRAFERAAERLAAGEPLDEVCWNFLALDGAARCFLLDAQGRQAGRNVVLRADRAARETRFLPLADAQGANWLRRPYFRTAIAEPGRVQVTRPYLSINEAQPCVTLSVAVRVGDTLRVLCGDIDWGDEEVLED
>NZ_CP020737.1|WP_157721065.1|3427841_3427979_-|hypothetical-protein
MIKKLLVLFTAASALLFAGSAAYAGTIVCFPSGECVNVNDPGIFP
>NZ_CP020737.1|WP_084905795.1|3426857_3427580_-|copper-homeostasis-protein-CutC
MNRSASPSVLLEVIAATVGDAKAAARAGADRLELVTAIGEGGLTPSVGLIEAVVAAVPIPVNVIVRPHSRSFVYDADDLRVIERDVRAAVAAGANGVVFGALDARGDIDLGALARIAGAAEGRALTFHRAFDVARDLNAAFDALLRVPAVTSVLTSGGHPSVLDAAATIARMVRRAEGTPCTVLAGSGLTADAVGDFVRTTGVRAVHFGSGVRPRGEVLAPVDERLVAKVRSVLDGAGRA
>NZ_CP020737.1|WP_084905792.1|3425670_3426690_+|biotin-synthase-BioB
MTQAQTAAVQTDAIPVAAPAAQRWRVADVVALFDLPFNDLMFRAQQVHREHFDANAVQLSTLLSIKTGGCEEDCGYCSQSSHHDTGLKAEKLMDVDAVLDAARAAKANGASRFCMGAAWRNPKERHMPALTEMVRGVKEMGLETCMTLGMLEDEQAKELADAGLDYYNHNLDTSPEFYGQIISTRTYQDRLDTLDRVRDAGINVCCGGIIGMGESRRERAGLITQLANLSPYPDSVPINNLVAIEGTPLEGTAALDPFEFVRTIAVARITMPKAVVRLSAGREQLDDGLQAMCFLAGANSMFYGDQLLTTSNPQTQRDRALFDRLGIRASQADALGTDA
>NZ_CP020737.1|WP_084905790.1|3424916_3425636_+|dethiobiotin-synthase
MSPPLSLFVTGTDTEIGKTFVSAALLHGFARLGLRAAAMKPVAAGAYEQDGVWRNEDADQLDAAANVVLPPALRTPFLLKAPAAPHLAAAQEGVTLDLDTIVACHRDVLTRADVVVVEGAGGFRVPLTDTRDMADLAVALGVPVVLVVGVRLGCISHALLTADAIRQRGLTLAGWVANHVDPAMSLQDENVATLRDWLAREHGAPLIGRIPHLAPAAPESAAAMLDVAALVDALRAAQR
>NZ_CP020737.1|WP_084905788.1|3423702_3424920_+|8-amino-7-oxononanoate-synthase
MTLLDTLQRGLAELDAQGLRRLRRTADTACDAHMSVDGRTIVGFASNDYLGLAAHPALVAAFGEGAQRYGSGSGGSHLLGGHSRAHARLEDELAGFSGGFSDAPRALYFSTGYMANLAAITALSGKGATIFSDALNHASLIDGMRLSRATVQVYPHADMAALAALLDASDAPTKLIVSDTVFSMDGDLAPLPELVALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPNLVYVGTLGKAAGVAGAFVIAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEGDARRAHLAALIERTRALLRSTRWQPVDSHTAVQPLVIGSNDATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLEAALIDASDRAAVSGEADRREAA
>NZ_CP020737.1|WP_084906740.1|3422359_3423706_+|adenosylmethionine--8-amino-7-oxononanoate-transaminase
MSTQATDDWVARSLRAVWHPCTQMKHHERMPLIPVARGAGLWLYDRDGRRYFDAISSWWVNLFGHANPDINAALKDQLDTLEHAMLAGCTHEPAIELAERLSALTQHTLGHAFFASDGASAVEIALKMSFHAWRNRGLKEKQEFVCVANSYHGETIGALAVTDVALFKDAYDPLIRHAHVVASPDARLAQPGETAADVAGRALADVRRLFVERNGKIAALIVEPLVQCAAGMAMHDPSYVRGLRALCDEFGVHLIADEIAVGCGRTGTFFACEQAGVWPDFLCLSKGISGGYLPLSLVLSRDEIFAAFYDDDTTRGFLHSHSYTGNPLACRAALATLDLFARDDVLARNARNSAALRDALAPLAAHPRVRHLRERGTLFAFDVALDGDAARGFSRRFFERALERELLLRPIGTTVYLMPPYVMTHDDIAWLAQRTRDTLDATLAEITR
>NZ_CP020737.1|WP_084905784.1|3420669_3421932_+|prolyl-oligopeptidase-family-serine-peptidase
MAFSKVLVGWMAACALSAALADTLPNAGASSGPLARAERFDYGASGLPQVAADLNEQIIRIPADASGTVTLEATLFKPDGPGPFPLVVFNHGKNPGDLHQQPRSRPLAFAREFVRRGYAVIAPNRQGFAGSGGTYQQEGCNVAKNGLAQAADIGATIRYMSHQSYVDASHIVVAGTSHGGLASIAYGTEAAAGVRGIINFSGGLRQDLCDGWQRNLVDAFDQYGARTAVQSLWLYGDNDSVWTPALVAQMHDAYASHGTRAEFVDFGRYKDDAHRLIVDRDGVPVWWPAVHAFLAKLNLPTAVRYAVANPHEPKASGYASIDAVDAVPFIDAAGRDGYRRFLNQHPSRAFAVSAEGAWSWAEGGDDPMALALDNCAKQGAGACRLYAVNDRVVWNANTSQTADSGERDDDAQAARSLAAR
>NZ_CP020737.1|WP_084905802.1|3436955_3437366_-|DUF1311-domain-containing-protein
MLSLPLLSIAAPGNVVRSEKDLYEECGAYSQAGMKDCLVKKADESRASLKKAEIDVIAVIKKWDEGNKYIRASQAMLAASNKEFVKYRGAQCEFSASLSGGGAGNAYEMGRLACIAELNTRRVEQLRNAVSDLPLK
>NZ_CP020737.1|WP_088511455.1|3437310_3438129_-|LysM-peptidoglycan-binding-domain-containing-protein
MAIQEPTKTGFEKWQDDINKAAGDVNWDTWDCEIQMAVNEYNRHLSGTAGYSPLDWHLIKAMLWVETGANSSEWKIKPLQIGVSGDPGLTSFLSGNEGGDLILPPTWKGQLTMGSARTMPAHNIRAGIGYLLMRMATFEHRSVSVAASKVYDVTVKSGDSLDKIATEHGSTTEVLKKLNPMVGVLRPGQVLKCQKASVRRVITGWRPLSATSVALRYNSMRRDPNYAKKLDFARVWYARERRLHARNKTDWFGVYAVLAAALNCCAGQCRQE
>NZ_CP020737.1|WP_084905804.1|3438617_3439232_+|glutathione-S-transferase
MKLYYWPKTRAFRALWMLEEIGVPYELAPIDLRSHEQGSDAFVQVNPMAKLPALDDGSVPFAESGAVLLYLADRFPDAQLGIAPDDPLRGRFLQWLFFTPTCLEPAMAEKFTGASGNPVAFGWGNIARVQRALAQTLAQSPWLVGAHFTAADLLLASTLKIAFDAHLLPHEGVLGDYVARAEDRDGFRRAVAIEQREAARLLHP
>NZ_CP020737.1|WP_084905806.1|3439244_3440216_-|Inward-rectifier-potassium-channel
MNVDPSASSPRGRGRKIWSGTRHVIAYGMPPLGWRDLYHRALTVSWPVFFLSLAVLFLLLNGGFATLYMLGHAPIANQSPAGFGGAFFFSVETLATVGYGDMHPQTLYAHVVATLEIFIGMSGIALATGLVFARFSRPRAKILFARYAIVRPLNGRMTVMVRVANARQNVIAEARAKLRLMRVEGTHEGYTLRKIHDLPLVRSEHPIFLLGWNLMHVIDESSPLFGESAESLAARDASLLITIEGSDETTSQVMLARHSWEHGEIRWFHRYVDLMHEEGGITHIDYTHFHDVVPVDADTAGGTPGATIVSREARAPGPSASST
>NZ_CP020737.1|WP_088511456.1|3440445_3441639_+|molybdopterin-dependent-oxidoreductase
MQAAAGGLLAVGGGWFRHAFAADAVSLPFENGLRELTRAFPQKGEMLLVRTRPPLLETPFAVFDDGVFTPNDRFFVRWHLANIPTRIDAGAFRLAVHGLVERPLALSLRELARDFPHVEVAAVNQCAGNSRGFFKPRVAGGEWGNGAMGNARWTGVRLKDILDRAGVKAGAVQVRFNGLDTGVLPATPAYVKALDVDRARDGAVIVAFAMNGQPLPLLNGFPVRLVVPGWYSTYWVKMLHDIEVIDRRDDNFWMAKAYRIPDTPHASVQPGQAGVATVPIGRMVPRSFITNLADGSVIAQDRVQTVRGIAFGGDTGVRNVLFSPDGGASWTAARLGKDYGKYSFRRWEAQFTPRRAGPAALQVKAVNADGVEQPDAPNWNPAGYMRNVVETTNVVIA
>NZ_CP020737.1|WP_084905810.1|3441649_3442009_+|cytochrome-c
MTKTCAAILLAAATCAASVAMAEATGPARAAAARTIETRTVEVELPGDTRKFPPGPGADLANQHCLVCHSVGMVTRQPPLSFDEWKAEVVKMRAVYGAPLPPEAIDDLARYLTTINGKP
>NZ_CP020737.1|WP_084905811.1|3442034_3443057_-|sulfate-ABC-transporter-substrate-binding-protein
MGYTNGIGGRLLKGVAAAALVVSAAAAHADTSLLNVSYDVTRELYKDINAGFVAAYKQKTGETVAIRQSHGASSAQALSVLQGLQADVVTMNQPNDIDLLAERGQLLPKDWRTRFPDSSSPYSTTMVFLVRKGNPKGIKDWSDLAKPGVQVIIANPKTSGNGRYAYLAAWGYQKQKGATDQQALDFEKAIFRNVPVLDSGGRGATTTFTQRGIGDVLVTFENEVALMDTGASGAQFDAVYPSASILAEPPVAVVDKVVDKKGTRKVAQAYLDYLYTPDAQEIIAQHHLRPRDPSVLKKHAAEFKPLKTFSVEQVFGNWANAQKTHFADGGTFDRVIVDRK
>NZ_CP020737.1|WP_084905813.1|3443505_3444399_+|4-hydroxy-tetrahydrodipicolinate-synthase
MQTRFEGIWLPLITPFHHGEVDHAALARLARRYAAAGIAGFVAGATTGEGALLDAREQDAVFATLRDAVPGLPIIVGLTASATQFAAARARELAALAPDGLLVTPPVYVRPTQDGIRRHFEVIVEAADRPVLVYNIPYRTGVNVELETLQALARDARVAGVKECGGSLDRMARLVHETPLAILSGDDNQNFAALCAGAHGTIASSAHVLTEWHVRIHALLRDGRLTDARRLAVALQPLVAALFAEPNPAPVKALLAAQGWCEDGLRLPFVPASDALRAKVVELCAALEASTPAVAAA
>NZ_CP020737.1|WP_084905815.1|3444420_3444801_-|type-II-toxin-antitoxin-system-VapC-family-toxin
MRLLFDTHIFLWMLADDPKLSVRARRLISTADEVFISSASIWEVAIKAGKGKLDVDVEGLVDAIKTSKYQELPVRAAHGAAVRNLPHYHRDPFDRLLVAQAWCEPLLLVTADGDLAQYGSSRILTV
>NZ_CP020737.1|WP_167389804.1|3444800_3445028_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MQNANLHDAALDLPRLVDAAIAGEDVVISQDGKPSVRLVPLKPIHQYGLLKGQIWIADDFDAPLPDDLLDAFEGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP020737_4	4.1\|3435983\|43\|NZ_CP020737\|CRISPRCasFinder	3435983-3436025	43	NZ_CP020737.1	3435806-3435848	1	0.977
NZ_CP020737_4	4.1\|3435983\|43\|NZ_CP020737\|CRISPRCasFinder	3435983-3436025	43	NZ_CP020737.1	3436337-3436379	2	0.953

1. spacer 4.1|3435983|43|NZ_CP020737|CRISPRCasFinder matches to position: 3435806-3435848, mismatch: 1, identity: 0.977

gggctcactctcaccgttagaatccacagccgtccgagtggcc	CRISPR spacer
gggctcactctcaccgttagaatccacagccttccgagtggcc	Protospacer
******************************* ***********

2. spacer 4.1|3435983|43|NZ_CP020737|CRISPRCasFinder matches to position: 3436337-3436379, mismatch: 2, identity: 0.953

gggctcactctcaccgttagaatccacagccgtccgagtggcc	CRISPR spacer
ggtctcaccctcaccgttagaatccacagccgtccgagtggcc	Protospacer
** *****.**********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020737_3	3.1\|2355858\|37\|NZ_CP020737\|CRISPRCasFinder	2355858-2355894	37	NZ_CP034352	Streptomyces sp. W1SF4 plasmid p2, complete sequence	132969-133005	5	0.865

1. spacer 3.1|2355858|37|NZ_CP020737|CRISPRCasFinder matches to NZ_CP034352 (Streptomyces sp. W1SF4 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.865

caggaggctggccgccccctcggggggcag--cgagcaa	CRISPR spacer
ctggaggcgggccgcaccctcggggggcaggacgagc--	Protospacer
* ****** ****** **************  *****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

177799 : 206545

Burkholderia_phage(66.67%)

holin,plate,integrase,tail

attL 177701:177721|attR 202368:202388

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
177701:177721	attL	NA	NA	NA	NA
WP_084899599.1\|177799_178876_-\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	1.7e-168	83.4
WP_084899604.1\|179193_179565_-	hypothetical protein	NA	NA	NA	NA
WP_084899607.1\|179561_182354_-	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	91.5
WP_084899609.1\|182357_182621_-	hypothetical protein	A4JWQ9	Burkholderia_virus	6.5e-18	65.1
WP_010095912.1\|182812_183061_-	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	5.9e-37	91.5
WP_084899612.1\|183185_183401_-	hypothetical protein	E5E3U1	Burkholderia_phage	3.9e-21	82.9
WP_133117985.1\|183527_183983_+	helix-turn-helix transcriptional regulator	E5E3U2	Burkholderia_phage	1.3e-45	64.9
WP_084899613.1\|184390_184687_+	hypothetical protein	E5E3U3	Burkholderia_phage	7.9e-12	49.5
WP_084899617.1\|184818_185898_-	phage late control D family protein	K4PAY4	Burkholderia_phage	1.0e-133	73.0
WP_084899619.1\|185894_186350_-\|tail	phage tail protein	K4NXK5	Burkholderia_phage	1.4e-39	64.3
WP_084899622.1\|186379_188932_-	hypothetical protein	A4JWS3	Burkholderia_virus	2.9e-155	47.6
WP_010095898.1\|188947_189061_-\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	1.8e-09	81.1
WP_084899624.1\|189069_189453_-\|tail	phage tail assembly protein	A4JWS5	Burkholderia_virus	2.0e-28	65.7
WP_029226832.1\|189522_190032_-\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	3.4e-71	74.6
WP_084899627.1\|190060_191233_-\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.7e-187	83.0
WP_084899629.1\|191292_191922_-\|tail	tail assembly chaperone	E5E3V1	Burkholderia_phage	9.0e-90	84.7
WP_084899632.1\|191937_193818_-	hypothetical protein	A4JWS9	Burkholderia_virus	2.1e-142	47.2
WP_084899634.1\|193824_194367_-\|tail	phage tail protein I	E5FFH2	Burkholderia_phage	9.5e-72	73.2
WP_084899638.1\|194359_195274_-\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	1.5e-122	73.6
WP_084899641.1\|195270_195633_-\|plate	baseplate assembly protein	K4PAX6	Burkholderia_phage	2.4e-39	66.7
WP_084899645.1\|195629_196313_-\|plate	phage baseplate assembly protein V	K4NXJ5	Burkholderia_phage	3.7e-81	69.6
WP_088511394.1\|196870_197086_-	hypothetical protein	NA	NA	NA	NA
WP_084899647.1\|197058_197841_-	hypothetical protein	A4JWL8	Burkholderia_virus	1.6e-48	48.4
WP_084899649.1\|197837_198404_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.9e-38	56.4
WP_084899651.1\|198396_199308_-\|plate	baseplate assembly protein	E5FFH3	Burkholderia_phage	2.8e-76	52.2
WP_084899654.1\|199304_199760_-\|tail	phage tail protein	E5E3V9	Burkholderia_phage	3.1e-31	56.5
WP_084899659.1\|199879_200320_-	protein lysB	K4NXJ2	Burkholderia_phage	4.6e-16	44.4
WP_084899662.1\|200316_201150_-	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	6.1e-94	67.0
WP_084899664.1\|201153_201420_-\|holin	phage holin family protein	E5E3W3	Burkholderia_phage	1.2e-24	66.3
WP_059609396.1\|201421_201766_-	hypothetical protein	A4JWU2	Burkholderia_virus	6.7e-39	79.6
WP_010095858.1\|201781_201988_-\|tail	tail protein	E5E3W5	Burkholderia_phage	4.2e-20	70.6
WP_084906324.1\|202394_202865_-	DUF523 domain-containing protein	NA	NA	NA	NA
202368:202388	attR	NA	NA	NA	NA
WP_084899665.1\|203056_204586_+	TIGR04222 domain-containing membrane protein	NA	NA	NA	NA
WP_084899667.1\|204886_206545_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-22	35.6

DBSCAN-SWA_2

431732 : 500038

uncultured_Caudovirales_phage(33.33%)

plate,integrase,protease

attL 432304:432349|attR 446180:446225

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084900080.1\|431732_432254_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	4.3e-21	49.5
432304:432349	attL	NA	NA	NA	NA
WP_084906342.1\|432446_433490_+\|integrase	site-specific integrase	A0A0A1I5U0	Burkholderia_phage	1.3e-48	36.7
WP_084900083.1\|434112_434847_+	DNA-binding protein	NA	NA	NA	NA
WP_154302346.1\|434852_435014_+	hypothetical protein	NA	NA	NA	NA
WP_059636886.1\|435153_435393_+	EexN family lipoprotein	NA	NA	NA	NA
WP_084900086.1\|435403_436543_+	type IV secretion system protein	NA	NA	NA	NA
WP_084900090.1\|436545_437001_+	hypothetical protein	NA	NA	NA	NA
WP_084900093.1\|437340_438069_-	hypothetical protein	NA	NA	NA	NA
WP_084900095.1\|438278_438809_+	hypothetical protein	A4JWV5	Burkholderia_virus	3.8e-57	63.4
WP_084900098.1\|438805_439537_+	VRR-NUC domain-containing protein	A4JWV4	Burkholderia_virus	1.2e-80	64.3
WP_084900101.1\|439548_440667_+	DUF3396 domain-containing protein	A4JWV3	Burkholderia_virus	6.8e-157	71.2
WP_157721042.1\|441933_443721_-	ADP-ribosylglycohydrolase family protein	NA	NA	NA	NA
WP_084900107.1\|443731_444400_-	DUF4433 domain-containing protein	NA	NA	NA	NA
WP_084906344.1\|444405_445812_-	AAA family ATPase	A0A2H4UW05	Bodo_saltans_virus	1.9e-07	24.5
WP_084900110.1\|446342_446924_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.0e-23	35.9
446180:446225	attR	NA	NA	NA	NA
WP_084900112.1\|446925_447396_-	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	6.9e-18	35.3
WP_084900116.1\|447871_448189_-	hypothetical protein	NA	NA	NA	NA
WP_084900118.1\|448262_448604_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_084900123.1\|449067_449319_-	PAAR domain-containing protein	A4PE23	Ralstonia_virus	1.4e-06	39.2
WP_133118078.1\|449433_449919_-	hypothetical protein	NA	NA	NA	NA
WP_133118079.1\|449915_451943_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_133118080.1\|451946_452525_-	hypothetical protein	NA	NA	NA	NA
WP_084900135.1\|452527_455281_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	4.9e-47	26.8
WP_084900138.1\|456570_457362_+	EboA domain-containing protein	NA	NA	NA	NA
WP_084900140.1\|457259_458255_+	hydrolase TatD	NA	NA	NA	NA
WP_084900144.1\|458335_459523_+	3-dehydroquinate synthase	NA	NA	NA	NA
WP_084900147.1\|459471_460644_+	metabolite traffic protein EboE	NA	NA	NA	NA
WP_084900150.1\|460621_461989_+	alkaline phosphatase family protein	NA	NA	NA	NA
WP_084900152.1\|461985_462723_+	UbiA family prenyltransferase	NA	NA	NA	NA
WP_084900154.1\|462846_463632_+	VOC family protein	NA	NA	NA	NA
WP_133118081.1\|463715_465707_+	hypothetical protein	NA	NA	NA	NA
WP_084900159.1\|465756_466866_+	hypothetical protein	NA	NA	NA	NA
WP_084900162.1\|467034_468903_-	cell wall anchor protein	NA	NA	NA	NA
WP_084900164.1\|469632_472530_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.5e-49	26.8
WP_084900168.1\|472533_473082_+	hypothetical protein	NA	NA	NA	NA
WP_084900171.1\|473106_475059_+	TIGR02594 family protein	A0A1U9ZAE8	Proteus_phage	4.4e-10	38.7
WP_084900174.1\|475045_475597_+	hypothetical protein	NA	NA	NA	NA
WP_084900176.1\|475799_476060_+	hypothetical protein	NA	NA	NA	NA
WP_084900178.1\|476433_476637_+	hypothetical protein	NA	NA	NA	NA
WP_084900181.1\|476731_477532_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_084900184.1\|477842_481013_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.9e-55	28.2
WP_084900186.1\|481069_485758_+	DUF4329 domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	1.2e-42	46.7
WP_133118082.1\|485747_486083_+	hypothetical protein	NA	NA	NA	NA
WP_084906346.1\|486613_486793_+	hypothetical protein	NA	NA	NA	NA
WP_084900189.1\|486785_487094_+	hypothetical protein	NA	NA	NA	NA
WP_084900192.1\|487266_489096_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.1e-14	44.1
WP_084900194.1\|489249_489573_+	hypothetical protein	NA	NA	NA	NA
WP_084900198.1\|489593_489971_+	DUF2750 domain-containing protein	NA	NA	NA	NA
WP_084900201.1\|490026_490806_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_084900204.1\|490802_492149_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_084900205.1\|492251_492863_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_167389792.1\|492849_493074_+	hypothetical protein	NA	NA	NA	NA
WP_084900208.1\|493238_493877_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_084900211.1\|493920_494448_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_084900214.1\|494463_495954_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_010096526.1\|496022_496526_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_084900218.1\|496587_497073_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_084900221.1\|497138_498974_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_084900224.1\|498937_500038_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_3

3613367 : 3647335

Erwinia_phage(25.0%)

plate,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006760749.1\|3613367_3613904_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_084906101.1\|3613914_3615258_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	1.0e-42	29.6
WP_084906103.1\|3615440_3615803_+	hypothetical protein	NA	NA	NA	NA
WP_059611872.1\|3615836_3616379_-	response regulator transcription factor	NA	NA	NA	NA
WP_084906105.1\|3616415_3617786_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_084906107.1\|3617896_3618121_-	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_084906111.1\|3618439_3619339_+	acetylglutamate kinase	NA	NA	NA	NA
WP_084906113.1\|3619335_3620127_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_084906115.1\|3620093_3620771_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_084906117.1\|3620848_3623518_-	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	3.6e-79	32.9
WP_084906119.1\|3624056_3625076_+	TagK domain-containing protein	NA	NA	NA	NA
WP_084906121.1\|3625056_3625914_+	ImpE protein superfamily protein	NA	NA	NA	NA
WP_084906765.1\|3625897_3626419_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_084906123.1\|3626420_3628301_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_084906125.1\|3628304_3629366_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_084906127.1\|3629362_3630421_+	hypothetical protein	NA	NA	NA	NA
WP_084906129.1\|3630463_3631498_+	fimbrial protein	NA	NA	NA	NA
WP_084906131.1\|3631528_3632881_+	hypothetical protein	A0A292GJ55	Xanthomonas_phage	2.7e-107	46.5
WP_084906133.1\|3632974_3636430_-	RHS repeat protein	NA	NA	NA	NA
WP_084906134.1\|3636450_3636717_-	hypothetical protein	NA	NA	NA	NA
WP_084906136.1\|3636804_3639330_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	3.0e-35	26.1
WP_084906138.1\|3639429_3639993_-	hypothetical protein	NA	NA	NA	NA
WP_084906140.1\|3639973_3640786_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_084906142.1\|3640782_3644670_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_084906144.1\|3644684_3645989_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_084906146.1\|3645985_3647335_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP020739

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14336

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084905202.1\|2862_4131_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_084910147.1\|4738_5422_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_084910148.1\|5449_6607_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_084910149.1\|7247_9275_+	hypothetical protein	NA	NA	NA	NA
WP_084910150.1\|9290_10181_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_084910151.1\|10309_11035_+	pirin family protein	NA	NA	NA	NA
WP_084910152.1\|11260_11665_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_084910153.1\|11810_12962_+	MFS transporter	NA	NA	NA	NA
WP_084910154.1\|13245_13503_-	hypothetical protein	NA	NA	NA	NA
WP_084910656.1\|13565_14336_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-05	26.3

DBSCAN-SWA_2

20830 : 23947

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910160.1\|20830_23947_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	7.4e-68	22.6

DBSCAN-SWA_3

27099 : 28944

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910164.1\|27099_28944_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.1

DBSCAN-SWA_4

59815 : 61945

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910195.1\|59815_61945_-	TonB-dependent siderophore receptor	A0A1B0VCF0	Salmonella_phage	2.8e-10	27.5

DBSCAN-SWA_5

70966 : 79675

Paenibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910205.1\|70966_73900_+	type I polyketide synthase	D0R7J2	Paenibacillus_phage	3.5e-35	35.5
WP_084910206.1\|73896_74721_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_162296943.1\|74725_79675_+	amino acid adenylation domain-containing protein	A0A2K9L3I8	Tupanvirus	3.0e-71	22.1

DBSCAN-SWA_6

85409 : 92239

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910213.1\|85409_86849_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	4.5e-36	30.8
WP_157721129.1\|86845_88069_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_084910215.1\|88186_92239_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	3.0e-53	26.3

DBSCAN-SWA_7

113823 : 114519

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059532126.1\|113823_114519_+	ParA family protein	D4HTX7	Vibrio_phage	1.3e-20	31.4

DBSCAN-SWA_8

120345 : 121644

Megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910235.1\|120345_121644_+	adenylosuccinate synthase	K7YXK1	Megavirus	7.6e-59	34.2

DBSCAN-SWA_9

138811 : 139336

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910246.1\|138811_139336_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	9.6e-45	54.9

DBSCAN-SWA_10

144968 : 146858

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910253.1\|144968_146858_-	AMP-binding protein	Q75ZG1	Hepacivirus	4.3e-34	26.3

DBSCAN-SWA_11

150460 : 174782

Paenibacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910257.1\|150460_162184_-	thioester reductase domain-containing protein	D0R7J2	Paenibacillus_phage	7.4e-28	29.9
WP_084910258.1\|162240_163653_-	gamma-aminobutyraldehyde dehydrogenase	NA	NA	NA	NA
WP_084910259.1\|163646_165068_-	aminotransferase	A0A1C9EHH3	Mycobacterium_phage	2.3e-08	27.3
WP_084910260.1\|165076_166102_-	peptide synthase	NA	NA	NA	NA
WP_084910261.1\|166152_166671_-	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_084910262.1\|166769_174782_-	type I polyketide synthase	A0A2K9KZV5	Tupanvirus	7.1e-30	24.1

DBSCAN-SWA_12

195280 : 196600

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910274.1\|195280_196600_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	6.1e-72	39.4

DBSCAN-SWA_13

203091 : 208362

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910281.1\|203091_204612_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	5.1e-14	25.7
WP_084910282.1\|204806_205550_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_084910283.1\|205822_206785_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_084910284.1\|206847_208362_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.5e-16	25.5

DBSCAN-SWA_14

216944 : 221244

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910291.1\|216944_218504_+	D-xylose ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.6e-10	27.6
WP_084910292.1\|218500_219700_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_084910293.1\|219734_220064_+	hypothetical protein	NA	NA	NA	NA
WP_084910294.1\|220509_221244_+	response regulator transcription factor	W8CYM9	Bacillus_phage	8.2e-34	34.5

DBSCAN-SWA_15

224307 : 225945

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910675.1\|224307_225945_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.4e-33	30.2

DBSCAN-SWA_16

244800 : 245571

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059610072.1\|244800_245571_+	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	2.4e-20	30.6

DBSCAN-SWA_17

251452 : 253921

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910313.1\|251452_253138_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	3.5e-80	39.7
WP_084910314.1\|253153_253921_+	3-hydroxyacyl-CoA dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	8.3e-05	30.4

DBSCAN-SWA_18

267812 : 272622

uncultured_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_133117887.1\|267812_269012_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.6e-42	42.7
WP_084910324.1\|269265_272622_-	S8 family serine peptidase	A0A1V0SLL0	Klosneuvirus	6.4e-49	33.1

DBSCAN-SWA_19

292020 : 292773

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910343.1\|292020_292773_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.8e-05	28.5

DBSCAN-SWA_20

302436 : 303372

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910353.1\|302436_303372_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.7e-18	28.0

DBSCAN-SWA_21

308651 : 324041

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910358.1\|308651_309938_-	MFS transporter	Q6JIH2	Burkholderia_virus	7.3e-171	72.0
WP_084910359.1\|310070_310976_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.9e-129	76.2
WP_084910360.1\|311865_314412_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.9e-22	36.0
WP_084910361.1\|314542_315094_+	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	4.0e-09	38.9
WP_084910362.1\|315146_316166_-	depolymerase	NA	NA	NA	NA
WP_133118007.1\|316709_317303_-	hypothetical protein	NA	NA	NA	NA
WP_084910364.1\|317762_318851_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.7e-11	22.4
WP_088511598.1\|318847_319591_-	response regulator transcription factor	NA	NA	NA	NA
WP_084910366.1\|319716_320877_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_084910367.1\|320897_324041_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.5e-52	21.7

DBSCAN-SWA_22

341429 : 342983

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910382.1\|341429_342983_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	2.0e-37	26.8

DBSCAN-SWA_23

351965 : 353496

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910391.1\|351965_352730_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-18	32.3
WP_084910392.1\|352737_353496_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	7.4e-14	28.5

DBSCAN-SWA_24

359216 : 376008

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910398.1\|359216_362918_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	3.4e-59	31.1
WP_084910399.1\|362954_365525_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.3e-25	36.7
WP_084910695.1\|365617_366094_+	universal stress protein	NA	NA	NA	NA
WP_084910697.1\|366211_366487_+	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_084910400.1\|366517_366757_+	hypothetical protein	NA	NA	NA	NA
WP_084910401.1\|366817_367090_-	hypothetical protein	NA	NA	NA	NA
WP_084910402.1\|367348_368338_+	zinc-dependent alcohol dehydrogenase family protein	A0A0G2YAX3	Acanthamoeba_polyphaga_mimivirus	8.5e-18	30.3
WP_084910403.1\|368421_369195_-	fumarate/nitrate reduction transcriptional regulator Fnr	NA	NA	NA	NA
WP_084910404.1\|369648_370482_-	universal stress protein	NA	NA	NA	NA
WP_084910405.1\|370478_370982_-	universal stress protein	NA	NA	NA	NA
WP_084910406.1\|371198_372038_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	9.7e-07	32.7
WP_084910699.1\|372298_373045_+	acetoacetyl-CoA reductase	F2NZ40	Diadromus_pulchellus_ascovirus	8.9e-12	31.7
WP_084910701.1\|373056_374868_+	polyhydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_084910407.1\|374967_376008_+	zinc-dependent alcohol dehydrogenase family protein	E3SJ82	Synechococcus_phage	4.9e-16	27.0

DBSCAN-SWA_25

380630 : 386517

Cyanophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910412.1\|380630_382106_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	2.8e-73	34.4
WP_084910413.1\|382299_382878_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_084910414.1\|382973_383849_+	SDR family NAD(P)-dependent oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.6e-07	27.7
WP_084910415.1\|383917_384457_-	hypothetical protein	NA	NA	NA	NA
WP_084910416.1\|384708_385257_+	hypothetical protein	NA	NA	NA	NA
WP_088511605.1\|385506_386517_+	histidine kinase	Q9EYF3	Enterobacteria_phage	6.6e-18	35.1

DBSCAN-SWA_26

422179 : 424324

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910442.1\|422179_424324_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.7e-34	28.8

DBSCAN-SWA_27

434512 : 443493

Hokovirus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910711.1\|434512_437575_+	hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	1.6e-46	31.7
WP_084910449.1\|437643_438078_-	DUF1090 family protein	NA	NA	NA	NA
WP_133118147.1\|438367_439504_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_084910450.1\|439856_440048_+	hypothetical protein	NA	NA	NA	NA
WP_084910451.1\|440430_443493_+	response regulator	A0A1V0SGX0	Hokovirus	3.8e-40	41.8

DBSCAN-SWA_28

447000 : 448587

Peridroma_alphabaculovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910454.1\|447000_448587_-	chitinase	A0A068LRB9	Peridroma_alphabaculovirus	3.2e-51	34.0

DBSCAN-SWA_29

453949 : 455371

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157721140.1\|453949_455371_-	peptidase S53	A0A1V0SLL0	Klosneuvirus	3.0e-48	33.2

DBSCAN-SWA_30

459036 : 480796

Tupanvirus(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910460.1\|459036_460854_-	fatty acyl-AMP ligase	A0A2K9L3I8	Tupanvirus	9.5e-07	21.9
WP_084910713.1\|460850_461837_-	amidohydrolase	NA	NA	NA	NA
WP_084910461.1\|461875_462901_-	acyl-CoA desaturase	A0A1B1IX11	uncultured_Mediterranean_phage	2.0e-06	24.9
WP_084910462.1\|462897_463833_-	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	2.5e-27	30.2
WP_084910463.1\|463845_464130_-	acyl carrier protein	NA	NA	NA	NA
WP_084910464.1\|464155_465190_-	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	1.4e-18	29.1
WP_084910465.1\|465519_466923_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.3e-23	38.3
WP_084910466.1\|466942_472828_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.4e-189	38.0
WP_084910467.1\|473320_474118_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_084910468.1\|474182_475190_-	Rieske 2Fe-2S domain-containing protein	A0A076FFT9	Aureococcus_anophage	7.3e-09	25.3
WP_084910469.1\|475186_478591_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	1.5e-42	30.4
WP_084910471.1\|479404_480796_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.1e-42	26.9

DBSCAN-SWA_31

503110 : 504271

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910496.1\|503110_504271_-	VWA domain-containing protein	Q9EYF7	Enterobacteria_phage	4.4e-42	32.8

DBSCAN-SWA_32

511240 : 511834

Thermoanaerobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910508.1\|511240_511834_-	helix-turn-helix transcriptional regulator	I3VYZ1	Thermoanaerobacterium_phage	9.9e-06	43.9

DBSCAN-SWA_33

518700 : 521007

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910521.1\|518700_521007_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	3.7e-40	28.7

DBSCAN-SWA_34

527126 : 529823

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910527.1\|527126_529823_+	type VI secretion system ATPase TssH	A0A1C3S747	Escherichia_phage	1.1e-86	33.2

DBSCAN-SWA_35

542885 : 547363

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910546.1\|542885_545015_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	8.5e-07	27.1
WP_084910548.1\|545041_547363_+	EAL domain-containing protein	G3MA91	Bacillus_virus	7.6e-17	36.7

DBSCAN-SWA_36

557796 : 559557

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910569.1\|557796_559557_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	A0A0R6PI85	Moraxella_phage	9.8e-25	26.0

DBSCAN-SWA_37

573067 : 573654

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910583.1\|573067_573337_+	type II toxin-antitoxin system ParD family antitoxin	A0A0N7C055	Escherichia_phage	4.1e-15	56.0
WP_084910585.1\|573333_573654_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2R2Z2Y1	Escherichia_phage	3.1e-14	39.2

DBSCAN-SWA_38

580909 : 599697

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910726.1\|580909_585619_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.3e-52	21.7
WP_084910597.1\|585636_589527_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	8.7e-58	28.8
WP_084910599.1\|589523_590519_-	hypothetical protein	NA	NA	NA	NA
WP_084910601.1\|590616_599697_-	hybrid non-ribosomal peptide synthetase/type I polyketide synthase	A0A2K9KZV5	Tupanvirus	2.9e-35	21.5

DBSCAN-SWA_39

621128 : 623693

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_084910631.1\|621128_623693_-\|tRNA	valine--tRNA ligase	A0A2K9KZB8	Tupanvirus	1.4e-152	35.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020738

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP020737

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP020739

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection