CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP020861	Lactiplantibacillus plantarum strain JBE490 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	1	1	7	2
NZ_CP020862	Lactiplantibacillus plantarum strain JBE490 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020861_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020861_1

360241-360702

Orphan

Consensus_repeat	Method
AAGTCNNANAAGAANAAN	CRT

12 spacers

The CRISPR arrays of NZ_CP020861_1

>merge|NZ_CP020861|1|360241-360702|CRT
AAGTCGCACAAGAAGTCACACAAGAAGAAAGCGGCCAAGAAACATAAGAAGTCGCACAAGAAGAAAGCGGCCAAGAAACATAAGAAGCCGCACAAGAAGAAGTCTTCTAAGAAGCATGGCAAGTCGCACAAGAAAAAATCTTCGAAGAAGCACGGCAAGTCCAATAAGAAGAAGTCTTCGAAGAAGCACGGCAAGTCCAATAAGAAAAAGTCTTCCAAGAAACACGGCAAGTCGCACAAGAAGAAGTCTTCGAAGAAGCACGGCAAGTCCAATAAGAAAAAGTCTTCCAAGAAACATGGCAAGTCCAGTAAGAAGAAGTCTTCCAAGAAACATGGCAAGTCGCACAAGAAGAAATCTTCCAAGAAGCACGGCAAGTCCAATAAGAAGAAATCTTCCAAGAAGCATGGTAAATCCAGTAAGAAGAAATCATCTAAGAAGCACGGCAAGTCTAACAAGAAAAAA

>NZ_CP020861|1|1|360241-360702|CRT
AAGTCGCACAAGAAGTCA	CACAAGAAGAAAGCGGCCAAGAAACATAAG
AAGTCGCACAAGAAGAAA	GCGGCCAAGAAACATAAG
AAGCCGCACAAGAAGAAG	TCTTCTAAGAAGCATGGC
AAGTCGCACAAGAAAAAA	TCTTCGAAGAAGCACGGC
AAGTCCAATAAGAAGAAG	TCTTCGAAGAAGCACGGC
AAGTCCAATAAGAAAAAG	TCTTCCAAGAAACACGGC
AAGTCGCACAAGAAGAAG	TCTTCGAAGAAGCACGGC
AAGTCCAATAAGAAAAAG	TCTTCCAAGAAACATGGC
AAGTCCAGTAAGAAGAAG	TCTTCCAAGAAACATGGC
AAGTCGCACAAGAAGAAA	TCTTCCAAGAAGCACGGC
AAGTCCAATAAGAAGAAA	TCTTCCAAGAAGCATGGT
AAATCCAGTAAGAAGAAA	TCATCTAAGAAGCACGGC
AAGTCTAACAAGAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020861.1\|WP_085438922.1\|347170_348697_+\|ABC-transporter-permease/substrate-binding-protein	unknown	unknown	gnl\|CDD\|270328
NZ_CP020861.1\|WP_086989537.1\|364692_365468_-\|IS5-like-element-ISLpl3-family-transposase	unknown	unknown	gnl\|CDD\|379129
NZ_CP020861.1\|WP_012778296.1\|366230_367229_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP020861.1\|WP_085438926.1\|364152_364431_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020861.1\|WP_015825109.1\|348697_349669_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP020861.1\|WP_085438924.1\|351543_353061_+\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NZ_CP020861.1\|WP_003643811.1\|368742_368901_-\|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF	unknown	unknown	unknown
NZ_CP020861.1\|WP_003643767.1\|343665_344586_-\|ribonucleoside-hydrolase-RihC	unknown	unknown	gnl\|CDD\|182713
NZ_CP020861.1\|WP_060677620.1\|363787_364051_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020861.1\|WP_085438929.1\|372994_373684_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP020861.1\|WP_085438928.1\|371528_372905_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|273387
NZ_CP020861.1\|WP_085438920.1\|344722_345634_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|180448
NZ_CP020861.1\|WP_003641985.1\|368925_369096_-\|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnE	unknown	unknown	unknown
NZ_CP020861.1\|WP_003641944.1\|353075_354905_+\|type-1-glycerol-3-phosphate-oxidase	unknown	unknown	gnl\|CDD\|380303
NZ_CP020861.1\|WP_085438921.1\|346486_346933_-\|ribonuclease-H	unknown	unknown	gnl\|CDD\|178927
NZ_CP020861.1\|WP_085438923.1\|349746_351078_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP020861.1\|WP_072540362.1\|354919_355642_+\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NZ_CP020861.1\|WP_085438925.1\|361712_362105_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020861.1\|WP_085438927.1\|367870_368644_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP020861.1\|WP_085439815.1\|357563_359924_+\|MucBP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377660

Protein	Function_ID	Function_description	E-value
NZ_CP020861.1\|WP_085438922.1\|347170_348697_+\|ABC-transporter-permease/substrate-binding-protein	gnl\|CDD\|270328	cd13610, PBP2_ChoS, Substrate-binding domain ChoS of an osmoregulated ABC-type transporter and related proteins; type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein ChoS of Lactococcus lactis is predicted to be involved in uptake of compatible solutes such as choline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. ChoS belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.16862e-155
NZ_CP020861.1\|WP_086989537.1\|364692_365468_-\|IS5-like-element-ISLpl3-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	1.14622e-32
NZ_CP020861.1\|WP_015825109.1\|348697_349669_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.08528e-132
NZ_CP020861.1\|WP_085438924.1\|351543_353061_+\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NZ_CP020861.1\|WP_003643767.1\|343665_344586_-\|ribonucleoside-hydrolase-RihC	gnl\|CDD\|182713	PRK10768, PRK10768, ribonucleoside hydrolase RihC; Provisional.	0
NZ_CP020861.1\|WP_085438929.1\|372994_373684_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.01715e-10
NZ_CP020861.1\|WP_085438928.1\|371528_372905_+\|HlyD-family-secretion-protein	gnl\|CDD\|273387	TIGR01000, Mesentericin_Y105_secretion_protein_MesE, bacteriocin secretion accessory protein. This family represents an accessory protein that works with the bacteriocin maturation and ABC transport secretion protein described by TIGR01193. [Transport and binding proteins, Other].	0
NZ_CP020861.1\|WP_085438920.1\|344722_345634_+\|oxidoreductase	gnl\|CDD\|180448	PRK06182, PRK06182, short chain dehydrogenase; Validated.	1.21811e-162
NZ_CP020861.1\|WP_003641944.1\|353075_354905_+\|type-1-glycerol-3-phosphate-oxidase	gnl\|CDD\|380303	NF033461, glycerol3P_ox_1, type 1 glycerol-3-phosphate oxidase. Glycerol-3-phosphate oxidase, also called alpha-glycerophosphate oxidase (GlpO), is an FAD-dependent enzyme related to the glycerol-3-phosphate dehydrogenase GlpD. Notably, GlpO releases hydrogen peroxide, which can contribute to virulence.	0
NZ_CP020861.1\|WP_085438921.1\|346486_346933_-\|ribonuclease-H	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	0.000124132
NZ_CP020861.1\|WP_012778296.1\|366230_367229_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.24499e-87
NZ_CP020861.1\|WP_072540362.1\|354919_355642_+\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	4.25252e-82
NZ_CP020861.1\|WP_085438923.1\|349746_351078_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	6.51978e-123
NZ_CP020861.1\|WP_085438927.1\|367870_368644_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	8.72071e-10
NZ_CP020861.1\|WP_085439815.1\|357563_359924_+\|MucBP-domain-containing-protein	gnl\|CDD\|377660	pfam06458, MucBP, MucBP domain. The MucBP (MUCin-Binding Protein) domain is found in a wide variety of bacterial proteins, in several repeats. The domain is found in bacterial peptidoglycan bound proteins and is often found in conjunction with pfam00746 and pfam00560.	8.11682e-10

>NZ_CP020861.1|WP_085439815.1|357563_359924_+|MucBP-domain-containing-protein
MTDSTDKVAPDETVKVGYGKAYDVTKQVKTITGYKRNATLDEHTRGTASKTTKEAVMYYDPLPYNIHVNYLLTDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPTTGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQDNSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVTNANGTKSQQTNTVDGLKSMVTGEQYDLELLNGLKVTAQKEINPSQAATTESKTTTDTSQSGSNQSTSTTATDQTETNESTAGSSTNATNSSSSVDASSANSQGDTEATSQSGTSASADSKTDSSVASSTSQTTDGKTDGETTNTGDTTTGTTTDSGLGFKSPFTEDQNTSSALGSAQTSSSLNSDTSAAVQALIAEPNSTPVVLGEDASFEEGVPVNDPVFSNDEGVSPNNNPSSAATPLAQATNTRARLTQNGKLLYEGTLQADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDKGMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASESSTNSSDSSRTASSAADHSTSSASISDASQSSHSTSSSENSRSESSSSSSTTGDSADADKQAAARSSQTQSNSVNGSSQAVGSSTVTSQSSVPTKANTKQASSTPTTKANRATVVAATSSTAPRQSRATTASASVPSVTSASAAAASRAKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLILTVAITMVIKKRGRD
>NZ_CP020861.1|WP_072540362.1|354919_355642_+|aquaporin-family-protein
MMKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLNPAVSLGMAVAGKFPWAYVIPYSTAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNVLP
>NZ_CP020861.1|WP_003641944.1|353075_354905_+|type-1-glycerol-3-phosphate-oxidase
MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKTGLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPMLLPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGGGVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASFEIHARIVINTTGPWSDTIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQDGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIEASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLETSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAHFNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSLIGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDSLKDGVIATMADYLGWDTATVKAQTELLNQTIAESDLTALKQG
>NZ_CP020861.1|WP_085438924.1|351543_353061_+|glycerol-kinase-GlpK
MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWVEHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQSRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFGTIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSEVYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQLSDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVKSAPDSERAARESHNENEVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK
>NZ_CP020861.1|WP_085438923.1|349746_351078_+|NAD(P)/FAD-dependent-oxidoreductase
MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGASKIDWPALMAHKRGYTDGINDGTLNGLKGQDIATLHGQAHFQSDNQLVVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLIAAMTADGITFDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAAATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATLLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY
>NZ_CP020861.1|WP_015825109.1|348697_349669_+|ABC-transporter-ATP-binding-protein
MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTTSLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPEMKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMDEPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDTPAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEKPSVASGRIQSLDVQATLRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS
>NZ_CP020861.1|WP_085438922.1|347170_348697_+|ABC-transporter-permease/substrate-binding-protein
MQTLIQTFIDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVVRRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGISEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGGLGTFIMLGIDRNDTSLLLIGAISSALLAILLSAFVRWFQTAKPRHALIVFVGILALLGGGGAYSVYANRVETITIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSALKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNTYALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSMEPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTSFANKHPKVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR
>NZ_CP020861.1|WP_085438921.1|346486_346933_-|ribonuclease-H
MATIHLYLASTNHQSTNITATTPAAWVVILRYADHQKALNDGGYGHTETSLALSALTTALATLKRHDLPVHIHTTTEQVAAVISEQRYLSWRQNNWDVPEADQPDLPQWQTLIPIIEEFPNLTITYHPVDDPVMTTTTTTLTAVMTKL
>NZ_CP020861.1|WP_085438920.1|344722_345634_+|oxidoreductase
MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLAAAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFKVNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRMEVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNPGVIAKLMVRAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDSMMNSAVNGTAKLSKVTRRKDRRTGSRHYRHGKIPADNN
>NZ_CP020861.1|WP_003643767.1|343665_344586_-|ribonucleoside-hydrolase-RihC
MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKTTLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAKPLPETAVEALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAEFNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYNDRNQTGVAMHDVNTLFYLLHPEAFTTERMWIDVQTEGPANGETVGDIRGAYHDGKTNATVCVDIDAAAFNKWFLETVAAIDQPK
>NZ_CP020861.1|WP_085438925.1|361712_362105_+|hypothetical-protein
MIRVLQVDPPDDPEYRDPFVLLSDGNMQIWVFADEFNNKIGDKYQYPYMTLFPLLEGDVEMQKGKVFAVKALSDIQYSYDLYGQINENWKLKVGEFVIDSGEENYEGFKRGDFVHFRCDRVDLIDFNKFI
>NZ_CP020861.1|WP_060677620.1|363787_364051_+|hypothetical-protein
MATIIIIGVVIIGITLGLGYWSYLLGKRNQSNLVGTIIPVAYFVVRAILAVMTQTTTHGLVSSLVGSLLFSLIYYGVFVWGKHRANK
>NZ_CP020861.1|WP_085438926.1|364152_364431_+|hypothetical-protein
MLVFIVIGLITAVITIGLGYWSYTLGKRNKSNIVGSVIPAGYFIVRLVFVLVLGEGVRELITSLVGNLVITVIYVLLFVWGRQRFNKQKQTK
>NZ_CP020861.1|WP_086989537.1|364692_365468_-|IS5-like-element-ISLpl3-family-transposase
MTTPKRYELEDAQWDRIKGYFPPYRTGRPSSLDNRTALNAILWLMRSGAPWRDLPERYGSWKTVYSRFRAWVSSGLFEQVFLELIDDPDMENLSLDSTIVRAHQKATGGKKNAECMVENQAIGLSRGGRTTKIHALVDGLGNPLGFRLTGGQVHDSQVASELLEGFDISQSNIIADKAYGTAKLRQYIEDKAGVYTIPPKENTKDKWTCDYHVYCERHLIENFFNQLKNFRRIATRYDKLAHVYLATVYIASICILLK
>NZ_CP020861.1|WP_012778296.1|366230_367229_+|IS30-family-transposase
MSPYNHLTLKDRECILLGVTLNDTYQVIAEKIGCSKATVSREIKRNGGRKAYSAVKAQENYQGRRLKSRRPRLLTDLKLRDFVLHCIVQRQWSPEQISGRLVHENSEWHVSYNTIYRGIERDNLGIKRKNHEARGFARKLRHRGKTRKVKGTIKERRGRFNDVPSVHERPVSCENRSWFGHWESDTVRGKTGRSALVTLVDRKSRYLLSQRVPKVNAKNVTQAMIDLLHTVTPKRVRTLTPDRGTEFAGYREVSQELSIPVYFPDPHAPQQRGTNENTNGLIREYFPKGTDLDQLTDQDIDKFVRDLNHRPRKVLGWKSPFEVFFGTKLRLI
>NZ_CP020861.1|WP_085438927.1|367870_368644_-|CPBP-family-intramembrane-metalloprotease
MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFILTESIILIAVIILNRRYVKQPIHWLPVNIMSILRKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLIVAITEEYAFRGMIFRTLLALNLKKFATLQATIASMMTASLIFAAMHLFNLLSQPVWSVLCQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLKGLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE
>NZ_CP020861.1|WP_003643811.1|368742_368901_-|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF
MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
>NZ_CP020861.1|WP_003641985.1|368925_369096_-|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnE
MLQFEKLQYSRLPQKKLAKISGGFNRGGYNFGKSVRHVVDAIGSVAGIRGILKSIR
>NZ_CP020861.1|WP_085438928.1|371528_372905_+|HlyD-family-secretion-protein
MRKDLLESGEFYGIRFQNFSTLLIIPVTLLLIGTILFSLVAKREIVINGTGTVQPTGTVPVIQATVNSAIKKNYLVEGARVKKGQKLLVYTNVFNRNKLREDNVSKRQLQRQVTALDHFKDGINTDSDVFLTTDEFGYRELLQSYLKQRQIYLTENQMLAAKSSAASTKKATLTKTAQQVVSNTKTSLDAYQALYNAVANGSKYANSAKYGSVFNEYVAKSKEANNANDKKEVKSATLADIQQQIDTLQDSLSSAKVQLEELQDFDDTKYSVETNNTKLAMLKNDQLSEVAEKRMKAEQDLRTVKADIDSLTTQSKSYTIKATKAGVLHVADNYRGAKYVSSGAEIAKILPIIKQQRRVNVKLYISTADISSVKVKQAIRFKVTRNVPKPIILDGVVTKIGVSPVEESKATFYEVTAVVPITADQAQLLRYGMIGQTAIITGKVTWFNYYKDKVLDNN
>NZ_CP020861.1|WP_085438929.1|372994_373684_+|CPBP-family-intramembrane-metalloprotease
MAHSNRQFIINLVIASLISLALVSFSMAPAYLFLIKNNWLMITIGFVIYALEAWGLYWLYRHTARVRHYQVATLKSRGNIAQLGTVIIAMLTIVVLIIVDLKLSAMLNIPETSNSRSLAWMLGEAPLPMIVSVVIFSPICEELIFRGIFFSYALTNQYNHRNYQMVAVVINSLIFASVHVDANWEPWIYYTLMGSILGTTYLLAKRDIRMNILVHMGTNLAVFALAAMN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP020861_1	1.2\|360307\|18\|NZ_CP020861\|CRT	360307-360324	18	NZ_CP020861.1	360223-360240	2	0.889

1. spacer 1.2|360307|18|NZ_CP020861|CRT matches to position: 360223-360240, mismatch: 2, identity: 0.889

gcggccaagaaacataag	CRISPR spacer
gccgctaagaaacataag	Protospacer
** **.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020861_1	1.1\|360259\|30\|NZ_CP020861\|CRT	360259-360288	30	NZ_CP006988	Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence	31047-31076	7	0.767
NZ_CP020861_1	1.1\|360259\|30\|NZ_CP020861\|CRT	360259-360288	30	NC_042345	Phage Salvo, complete genome	4721-4750	8	0.733

1. spacer 1.1|360259|30|NZ_CP020861|CRT matches to NZ_CP006988 (Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence) position: , mismatch: 7, identity: 0.767

cacaagaagaaagcggccaagaaacataag	CRISPR spacer
cacaagaataaagccgccaagaagctccgg	Protospacer
******** ***** ********.* . .*

2. spacer 1.1|360259|30|NZ_CP020861|CRT matches to NC_042345 (Phage Salvo, complete genome) position: , mismatch: 8, identity: 0.733

cacaagaagaaagcggccaagaaacataag	CRISPR spacer
ccggggaagtaagcggacaagaaacatact	Protospacer
*  ..**** ****** ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37664 : 54774

Lactobacillus_phage(30.0%)

tail,terminase,head,capsid,integrase,portal

attL 34235:34248|attR 44363:44376

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
34235:34248	attL	NA	NA	NA	NA
WP_064578503.1\|37664_38819_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	6.1e-60	36.7
WP_062690071.1\|38875_39562_-	helix-turn-helix domain-containing protein	Q20DG0	Lactobacillus_phage	2.6e-10	50.6
WP_062690069.1\|39692_39875_+	hypothetical protein	NA	NA	NA	NA
WP_062690067.1\|40140_40395_+	hypothetical protein	NA	NA	NA	NA
WP_062690065.1\|40391_41195_+	bifunctional DNA primase/polymerase	NA	NA	NA	NA
WP_062690063.1\|41194_42769_+	hypothetical protein	NA	NA	NA	NA
WP_062690061.1\|43030_43387_+	hypothetical protein	NA	NA	NA	NA
WP_062690059.1\|43386_43578_+	hypothetical protein	NA	NA	NA	NA
WP_085438833.1\|43564_43903_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	3.2e-09	36.6
WP_046947486.1\|43895_44285_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	45.6
WP_085438834.1\|45068_45542_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
44363:44376	attR	NA	NA	NA	NA
WP_085438835.1\|45538_47242_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.4e-121	40.5
WP_085438836.1\|47195_47396_+	hypothetical protein	NA	NA	NA	NA
WP_085438837.1\|47396_48497_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	4.6e-49	34.6
WP_128484744.1\|48493_50023_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	2.1e-44	26.0
WP_003643632.1\|50138_50408_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_161325197.1\|50566_50935_+	hypothetical protein	NA	NA	NA	NA
WP_003643340.1\|51058_51259_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-20	71.4
WP_085438839.1\|52178_52886_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-44	40.1
WP_003641656.1\|52899_54774_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.5e-34	31.8

DBSCAN-SWA_2

324131 : 368901

Staphylococcus_phage(28.57%)

transposase,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085438914.1\|324131_325784_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.5e-93	41.5
WP_003646432.1\|325958_327125_-	hypothetical protein	NA	NA	NA	NA
WP_003641920.1\|327719_328535_+	ABC transporter permease	NA	NA	NA	NA
WP_003641921.1\|328547_329639_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7
WP_003643757.1\|330017_330290_+	hypothetical protein	NA	NA	NA	NA
WP_011100970.1\|330516_331059_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085438915.1\|331055_332501_+	MFS transporter	NA	NA	NA	NA
WP_003643760.1\|332826_334143_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.1e-33	29.6
WP_085438916.1\|334638_335598_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003641927.1\|335700_335970_+	hypothetical protein	NA	NA	NA	NA
WP_085438917.1\|336199_336763_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_085438918.1\|336956_337625_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|337782_339288_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|339552_339921_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|340033_340543_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_085438919.1\|340573_341770_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|341879_342350_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|342368_342824_+	hypothetical protein	NA	NA	NA	NA
WP_003643766.1\|342927_343500_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003643767.1\|343665_344586_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_085438920.1\|344722_345634_+	oxidoreductase	NA	NA	NA	NA
WP_085438921.1\|346486_346933_-	ribonuclease H	NA	NA	NA	NA
WP_085438922.1\|347170_348697_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|348697_349669_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_085438923.1\|349746_351078_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_085438924.1\|351543_353061_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|353075_354905_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_072540362.1\|354919_355642_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	4.1e-30	31.9
WP_085439815.1\|357563_359924_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_085438925.1\|361712_362105_+	hypothetical protein	NA	NA	NA	NA
WP_060677620.1\|363787_364051_+	hypothetical protein	NA	NA	NA	NA
WP_085438926.1\|364152_364431_+	hypothetical protein	NA	NA	NA	NA
WP_086989537.1\|364692_365468_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_012778296.1\|366230_367229_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.4e-52	37.6
WP_085438927.1\|367870_368644_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|368742_368901_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA

DBSCAN-SWA_3

1015716 : 1022783

Escherichia_phage(50.0%)

integrase

attL 1009175:1009187|attR 1024361:1024373

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1009175:1009187	attL	NA	NA	NA	NA
WP_085439098.1\|1015716_1016580_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	4.2e-98	62.1
WP_085439099.1\|1016602_1017892_+	cellulase family glycosylhydrolase	A0A2K9VCN9	Lactobacillus_phage	4.5e-27	24.1
WP_085439100.1\|1017951_1018533_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.3e-38	45.1
WP_085439101.1\|1018542_1019571_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.2e-69	42.4
WP_063731603.1\|1019640_1020483_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.9e-34	37.2
WP_085439103.1\|1022195_1022783_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	3.6e-32	42.5
1024361:1024373	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1174044 : 1284386

103

Lactobacillus_phage(85.0%)

tRNA,transposase,tail,terminase,head,protease,holin,capsid,integrase,portal

attL 1175935:1175950|attR 1195271:1195286

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033615339.1\|1174044_1174731_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643149.1\|1175402_1175879_-	MarR family transcriptional regulator	NA	NA	NA	NA
1175935:1175950	attL	NA	NA	NA	NA
WP_046038903.1\|1175995_1176508_-	hypothetical protein	NA	NA	NA	NA
WP_003643147.1\|1176622_1176910_+	hypothetical protein	NA	NA	NA	NA
WP_164886065.1\|1176974_1179242_+	ATP-binding cassette domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	8.8e-119	31.5
WP_085439159.1\|1179883_1181020_-\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	1.5e-212	98.9
WP_085439160.1\|1181464_1181647_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	1.5e-13	64.9
WP_016058347.1\|1181789_1182104_-	hypothetical protein	E9LUS3	Lactobacillus_phage	7.7e-50	100.0
WP_085439161.1\|1182096_1182510_-	hypothetical protein	E9LUS4	Lactobacillus_phage	2.8e-71	98.5
WP_003641360.1\|1183105_1183495_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_003641361.1\|1183525_1183852_-	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003644552.1\|1184108_1184324_+	hypothetical protein	NA	NA	NA	NA
WP_085439163.1\|1184336_1185089_+	phage antirepressor KilAC domain-containing protein	E9LUT0	Lactobacillus_phage	2.2e-58	96.5
WP_157515417.1\|1185103_1185277_+	hypothetical protein	NA	NA	NA	NA
WP_021336779.1\|1185273_1185465_-	hypothetical protein	NA	NA	NA	NA
WP_085439164.1\|1185557_1185887_+	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	5.8e-48	82.6
WP_085439165.1\|1185976_1186231_+	hypothetical protein	NA	NA	NA	NA
WP_085439166.1\|1186233_1186458_+	hypothetical protein	E9LUT8	Lactobacillus_phage	2.2e-27	82.4
WP_164742702.1\|1186506_1186653_+	hypothetical protein	E9LUT9	Lactobacillus_phage	8.0e-18	95.7
WP_085439167.1\|1186652_1187513_+	DUF1351 domain-containing protein	A0A0P0IV40	Lactobacillus_phage	1.2e-36	34.0
WP_085439168.1\|1187513_1188176_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	1.0e-120	99.1
WP_085439169.1\|1188177_1188837_+	DUF669 domain-containing protein	E9LUU2	Lactobacillus_phage	4.5e-92	95.4
WP_085439170.1\|1188883_1189576_+	hypothetical protein	E9LUU3	Lactobacillus_phage	4.7e-132	98.7
WP_085439171.1\|1190401_1191187_+	ATP-binding protein	E9LUN6	Lactobacillus_phage	3.1e-132	90.8
WP_085439173.1\|1191358_1192036_+	AP2 domain-containing protein	A0A060QSU6	Streptococcus_phage	5.3e-11	49.3
WP_085439174.1\|1192113_1192422_+	hypothetical protein	E9LUN7	Lactobacillus_phage	3.5e-47	93.1
WP_085439175.1\|1192506_1192998_+	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	1.0e-85	91.8
WP_164886064.1\|1193065_1193224_+	hypothetical protein	O03920	Lactobacillus_phage	1.8e-15	80.8
WP_085439176.1\|1193239_1193620_+	hypothetical protein	K4I239	Lactobacillus_phage	1.8e-32	53.4
WP_187337941.1\|1193701_1194139_+	hypothetical protein	A0A2P0ZKW8	Lactobacillus_phage	5.4e-41	63.2
WP_085439177.1\|1194131_1194302_+	hypothetical protein	E9LUP4	Lactobacillus_phage	2.9e-19	91.1
WP_085439178.1\|1195143_1196019_+	hypothetical protein	NA	NA	NA	NA
1195271:1195286	attR	NA	NA	NA	NA
WP_128484719.1\|1196086_1196416_+	hypothetical protein	NA	NA	NA	NA
WP_085439180.1\|1196483_1197149_+	hypothetical protein	NA	NA	NA	NA
WP_187337943.1\|1197256_1197742_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	8.8e-77	89.7
WP_074028658.1\|1197734_1198250_+	HNH endonuclease	U5U4N5	Lactobacillus_phage	1.2e-31	43.9
WP_085439182.1\|1198381_1198837_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	1.0e-79	96.0
WP_063488413.1\|1200767_1200962_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	1.8e-25	95.3
WP_085439183.1\|1200964_1202158_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	4.5e-223	98.5
WP_085439184.1\|1202135_1202891_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.3e-122	92.4
WP_085439185.1\|1202890_1204123_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	3.7e-212	93.4
WP_085439186.1\|1204195_1204528_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.4e-43	80.0
WP_085439187.1\|1204517_1204865_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	7.0e-44	73.9
WP_085439188.1\|1204867_1205275_+	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	1.8e-62	89.4
WP_085439189.1\|1205274_1205655_+	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.2e-57	88.9
WP_085439190.1\|1205670_1206336_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	9.5e-106	90.4
WP_085439191.1\|1206410_1206785_+\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	4.6e-57	94.4
WP_085439192.1\|1206829_1207015_+	hypothetical protein	NA	NA	NA	NA
WP_085439193.1\|1213880_1216238_+\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	91.5
WP_085439194.1\|1216255_1219108_+	hypothetical protein	E9LUR4	Lactobacillus_phage	1.6e-138	53.7
WP_085439195.1\|1219100_1219349_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.4e-30	95.9
WP_164886062.1\|1219352_1219514_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	2.3e-18	96.2
WP_085439196.1\|1219497_1220619_+	collagen-like protein	E9LUR7	Lactobacillus_phage	1.7e-54	93.4
WP_085439197.1\|1220615_1220861_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.6e-18	80.0
WP_085439198.1\|1220872_1222045_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	6.6e-195	89.2
WP_085439199.1\|1222044_1222308_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-35	93.1
WP_164886061.1\|1222318_1222696_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	7.2e-18	70.0
WP_015825436.1\|1223270_1223696_-	hypothetical protein	NA	NA	NA	NA
WP_164886060.1\|1223860_1224874_-	hypothetical protein	NA	NA	NA	NA
WP_003643142.1\|1224979_1225501_+	GtrA family protein	NA	NA	NA	NA
WP_085439201.1\|1225600_1225960_-	YisL family protein	NA	NA	NA	NA
WP_085439202.1\|1226032_1227889_-	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_085439203.1\|1227902_1230209_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_085439204.1\|1231097_1232735_+	hypothetical protein	NA	NA	NA	NA
WP_013355451.1\|1232712_1233888_+	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	2.9e-49	31.9
WP_085439205.1\|1233890_1234514_+	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	4.8e-27	40.6
WP_003645242.1\|1234503_1235460_+	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_085439206.1\|1235681_1237421_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_085439207.1\|1237853_1239629_+	SLC13 family permease	NA	NA	NA	NA
WP_085439208.1\|1239904_1241296_+	MATE family efflux transporter	NA	NA	NA	NA
WP_003643130.1\|1241422_1241668_+	hypothetical protein	NA	NA	NA	NA
WP_085439209.1\|1242056_1242503_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_085439210.1\|1242774_1244463_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9
WP_011101384.1\|1244668_1245145_-	hypothetical protein	NA	NA	NA	NA
WP_085439211.1\|1245414_1247409_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.1e-35	40.4
WP_003643125.1\|1248093_1248750_+	hypothetical protein	NA	NA	NA	NA
WP_003643123.1\|1251649_1252120_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003643122.1\|1252404_1252743_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003643121.1\|1252739_1253039_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_085439212.1\|1253072_1254428_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_085439213.1\|1254430_1255903_+	family 1 glycosylhydrolase	NA	NA	NA	NA
WP_076655257.1\|1257099_1257711_-	L,D-transpeptidase	NA	NA	NA	NA
WP_003644263.1\|1257981_1258224_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_085439214.1\|1258326_1259778_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_003645229.1\|1260011_1260620_+	LysE family transporter	NA	NA	NA	NA
WP_013355465.1\|1260685_1261807_+	aminotransferase	NA	NA	NA	NA
WP_003644266.1\|1261984_1262446_+	arginine repressor	NA	NA	NA	NA
WP_003643108.1\|1262939_1265069_+	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_003643106.1\|1265159_1265504_+	YlbF family regulator	NA	NA	NA	NA
WP_046038950.1\|1265573_1266794_+	DNA repair exonuclease	NA	NA	NA	NA
WP_164886343.1\|1266780_1269261_+	AAA family ATPase	NA	NA	NA	NA
WP_015825453.1\|1269271_1270252_+	HD domain-containing protein	NA	NA	NA	NA
WP_085439216.1\|1270569_1271799_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.5e-213	97.2
WP_085439217.1\|1271889_1272861_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.9e-179	97.5
WP_085439218.1\|1273046_1273994_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.9e-177	99.4
WP_085439219.1\|1274337_1274952_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	3.1e-111	99.0
WP_085439220.1\|1274954_1277393_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.1
WP_085439221.1\|1277480_1278041_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.2e-100	98.9
WP_085439825.1\|1278126_1279095_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	6.8e-20	29.9
WP_086989537.1\|1279066_1279842_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_021356350.1\|1280013_1280454_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	4.4e-75	95.9
WP_085439222.1\|1280844_1282764_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	1.7e-54	72.2
WP_085439223.1\|1283390_1284386_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_5

1290091 : 1298784

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085439224.1\|1290091_1291159_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.6e-38	33.9
WP_046038969.1\|1291159_1291762_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.1e-23	38.9
WP_085439225.1\|1291763_1292978_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.1e-86	46.9
WP_085439226.1\|1292974_1293454_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.0e-32	46.7
WP_085439227.1\|1293484_1293994_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_085439228.1\|1294034_1294955_-\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-50	37.9
WP_085439229.1\|1295258_1295822_-	hypothetical protein	NA	NA	NA	NA
WP_011101408.1\|1295910_1296552_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_003640242.1\|1296687_1297314_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_085439230.1\|1297467_1298784_+	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	6.6e-10	25.0

DBSCAN-SWA_6

2128102 : 2176149

Lactobacillus_phage(55.88%)

tail,terminase,head,holin,capsid,integrase,portal

attL 2142036:2142050|attR 2170961:2170975

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_187337934.1\|2128102_2128483_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	2.0e-15	66.2
WP_085439457.1\|2128493_2128757_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	6.9e-36	94.3
WP_085439458.1\|2128756_2129935_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.9e-194	87.5
WP_085439459.1\|2130849_2133036_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_085439460.1\|2133025_2133292_-	hypothetical protein	NA	NA	NA	NA
WP_164886045.1\|2133288_2134467_-\|tail	phage tail protein	Q9T1A5	Listeria_phage	7.7e-18	24.4
WP_085439462.1\|2134466_2135363_-\|tail	phage tail family protein	A8ATA8	Listeria_phage	2.4e-19	28.5
WP_085439463.1\|2135372_2139449_-	tape measure protein	E9LUR1	Lactobacillus_phage	2.6e-81	43.9
WP_057717834.1\|2139448_2139685_-	hypothetical protein	NA	NA	NA	NA
WP_085439464.1\|2139753_2140266_-	hypothetical protein	NA	NA	NA	NA
WP_085439465.1\|2140283_2140859_-\|tail	phage tail protein	NA	NA	NA	NA
WP_085439466.1\|2140870_2141257_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_085439467.1\|2141262_2141814_-\|tail	phage tail protein	NA	NA	NA	NA
WP_085439830.1\|2141803_2142127_-	hypothetical protein	NA	NA	NA	NA
2142036:2142050	attL	NA	NA	NA	NA
WP_085439468.1\|2142131_2142482_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_085439469.1\|2142496_2143579_-\|capsid	phage capsid protein	A0A0P0HSG2	Acinetobacter_phage	2.3e-40	33.2
WP_085439470.1\|2143592_2144240_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_085439471.1\|2144348_2145293_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_085439472.1\|2145306_2146983_-\|portal	phage portal protein	D2IYW2	Enterococcus_phage	7.8e-64	32.4
WP_085439473.1\|2146972_2148271_-\|terminase	PBSX family phage terminase large subunit	B7T0C6	Staphylococcus_virus	1.3e-114	50.4
WP_128484705.1\|2148475_2149336_-\|terminase	terminase small subunit	V5URT8	Oenococcus_phage	1.5e-55	48.9
WP_085439474.1\|2149394_2149715_-	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	1.2e-18	47.1
WP_016511179.1\|2149938_2150202_-	hypothetical protein	A0A1S5SBT9	Streptococcus_phage	2.6e-22	58.6
WP_085439476.1\|2150389_2151148_-	hypothetical protein	NA	NA	NA	NA
WP_003642805.1\|2152164_2152626_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_085439477.1\|2152753_2152921_-	hypothetical protein	E9LUP4	Lactobacillus_phage	2.6e-12	82.6
WP_085439478.1\|2152917_2153370_-	DUF1642 domain-containing protein	A0A2K9VCG9	Lactobacillus_phage	3.5e-35	50.0
WP_164886043.1\|2153442_2153844_-	hypothetical protein	K4I239	Lactobacillus_phage	1.7e-33	56.6
WP_085439480.1\|2153836_2154127_-	hypothetical protein	A0A2K9VCZ2	Lactobacillus_phage	1.7e-27	69.7
WP_085439481.1\|2154123_2154525_-	hypothetical protein	A0A2K9VC36	Lactobacillus_phage	1.2e-10	35.2
WP_164886042.1\|2154508_2154685_-	hypothetical protein	E9LUP2	Lactobacillus_phage	5.0e-14	69.0
WP_085439482.1\|2154827_2155208_-	hypothetical protein	NA	NA	NA	NA
WP_085439483.1\|2155204_2155723_-	hypothetical protein	O03915	Lactobacillus_phage	1.7e-54	68.4
WP_064578077.1\|2155719_2156007_-	hypothetical protein	NA	NA	NA	NA
WP_085439484.1\|2156003_2156912_-	DnaD domain protein	NA	NA	NA	NA
WP_052748123.1\|2156991_2157957_-	hypothetical protein	A6M982	Geobacillus_virus	5.3e-65	54.5
WP_083202669.1\|2157968_2158499_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	4.6e-55	59.2
WP_050339445.1\|2159003_2159516_-	transcriptional regulator	D6PST4	Lactobacillus_phage	3.2e-29	44.7
WP_064971995.1\|2159583_2159889_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2159900_2160071_-	hypothetical protein	NA	NA	NA	NA
WP_011101083.1\|2160083_2160314_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101082.1\|2160486_2160849_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
WP_085439486.1\|2160860_2161274_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	4.5e-05	31.3
WP_085439487.1\|2161304_2162801_+	TerB N-terminal domain-containing protein	NA	NA	NA	NA
WP_063486624.1\|2163323_2163659_+	hypothetical protein	A0A1B0Y4P2	Lactobacillus_phage	4.1e-25	52.2
WP_076636272.1\|2163935_2164112_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_085439488.1\|2164269_2165889_+	SIR2 family protein	A0A1S5SA14	Streptococcus_phage	3.1e-94	48.2
WP_085439489.1\|2166153_2167275_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	1.2e-44	31.5
WP_003642774.1\|2167626_2167833_-	hypothetical protein	NA	NA	NA	NA
WP_085439490.1\|2168250_2168556_-	hypothetical protein	NA	NA	NA	NA
WP_024971530.1\|2168638_2169010_-	hypothetical protein	NA	NA	NA	NA
WP_085439491.1\|2169167_2169437_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_128484703.1\|2169846_2171388_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	3.3e-45	25.8
2170961:2170975	attR	NA	NA	NA	NA
WP_085439492.1\|2171384_2172485_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	7.9e-49	34.3
WP_033611503.1\|2172485_2172686_-	hypothetical protein	NA	NA	NA	NA
WP_085439493.1\|2172639_2174343_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.2e-121	40.1
WP_085439494.1\|2174339_2174813_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_085439495.1\|2175428_2175818_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	8.8e-19	45.6
WP_085439496.1\|2175810_2176149_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.0e-07	33.6

DBSCAN-SWA_7

2383556 : 2392067

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645867.1\|2383556_2384135_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_085439568.1\|2384127_2385153_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.2e-60	41.0
WP_003642591.1\|2385149_2386604_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645864.1\|2386588_2388808_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_011101895.1\|2388800_2389481_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_085439569.1\|2389480_2389735_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2389736_2390468_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_046811071.1\|2390470_2391601_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2391584_2392067_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr_ID: NZ_CP020861.1|WP_060677620.1|363787_364051_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP020861.1|WP_085438926.1|364152_364431_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP020861.1|WP_060677620.1|363787_364051_+|hypothetical-protein

363787_364051_+

87 aa aa

324131-368901

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP020861_1	Orphan	1.2\|360307\|18\|NZ_CP020861\|CRT	360307-360324	18	360223-360240	2

1. spacer 1.2|360307|18|NZ_CP020861|CRT matches to NZ_CP020861 position: 360223-360240, mismatch: 2

gcggccaagaaacataag	CRISPR spacer
gccgctaagaaacataag	Protospacer
** **.************

NZ_CP020861.1|WP_085438926.1|364152_364431_+|hypothetical-protein

364152_364431_+

92 aa aa

324131-368901

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP020861_1	Orphan	1.2\|360307\|18\|NZ_CP020861\|CRT	360307-360324	18	360223-360240	2

1. spacer 1.2|360307|18|NZ_CP020861|CRT matches to NZ_CP020861 position: 360223-360240, mismatch: 2

gcggccaagaaacataag	CRISPR spacer
gccgctaagaaacataag	Protospacer
** **.************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020861

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information