CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018403	Burkholderia pseudomallei strain 2013746877 chromosome 2, complete sequence	1 crisprs	WYL,cas3,DEDDh,csa3,DinG	0	8	10	0
NZ_CP018402	Burkholderia pseudomallei strain 2013746877 chromosome 1, complete sequence	2 crisprs	DinG,cas3,csa3,PD-DExK	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018403_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018403_1

1009120-1009575

Orphan

Consensus_repeat	Method
AAGCGCTGAAGCGCTGACTC	CRT

9 spacers

The CRISPR arrays of NZ_CP018403_1

>merge|NZ_CP018403|1|1009120-1009575|CRT
GAGCGCTGAAGCGTTCGCTTCGGTCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCGACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGTTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTAAAGCGCTGACGCTGGCCAACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGCTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACTCTGGCCGACCACGGCATGGGATCGGAGTAAGTGCTGAAGCGCTGACTCCGATCGACCGCCGCGGGGCCAGAGTAAAGCGCTGAAGCGCTGACGCTGGCCAACCACGGCATGGGATCGGAGTAAGCGCTGAAGCGCTGACTCCGATTGACAGGAGTCGATATGGCAACCATCAAAGTAGACGTCGTCAGCGCCGAAGAGCAGATCT

>NZ_CP018403|1|1|1009120-1009575|CRT
GAGCGCTGAAGCGTTCGCTT	CGGTCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCGACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGTTGACTC	CGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTAAAGCGCTGACGC	TGGCCAACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGCTGACTC	CGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACTC	TGGCCGACCACGGCATGGGATCGGAGT
AAGTGCTGAAGCGCTGACTC	CGATCGACCGCCGCGGGGCCAGAGTA
AAGCGCTGAAGCGCTGACGC	TGGCCAACCACGGCATGGGATCGGAGT
AAGCGCTGAAGCGCTGACTC	CGATTGACAGGAGTCGATATGGCAACCATCAAAGTAGACGTCGT
CAGCGCCGAAGAGCAGATCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018403.1\|WP_025986094.1\|1002017_1002548_+\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP018403.1\|WP_004524507.1\|1005044_1006586_+\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|236448
NZ_CP018403.1\|WP_004185243.1\|1007612_1009007_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|236447
NZ_CP018403.1\|WP_004525749.1\|1013024_1013810_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270231
NZ_CP018403.1\|WP_004185283.1\|1003985_1004456_+\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|180240
NZ_CP018403.1\|WP_004195841.1\|1018027_1018204_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018403.1\|WP_004202912.1\|1017762_1017933_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|341251
NZ_CP018403.1\|WP_004524502.1\|1013949_1015044_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP018403.1\|WP_009967348.1\|1001743_1001902_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018403.1\|WP_111993829.1\|1012377_1012512_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP018403.1\|WP_004545277.1\|1015484_1017752_+\|primosomal-protein-N'	unknown	unknown	gnl\|CDD\|235514
NZ_CP018403.1\|WP_004524508.1\|1004458_1004998_+\|F0F1-ATP-synthase-subunit-delta	unknown	unknown	gnl\|CDD\|235593
NZ_CP018403.1\|WP_004195834.1\|1011959_1012154_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018403.1\|WP_071810422.1\|1018216_1022146_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|236989
NZ_CP018403.1\|WP_071810948.1\|1012504_1012819_+\|CoA-binding-protein	unknown	unknown	gnl\|CDD\|224745
NZ_CP018403.1\|WP_009922758.1\|1000595_1001747_+\|citrate-transporter	unknown	unknown	gnl\|CDD\|238537
NZ_CP018403.1\|WP_004195828.1\|1003588_1003858_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|180739
NZ_CP018403.1\|WP_004536471.1\|1010187_1011918_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236236
NZ_CP018403.1\|WP_004538602.1\|1002660_1003512_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP018403.1\|WP_004195831.1\|1006657_1007533_+\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|235535

Protein	Function_ID	Function_description	E-value
NZ_CP018403.1\|WP_025986094.1\|1002017_1002548_+\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.24671e-11
NZ_CP018403.1\|WP_004524507.1\|1005044_1006586_+\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|236448	PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated.	0
NZ_CP018403.1\|WP_004185243.1\|1007612_1009007_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|236447	PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated.	0
NZ_CP018403.1\|WP_004525749.1\|1013024_1013810_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270231	cd01069, PBP2_PheC, Cyclohexadienyl dehydratase, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes cyclohexadienyl dehydratase PheC. These proteins catalyze the decarboxylation of prephenate to phenylpyruvate in the alternative phenylalanine biosynthesis pathway in some proteobacteria and archaea. The PheC proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. Since they the PheC proteins are so similar to periplasmic binding proteins, (PBP), it is evolutionarily plausible that several pre-existing PBP proteins might have been recruited to perform the enzymatic function.	1.47897e-125
NZ_CP018403.1\|WP_004185283.1\|1003985_1004456_+\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|180240	PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated.	5.5546e-56
NZ_CP018403.1\|WP_004202912.1\|1017762_1017933_-\|hypothetical-protein	gnl\|CDD\|341251	cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM). MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The acyl-CoA is a key intermediate in many important biosynthetic and catabolic processes. MACS enzymes are localized to mitochondria. Two murine MACS family proteins are found in liver and kidney. In rodents, a MACS member is detected particularly in the olfactory epithelium and is called O-MACS. O-MACS demonstrates substrate preference for the fatty acid lengths of C6-C12.	0.00325788
NZ_CP018403.1\|WP_004524502.1\|1013949_1015044_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP018403.1\|WP_111993829.1\|1012377_1012512_+\|hypothetical-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	7.42552e-11
NZ_CP018403.1\|WP_004545277.1\|1015484_1017752_+\|primosomal-protein-N'	gnl\|CDD\|235514	PRK05580, PRK05580, primosome assembly protein PriA; Validated.	0
NZ_CP018403.1\|WP_004524508.1\|1004458_1004998_+\|F0F1-ATP-synthase-subunit-delta	gnl\|CDD\|235593	PRK05758, PRK05758, F0F1 ATP synthase subunit delta; Validated.	2.00477e-65
NZ_CP018403.1\|WP_071810422.1\|1018216_1022146_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	gnl\|CDD\|236989	PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0
NZ_CP018403.1\|WP_071810948.1\|1012504_1012819_+\|CoA-binding-protein	gnl\|CDD\|224745	COG1832, COG1832, Predicted CoA-binding protein [General function prediction only].	1.02e-33
NZ_CP018403.1\|WP_009922758.1\|1000595_1001747_+\|citrate-transporter	gnl\|CDD\|238537	cd01117, YbiR_permease, Putative anion permease YbiR. Based on sequence similarity, YbiR proteins are predicted to function as anion translocating permeases in eubacteria, archaea and plants. They belong to ArsB/NhaD superfamily of permeases that have been shown to translocate sodium, sulfate, arsenite and organic anions. A typical ArsB/NhaD permease is composed of 8-13 transmembrane domains.	3.12688e-60
NZ_CP018403.1\|WP_004195828.1\|1003588_1003858_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|180739	PRK06876, PRK06876, F0F1 ATP synthase subunit C; Validated.	4.52385e-24
NZ_CP018403.1\|WP_004536471.1\|1010187_1011918_+\|AMP-binding-protein	gnl\|CDD\|236236	PRK08315, PRK08315, AMP-binding domain protein; Validated.	0
NZ_CP018403.1\|WP_004538602.1\|1002660_1003512_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	4.13283e-72
NZ_CP018403.1\|WP_004195831.1\|1006657_1007533_+\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|235535	PRK05621, PRK05621, F0F1 ATP synthase subunit gamma; Validated.	1.65914e-157

>NZ_CP018403.1|WP_004185243.1|1007612_1009007_+|F0F1-ATP-synthase-subunit-beta
MSTAALVEGKIVQCIGAVIDVEFPRESMPKIYDALILEGSELTLEVQQQLGDGVVRTICLGASDGLRRGVVVKNTGNPISVPVGKPTLGRIMDVLGRPIDEAGPIESENKRSIHQKAPAFDELSPSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELINNIAKEHGGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRVALTGLTMAEHFRDEGLDVLFFVDNIYRFTLAGTEVSALLGRMPSAVGYQPTLAEEMGKLQERITSTKKGSITSVQAVYVPADDLTDPSPATTFGHLDATVVLSRDIASLGIYPAVDPLDSTSRQIDPNVIGEEHYSITRRVQQTLQRYKELRDIIAILGMDELSPEDKLSVARARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMIVDGECDHLPEQAFYMVGTIDEAFEKAKKIQ
>NZ_CP018403.1|WP_004195831.1|1006657_1007533_+|F0F1-ATP-synthase-subunit-gamma
MAGMKEIRGKIKSVQNTRKITKAMEMVAASKMRRAQERMRAARPYAEKVRAIAAHMSRANPEYRHPFMVANDGVKTAGMILVTTDKGLCGGLNTNVLRASLQKFKELEEQGQKVEATAIGGKGLGFLNRFGAKVISQVVHLGDTPHLDKLIGAVKTQLDLYSEGKLSAVYLAYTRFVNTMKQETVIEQLLPLSSEHFDANDGTPATSWDYIYEPDAQAVVDELLVRYVEALVYQAVAENMASEQSARMVAMKAASDNAKTVISELQLSYNKSRQAAITKELSEIVGGAAAV
>NZ_CP018403.1|WP_004524507.1|1005044_1006586_+|F0F1-ATP-synthase-subunit-alpha
MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTFGLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGPVNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAIDTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVAASASESAAMQYLAPYAGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERAARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLFNAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQLERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHADLIKRIEDTKDLSKDDESALHAALKDFKKSGAY
>NZ_CP018403.1|WP_004524508.1|1004458_1004998_+|F0F1-ATP-synthase-subunit-delta
MAELATIARPYAEALFRVAEGGDISAWSTLVQELAQVAQLPEVLSVASSPKVSRTQVAELLLAALKSPLASGAQAKNFVQMLVDNHRIALLPEIAEQFEALKNAREGAADVQIVSAFPLEGAQLAELVTSLERKFKRKLKPAVEVDSSLIGGVRVTVGDEVLDTSVRARLAGMQAALTA
>NZ_CP018403.1|WP_004185283.1|1003985_1004456_+|F0F1-ATP-synthase-subunit-B
MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKRVDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETLRGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL
>NZ_CP018403.1|WP_004195828.1|1003588_1003858_+|F0F1-ATP-synthase-subunit-C
MQAFIANIQGLTAIGIGIIIGLGAIGACIGIALMGGKYIEACARQPELINPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSKLAG
>NZ_CP018403.1|WP_004538602.1|1002660_1003512_+|F0F1-ATP-synthase-subunit-A
MAASEGTRAPDPSEYIAHHLQNFSTSHQTSIFDIHVWNLDTLFWSIVCGLITILLLRLAARKATSGVPGRFQCAVEMLVEMVEDQSKAIVHGNRAFIAPLALTVFVWVALMNSLDFLPVDLPGRVIGWLGLSGIISHHRIVPTADLNGTLGIALGVFVLMLYYSIKIKGAGGFAHELVSAPFGSHPLLWIPNLALNIVEFVAKTVSLGMRLFGNMYAGELVFLLIALLGSMWSFGGDATFLGFVGHVIAGSVWAIFHILIVLLQAFIFMMLTLVYLGQAHDAH
>NZ_CP018403.1|WP_025986094.1|1002017_1002548_+|ATP-synthase-subunit-I
MADRAPDKRHEDRRAAQRTVSGAVGRRAAAADDWDAEHQEDDVVPLTRAEAQALFGPEVSRPSRVTPYRVVVAQMVLSLVATLAWWLFSRSPGAAAQSAFLGGAIGWVPSALFVARLRLSGAGTVMGWVAGEALKLGVTIAMFAAVAFGYPGVHWVPLLVTYLVVLKTYWIALAWR
>NZ_CP018403.1|WP_009967348.1|1001743_1001902_+|hypothetical-protein
MSSGAHRNGAGQRAFDARRAIENTYLTTVIGRQKFANFSHHEPLFHTDFCRV
>NZ_CP018403.1|WP_009922758.1|1000595_1001747_+|citrate-transporter
MPLDRAVSNSVVGRAPARIIAFVRHEPVLSILVAALIALQAVHSLSAIALVRLVDWQTVATLAGLLMLTKALELSGFLMWLAHRIVHRVRSERALAALLVVFAAALSVWLTNDVALFVVIPLVLSLRELTPLPFKRLVIYIALAVNAGAIATPLGNPQNLFLWQLSGVSFGRFVIALGPLALVLMALLLAMVVFAFDGRPLDLSRDSTERPVDRAQAFATVAMFAGFVLLADAHHALAGVLAVAAVFLIVRRDAVLKIDWLLLLIFVLMFIVLRSAASLPAVHQAIAGIGLDTPLRAYAAGALLSQIISNVPAAILLSEFTHDWRALAFGVSVGGFGIAFGSLANLIAIRLSRARGMWLPFHLVSIPFGIASAVLGALLLHYF
>NZ_CP018403.1|WP_004536471.1|1010187_1011918_+|AMP-binding-protein
MAADSGMGALIAPMHGLSYVRGPADVPLSDATIGQFLLDTVARFPDRAAVVFREQGVRWTWREFADEVDALAAALIELGIARGDRVGIWSPNRAEWLLTQFATARIGAVLVNVNPAYRLAELEYALNKVGCKLLIAAERFKTSAYAEMIAEIAPELATTRAGDVLCAARVPSLRTVVTMSDAAHAGMLSFADVLARGRAALASARLDAIGATLDCRDPINIQFTSGTTGSPKGATLTHRNVVNNARSIANVMRLTEADAMCIPVPLYHCFGMVLSVLACVSAGAKMVFPGAAFEPGATLAAVSDERCTALQGVPTMFIAELDHPDFDRFDLSTLRTGIMAGSPCPIETMKRVVAKMHMSEVTIAYGMTETSPVSFQSATTDSLEKRTTTVGRIQPHLEAKIVDATGAIVPVGETGELCTRGYSVMLGYWDDEARTREAVVDGWMRTGDLATLDEEGFCNIVGRLKDMLIRGGENVYPREIEEFLFRHPKIQSVQVFGVPDSKYGEEVCAWIVLRAGETMTDDELREFCSGQIAHYKVPRYVRFVDELPMTVTGKVQKFVMRERMIDELGLSVQQTA
>NZ_CP018403.1|WP_004195834.1|1011959_1012154_+|hypothetical-protein
MSPLKTTRYGVSARRPKVERIGMGRRRLQQGCPWEGIRYETDGLVIRACVRSHAAHETASVLKP
>NZ_CP018403.1|WP_111993829.1|1012377_1012512_+|hypothetical-protein
MTAISTDEVPRKILKRDRVIAVVGLSDKPYRPSYEVAAYLRQNG
>NZ_CP018403.1|WP_071810948.1|1012504_1012819_+|CoA-binding-protein
MVNRIVPVNPLLAGAALLGERVHPSLADARAALAADGIEIDMVDVFRKPEEVPAVVDAAIAIGARSLWLQSGVVHDEAAAKARTAGLDVVVGRCVKIEHRRRFG
>NZ_CP018403.1|WP_004525749.1|1013024_1013810_-|transporter-substrate-binding-domain-containing-protein
MKMNQTLLALACCAGLAHAQTAPQPGAPASRLDDVLARGTLRVCTTGDYKPYTYRREDGAFEGIDIDMAASLAKSLGVKTAFVKTTWPTLTDDFVAKCDIAVGGISTTLERQKRVFFTQPYVSDGKTPIVRCADAERYQTIAQIDQPQTRVIVNPGGTNERFAKQHFTRAKLTVFPDNVTIFKQILAGNADVMVTDASETLLQQKLNPGLCSVHPDKPFQFGEKAYMVPRGDVVFQQYVDQWLHLARETGELRAISDKWLK
>NZ_CP018403.1|WP_004524502.1|1013949_1015044_+|uroporphyrinogen-decarboxylase
MAQTLLNDTFLRALLREPTDYTPIWLMRQAGRYLPEYNATRARAGSFLGLAKQPDYATEVTLQPLERFPLDAAILFSDILTIPDAMGLGLDFAAGEGPKFAHPVRTEADVAKLAVPDIGATLGYVTDAVREIRRALTDGEGRQRVPLIGFSGSPWTLACYMVEGGGSDDFRTVKSMAYARPDLMHRILDVNAQAVAAYLNAQIEAGAQAVMIFDTWGGALADGAYQRFSLDYVRRVLAQLKREHDGARVPAIAFTKGGGLWLEELAATGVDAVGLDWTVNLGRARERVAGRVALQGNLDPTILFAPPEAIRAEARAVLDSYGNHPGHVFNLGHGISQFTPPEHVAELVDEVHRHSRAIRSGAGS
>NZ_CP018403.1|WP_004545277.1|1015484_1017752_+|primosomal-protein-N'
MADAFVRVALDHPLPTLFDYRYRGDMPAAPGMLVQVPFGRRSVVGLVCEVTAHTDVPAAKLKAVDAVCTELPPLSRHWLELAAFAADYYQRGLGEVALPALPQALRDVPRWGRLLAPELRYRLLDAGRAALPDALPARGAALRRLAQALADAPALSLAEVRALHPKAVAVLDEWQAQGWAACDEIAITHADAQLVDNPAPASAWRPTALPPQLTDQQAEALDAIAAADGFAPFLLHGVTGSGKTEVYLRALAALLERQPEAQALVLVPEINLTPQFEAAFRARFAATLPADAIVTLHSGLAEGERARHWLAAHTGRARIVLGTRLAVLASLPALAMIVVDEEHEPAYKQQEGLRYSARDLAVWRAKQLAIPVVLGSATPSLETWWQAEQGRYRRLTLTKRAVADAALPTVRLVDLEEERRRGRGSMGGLSGPLVAALKARLERGEQSLVFLNRRGYAPALACDACGWVAGCPRCSAYVVMHKPEHAVRCHHCGWEARIPRACPECGNVDIAPLGRGTQRVEETLALAVPGARILRIDADSTRRKGSAQALFSDVHAGEVDILVGTQMIAKGHDFQRVSLVGVLNADTALFSHDFRASERLFAQLMQVSGRAGRAGLPGEVLIQTRYPRHALYHALARQDYVGFAGATLGERRDAHLPPFVYQALLRAEGRTLDAALAFLQQAADAFSGLPGAERVTVYDAVPMTIVKVANVHRAQLLIESASRAALQHTLRAWQPLLRELKGVLRWSVEVDPLDI
>NZ_CP018403.1|WP_004202912.1|1017762_1017933_-|hypothetical-protein
MDGWVVIGIVLAAWIAGAIVFVHRASAVFFQALGCAQRVKKDERRARLSGLREAHE
>NZ_CP018403.1|WP_004195841.1|1018027_1018204_-|hypothetical-protein
MPARCRPRTLKDRKIVRQAIKRCNQISHPVAPHISPLLSITYQKRQPARTTLNDRYFP
>NZ_CP018403.1|WP_071810422.1|1018216_1022146_+|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGVADLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASLASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDALIRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLIRKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASYEQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYDIGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQFATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEDALKVVPLGAPHTKIALPRELYGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAAPRDVRNPADLRDVVGTVSEATPDEVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVREAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVAAALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRAVMFTGSTEVARLINKTLSSRLDPDGRPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSFDSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDTHIAAMKDKGHALTQLEMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLDKLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSGTGPKAGGALYLQRLLATRPAGLPRSLEAALVADAPQEGETRDNPSAALTALRDWLIEQREPALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAALATGNRALFAGAAGEALAAALPAQLKAHAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPGPIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	73538-73563	4	0.846
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	306425-306450	4	0.846
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP018403_1	1.1\|1009140\|26\|NZ_CP018403\|CRT	1009140-1009165	26	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	1003771-1003796	5	0.808
NZ_CP018403_1	1.2\|1009186\|27\|NZ_CP018403\|CRT	1009186-1009212	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	119428-119454	5	0.815
NZ_CP018403_1	1.3\|1009233\|26\|NZ_CP018403\|CRT	1009233-1009258	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP018403_1	1.3\|1009233\|26\|NZ_CP018403\|CRT	1009233-1009258	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP018403_1	1.3\|1009233\|26\|NZ_CP018403\|CRT	1009233-1009258	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP018403_1	1.3\|1009233\|26\|NZ_CP018403\|CRT	1009233-1009258	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279887	Mycobacterium phage Timmi, complete genome	40471-40497	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH651175	Mycobacterium phage Gophee, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	GQ303264	Mycobacterium phage Puhltonio, complete genome	40765-40791	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	GU247134	Mycobacterium phage Scoot17C, complete genome	40898-40924	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX683293	Mycobacterium phage Daffy, complete genome	40480-40506	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279888	Mycobacterium phage TomBombadil, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF957056	Mycobacterium phage Thora, complete genome	40771-40797	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT316463	Mycobacterium phage Slatt, complete genome	40775-40801	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX576645	Mycobacterium phage Derpp, complete genome	40325-40351	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH651184	Mycobacterium phage Phareon, complete genome	40464-40490	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN006063	Mycobacterium phage Serendipity, complete genome	40779-40805	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH779500	Mycobacterium phage Crownjwl, complete genome	40543-40569	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH230875	Mycobacterium phage CheetO, complete genome	40766-40792	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG962365	Mycobacterium phage DoesntMatter, complete genome	40752-40778	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279882	Mycobacterium phage Sophia, complete genome	40470-40496	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX670813	Mycobacterium phage MitKao, complete genome	40468-40494	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH576970	Mycobacterium phage DonSanchon, complete genome	40462-40488	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279866	Mycobacterium phage MRabcd, complete genome	40461-40487	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH513973	Mycobacterium phage Kwksand96, complete genome	40330-40356	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN945899	Mycobacterium phage Skippy, complete genome	40749-40775	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279908	Mycobacterium phage Roliet, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_023727	Mycobacterium phage Vista, complete genome	40769-40795	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT897909	Mycobacterium phage Maru, complete genome	40413-40439	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH727555	Mycobacterium phage Mulan, complete genome	40624-40650	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_027985	Mycobacterium phage UncleHowie, complete genome	40468-40494	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN698990	Mycobacterium phage IsaacEli, complete genome	40907-40933	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KY965066	Mycobacterium phage BlackStallion, complete genome	40902-40928	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN703415	Mycobacterium phage Mcshane, complete genome	40462-40488	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX592589	Mycobacterium phage Iridoclysis, complete genome	40748-40774	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH051251	Mycobacterium phage DuchessDung, complete genome	39751-39777	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX576646	Mycobacterium phage TyrionL, complete genome	40325-40351	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279871	Mycobacterium phage Plmatters, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279883	Mycobacterium phage Struggle, complete genome	40317-40343	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	40771-40797	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH371107	Mycobacterium phage Doddsville, complete genome	40479-40505	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_028942	Mycobacterium phage Phipps, complete sequence	40744-40770	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KJ567044	Mycobacterium phage EmpTee, complete genome	40765-40791	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279881	Mycobacterium phage Solosis, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG944223	Mycobacterium phage Trypo, complete genome	40900-40926	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT897902	Mycobacterium phage Boehler, complete genome	40772-40798	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279855	Mycobacterium phage Haleema, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JX649096	Mycobacterium phage Serpentine, complete genome	40766-40792	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK494104	Mycobacterium phage HenryJackson, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG944225	Mycobacterium phage Xavier, complete genome	40473-40499	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JX649099	Mycobacterium phage Gyarad, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH450116	Mycobacterium phage Buckeye, complete genome	40786-40812	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN638753	Mycobacterium phage Morgushi, complete genome	40469-40495	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG757158	Mycobacterium phage HighStump, complete genome	40603-40629	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112539	Mycobacterium phage Dione, complete genome	40459-40485	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279873	Mycobacterium phage QueenBeane, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF668276	Mycobacterium phage Lulumae, complete genome	40455-40481	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT897903	Mycobacterium phage DirtJuice, complete genome	40749-40775	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH513980	Mycobacterium phage Roy17, complete genome	40455-40481	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT316460	Mycobacterium phage Kimbrough, complete genome	40480-40506	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF937097	Mycobacterium phage Hertubise, complete genome	40776-40802	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH230874	Mycobacterium phage Banjo, complete genome	40448-40474	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH651186	Mycobacterium phage Podrick, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG962362	Mycobacterium phage AltPhacts, complete genome	40744-40770	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF704103	Mycobacterium phage Vortex, complete sequence	40466-40492	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	FJ174694	Mycobacterium phage Chah, complete genome	40916-40942	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH051264	Mycobacterium phage Cobra, complete genome	40767-40793	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112536	Mycobacterium phage Cannibal, complete genome	40738-40764	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX578071	Mycobacterium phage Mana, complete genome	40470-40496	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919539	Mycobacterium phage Virapocalypse, complete genome	40759-40785	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KC661274	Mycobacterium phage SDcharge11, complete genome	40742-40768	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KJ194579	Mycobacterium phage Swish, complete genome	40890-40916	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH371114	Mycobacterium phage Childish, complete genome	40486-40512	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279852	Mycobacterium phage Fringe, complete genome	40886-40912	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KY385382	Mycobacterium phage ImtiyazSitla, complete genome	40451-40477	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN699010	Mycobacterium phage TallGrassMM, complete genome	40385-40411	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG757159	Mycobacterium phage JangoPhett, complete genome	40759-40785	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279891	Mycobacterium phage Wallhey, complete genome	40329-40355	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919503	Mycobacterium phage Dingo, complete genome	40750-40776	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KY676783	Mycobacterium phage Chorkpop, complete genome	40482-40508	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112527	Mycobacterium phage Altwerkus, complete genome	40450-40476	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JX649100	Mycobacterium phage Alex, complete genome	40792-40818	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_028691	Mycobacterium phage Apizium, complete genome	40650-40676	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH371125	Mycobacterium phage Morty, complete genome	40907-40933	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF937109	Mycobacterium phage Yoshand, complete genome	40903-40929	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279878	Mycobacterium phage Samaymay, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	40892-40918	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112551	Mycobacterium phage Riggan, complete genome	40751-40777	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN945903	Mycobacterium phage Jiminy, complete genome	40319-40345	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KM363597	Mycobacteriophage Zonia, complete genome	40780-40806	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KF713485	Mycobacterium phage Suffolk, complete genome	40766-40792	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG770212	Mycobacterium phage Haimas, complete genome	40762-40788	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279861	Mycobacterium phage Legolas, complete genome	40500-40526	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279843	Mycobacterium phage CamL, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279846	Mycobacterium phage Cosmolli16, complete genome	40474-40500	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KM408320	Mycobacterium phage Lasso, complete genome	40730-40756	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KR029086	Mycobacterium phage PDRPv, complete genome	40479-40505	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KY385380	Mycobacterium phage Ashraf, complete genome	40451-40477	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH825705	Mycobacterium phage Mesh1, complete genome	40777-40803	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT952849	Mycobacterium phage Windsor, complete genome	40465-40491	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH576954	Mycobacterium phage HSavage, complete genome	40768-40794	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112555	Mycobacterium phage Zelda, complete genome	40810-40836	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_028803	Mycobacterium phage OSmaximus, complete genome	40940-40966	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279904	Mycobacterium phage RedMaple, complete genome	40906-40932	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KR029087	Mycobacterium phage PDRPxv, complete genome	40540-40566	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	40904-40930	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_005259	Mycobacterium phage PG1, complete genome	40909-40935	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112552	Mycobacterium phage Spartan300, complete genome	40761-40787	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX702319	Mycobacterium phage Pinkman, complete genome	40323-40349	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919523	Mycobacterium phage Mikota, complete genome	40748-40774	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KU867907	Mycobacterium phage Potter, complete genome	40479-40505	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH590588	Mycobacterium phage Vaticameos, complete genome	38450-38476	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279885	Mycobacterium phage Surely, complete genome	40772-40798	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279870	Mycobacterium phage Omniscient, complete genome	40775-40801	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN638752	Mycobacterium phage Murdoc, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG962375	Mycobacterium phage ProfessorX, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG925348	Mycobacterium phage Megatron, complete genome	40898-40924	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH077582	Mycobacterium phage Olive, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF155947	Mycobacterium phage LemonSlice, complete genome	40467-40493	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KP027209	Mycobacterium phage Sigman, complete genome	40889-40915	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH450122	Mycobacterium phage KingTut, complete genome	36143-36169	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279859	Mycobacterium phage Kwadwo, complete genome	40455-40481	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112546	Mycobacterium phage LuckyMarjie, complete genome	40470-40496	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX620786	Mycobacterium phage Lego3393, complete genome	40910-40936	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112544	Mycobacterium phage Keitherie, complete genome	40819-40845	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KP027197	Mycobacterium phage FluffyNinja, complete genome	40903-40929	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH651177	Mycobacterium phage KlimbOn, complete genome	40757-40783	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279877	Mycobacterium phage Roscoe, complete genome	41001-41027	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN698989	Mycobacterium phage JacAttac, complete genome	40889-40915	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH479918	Mycobacterium phage Labeouficaum, complete genome	40325-40351	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112553	Mycobacterium Phage Squiggle, complete genome	40485-40511	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_028907	Mycobacterium phage Kikipoo, complete genome	40907-40933	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279850	Mycobacterium phage Durga, complete genome	40917-40943	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279897	Mycobacterium phage Bishoperium, complete genome	40463-40489	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN585965	Mycobacterium phage Duggie, complete genome	40481-40507	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT310868	Mycobacterium phage Telesworld, complete genome	40464-40490	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279865	Mycobacterium phage Mecca, complete genome	40468-40494	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KC576784	Mycobacterium phage ShiVal, complete genome	40765-40791	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH479916	Mycobacterium phage GeneCoco, complete genome	40773-40799	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN444868	Mycobacterium phage Prickles, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KY385383	Mycobacterium phage Maskar, complete genome	40451-40477	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH371117	Mycobacterium phage Kahve, complete genome	40473-40499	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH399773	Mycobacterium phage Craff, complete genome	40902-40928	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	GU247133	Mycobacterium phage Fang, complete genome	40910-40936	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_008197	Mycobacterium phage Orion, complete genome	40896-40922	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH479921	Mycobacterium phage Placalicious, complete genome	40461-40487	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT897901	Mycobacterium phage Adriana, complete genome	40892-40918	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN369744	Mycobacterium phage Beaglebox, complete genome	40469-40495	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919530	Mycobacterium phage Sheila, complete genome	40804-40830	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG925356	Mycobacterium phage OliverWalter, complete genome	40778-40804	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JX649098	Mycobacterium phage Nacho, complete genome	40901-40927	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT889369	Mycobacterium phage Inchworm, complete genome	40889-40915	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KP027208	Mycobacterium phage Pipsqueak, complete genome	40768-40794	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919519	Mycobacterium phage Longacauda, complete genome	40463-40489	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF704109	Mycobacterium phage Oosterbaan, complete sequence	40763-40789	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX369585	Mycobacterium phage PhatCats2014, complete genome	40913-40939	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK310139	Mycobacterium phage Emiris, complete genome	40885-40911	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KJ194580	Mycobacterium phage Badfish, complete genome	40917-40943	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KX576647	Mycobacterium phage CharlieGBrown, complete genome	40336-40362	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN369738	Mycobacterium phage Hocus, complete genome	40465-40491	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279889	Mycobacterium phage Valjean, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH399775	Mycobacterium phage Gareth, complete genome	40458-40484	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	40763-40789	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279895	Mycobacterium phage Zaider, complete genome	40993-41019	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MN585967	Mycobacterium phage Kloppinator, complete genome	41182-41208	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK279858	Mycobacterium phage JakeO, complete genome	40484-40510	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_028681	Mycobacterium phage Pops, complete genome	40779-40805	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH744417	Mycobacterium phage Grand2040, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JX649097	Mycobacterium phage Piglet, complete genome	40874-40900	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MG925350	Mycobacterium phage Mosaic, complete genome	40462-40488	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH479914	Mycobacterium phage FugateOSU, complete genome	40464-40490	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH825702	Mycobacterium phage Hamish, complete genome	40754-40780	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF704091	Mycobacterium phage ABU, complete sequence	40894-40920	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919528	Mycobacterium phage Phunky, complete genome	40761-40787	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_028690	Mycobacterium phage Eremos, complete genome	40758-40784	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	40751-40777	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JN192463	Mycobacterium phage Oline, complete genome	40329-40355	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NC_021310	Mycobacterium phage Newman, complete genome	40760-40786	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MK112542	Mycobacterium phage Jillium, complete genome	40478-40504	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MT310867	Mycobacterium phage Chaelin, complete genome	40461-40487	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KJ194583	Mycobacterium phage Numberten, complete genome	40767-40793	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH590594	Mycobacterium phage PinheadLarry, complete genome	40474-40500	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	KJ174157	Mycobacterium phage Soto, complete genome	40776-40802	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH399780	Mycobacterium phage Mutante, complete genome	40474-40500	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	JF704099	Mycobacterium phage KLucky39, complete sequence	40763-40789	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MH779516	Mycobacterium phage Waterdiva, complete genome	40761-40787	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	MF919507	Mycobacterium phage Horchata, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.4\|1009279\|27\|NZ_CP018403\|CRT	1009279-1009305	27	NZ_CP045374	Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence	161364-161390	5	0.815
NZ_CP018403_1	1.5\|1009326\|26\|NZ_CP018403\|CRT	1009326-1009351	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP018403_1	1.5\|1009326\|26\|NZ_CP018403\|CRT	1009326-1009351	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP018403_1	1.5\|1009326\|26\|NZ_CP018403\|CRT	1009326-1009351	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP018403_1	1.5\|1009326\|26\|NZ_CP018403\|CRT	1009326-1009351	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP018403_1	1.6\|1009372\|27\|NZ_CP018403\|CRT	1009372-1009398	27	NZ_CP030128	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence	119428-119454	5	0.815
NZ_CP018403_1	1.7\|1009419\|26\|NZ_CP018403\|CRT	1009419-1009444	26	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	216447-216472	5	0.808
NZ_CP018403_1	1.7\|1009419\|26\|NZ_CP018403\|CRT	1009419-1009444	26	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	459201-459226	5	0.808
NZ_CP018403_1	1.7\|1009419\|26\|NZ_CP018403\|CRT	1009419-1009444	26	NZ_CP024427	Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence	79159-79184	5	0.808
NZ_CP018403_1	1.7\|1009419\|26\|NZ_CP018403\|CRT	1009419-1009444	26	NZ_CP020443	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence	89074-89099	5	0.808
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279887	Mycobacterium phage Timmi, complete genome	40471-40497	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH651175	Mycobacterium phage Gophee, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	GQ303264	Mycobacterium phage Puhltonio, complete genome	40765-40791	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	GU247134	Mycobacterium phage Scoot17C, complete genome	40898-40924	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX683293	Mycobacterium phage Daffy, complete genome	40480-40506	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279888	Mycobacterium phage TomBombadil, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF957056	Mycobacterium phage Thora, complete genome	40771-40797	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT316463	Mycobacterium phage Slatt, complete genome	40775-40801	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX576645	Mycobacterium phage Derpp, complete genome	40325-40351	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH651184	Mycobacterium phage Phareon, complete genome	40464-40490	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN006063	Mycobacterium phage Serendipity, complete genome	40779-40805	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH779500	Mycobacterium phage Crownjwl, complete genome	40543-40569	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH230875	Mycobacterium phage CheetO, complete genome	40766-40792	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG962365	Mycobacterium phage DoesntMatter, complete genome	40752-40778	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279882	Mycobacterium phage Sophia, complete genome	40470-40496	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX670813	Mycobacterium phage MitKao, complete genome	40468-40494	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH576970	Mycobacterium phage DonSanchon, complete genome	40462-40488	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279866	Mycobacterium phage MRabcd, complete genome	40461-40487	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH513973	Mycobacterium phage Kwksand96, complete genome	40330-40356	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN945899	Mycobacterium phage Skippy, complete genome	40749-40775	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279908	Mycobacterium phage Roliet, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_023727	Mycobacterium phage Vista, complete genome	40769-40795	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT897909	Mycobacterium phage Maru, complete genome	40413-40439	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH727555	Mycobacterium phage Mulan, complete genome	40624-40650	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_027985	Mycobacterium phage UncleHowie, complete genome	40468-40494	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN698990	Mycobacterium phage IsaacEli, complete genome	40907-40933	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KY965066	Mycobacterium phage BlackStallion, complete genome	40902-40928	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN703415	Mycobacterium phage Mcshane, complete genome	40462-40488	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX592589	Mycobacterium phage Iridoclysis, complete genome	40748-40774	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH051251	Mycobacterium phage DuchessDung, complete genome	39751-39777	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX576646	Mycobacterium phage TyrionL, complete genome	40325-40351	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279871	Mycobacterium phage Plmatters, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279883	Mycobacterium phage Struggle, complete genome	40317-40343	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN096366	Mycobacterium phage AbsoluteMadLad, complete genome	40771-40797	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH371107	Mycobacterium phage Doddsville, complete genome	40479-40505	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_028942	Mycobacterium phage Phipps, complete sequence	40744-40770	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KJ567044	Mycobacterium phage EmpTee, complete genome	40765-40791	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279881	Mycobacterium phage Solosis, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG944223	Mycobacterium phage Trypo, complete genome	40900-40926	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT897902	Mycobacterium phage Boehler, complete genome	40772-40798	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279855	Mycobacterium phage Haleema, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JX649096	Mycobacterium phage Serpentine, complete genome	40766-40792	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK494104	Mycobacterium phage HenryJackson, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG944225	Mycobacterium phage Xavier, complete genome	40473-40499	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JX649099	Mycobacterium phage Gyarad, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH450116	Mycobacterium phage Buckeye, complete genome	40786-40812	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN638753	Mycobacterium phage Morgushi, complete genome	40469-40495	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG757158	Mycobacterium phage HighStump, complete genome	40603-40629	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112539	Mycobacterium phage Dione, complete genome	40459-40485	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279873	Mycobacterium phage QueenBeane, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF668276	Mycobacterium phage Lulumae, complete genome	40455-40481	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT897903	Mycobacterium phage DirtJuice, complete genome	40749-40775	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH513980	Mycobacterium phage Roy17, complete genome	40455-40481	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT316460	Mycobacterium phage Kimbrough, complete genome	40480-40506	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF937097	Mycobacterium phage Hertubise, complete genome	40776-40802	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH230874	Mycobacterium phage Banjo, complete genome	40448-40474	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH651186	Mycobacterium phage Podrick, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG962362	Mycobacterium phage AltPhacts, complete genome	40744-40770	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF704103	Mycobacterium phage Vortex, complete sequence	40466-40492	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	FJ174694	Mycobacterium phage Chah, complete genome	40916-40942	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH051264	Mycobacterium phage Cobra, complete genome	40767-40793	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112536	Mycobacterium phage Cannibal, complete genome	40738-40764	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX578071	Mycobacterium phage Mana, complete genome	40470-40496	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919539	Mycobacterium phage Virapocalypse, complete genome	40759-40785	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KC661274	Mycobacterium phage SDcharge11, complete genome	40742-40768	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KJ194579	Mycobacterium phage Swish, complete genome	40890-40916	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH371114	Mycobacterium phage Childish, complete genome	40486-40512	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279852	Mycobacterium phage Fringe, complete genome	40886-40912	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KY385382	Mycobacterium phage ImtiyazSitla, complete genome	40451-40477	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN699010	Mycobacterium phage TallGrassMM, complete genome	40385-40411	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG757159	Mycobacterium phage JangoPhett, complete genome	40759-40785	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279891	Mycobacterium phage Wallhey, complete genome	40329-40355	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919503	Mycobacterium phage Dingo, complete genome	40750-40776	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KY676783	Mycobacterium phage Chorkpop, complete genome	40482-40508	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112527	Mycobacterium phage Altwerkus, complete genome	40450-40476	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JX649100	Mycobacterium phage Alex, complete genome	40792-40818	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_028691	Mycobacterium phage Apizium, complete genome	40650-40676	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH371125	Mycobacterium phage Morty, complete genome	40907-40933	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF937109	Mycobacterium phage Yoshand, complete genome	40903-40929	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279878	Mycobacterium phage Samaymay, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH399786	Mycobacterium phage PhrodoBaggins, complete genome	40892-40918	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112551	Mycobacterium phage Riggan, complete genome	40751-40777	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN945903	Mycobacterium phage Jiminy, complete genome	40319-40345	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KM363597	Mycobacteriophage Zonia, complete genome	40780-40806	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KF713485	Mycobacterium phage Suffolk, complete genome	40766-40792	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG770212	Mycobacterium phage Haimas, complete genome	40762-40788	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279861	Mycobacterium phage Legolas, complete genome	40500-40526	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279843	Mycobacterium phage CamL, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279846	Mycobacterium phage Cosmolli16, complete genome	40474-40500	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KM408320	Mycobacterium phage Lasso, complete genome	40730-40756	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KR029086	Mycobacterium phage PDRPv, complete genome	40479-40505	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KY385380	Mycobacterium phage Ashraf, complete genome	40451-40477	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH825705	Mycobacterium phage Mesh1, complete genome	40777-40803	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT952849	Mycobacterium phage Windsor, complete genome	40465-40491	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH576954	Mycobacterium phage HSavage, complete genome	40768-40794	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112555	Mycobacterium phage Zelda, complete genome	40810-40836	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_028803	Mycobacterium phage OSmaximus, complete genome	40940-40966	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279904	Mycobacterium phage RedMaple, complete genome	40906-40932	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KR029087	Mycobacterium phage PDRPxv, complete genome	40540-40566	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN699009	Mycobacterium phage ThreeOh3D2, complete genome	40904-40930	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_005259	Mycobacterium phage PG1, complete genome	40909-40935	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112552	Mycobacterium phage Spartan300, complete genome	40761-40787	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX702319	Mycobacterium phage Pinkman, complete genome	40323-40349	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919523	Mycobacterium phage Mikota, complete genome	40748-40774	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KU867907	Mycobacterium phage Potter, complete genome	40479-40505	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH590588	Mycobacterium phage Vaticameos, complete genome	38450-38476	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279885	Mycobacterium phage Surely, complete genome	40772-40798	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279870	Mycobacterium phage Omniscient, complete genome	40775-40801	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN638752	Mycobacterium phage Murdoc, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG962375	Mycobacterium phage ProfessorX, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG925348	Mycobacterium phage Megatron, complete genome	40898-40924	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH077582	Mycobacterium phage Olive, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF155947	Mycobacterium phage LemonSlice, complete genome	40467-40493	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KP027209	Mycobacterium phage Sigman, complete genome	40889-40915	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH450122	Mycobacterium phage KingTut, complete genome	36143-36169	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279859	Mycobacterium phage Kwadwo, complete genome	40455-40481	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112546	Mycobacterium phage LuckyMarjie, complete genome	40470-40496	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX620786	Mycobacterium phage Lego3393, complete genome	40910-40936	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112544	Mycobacterium phage Keitherie, complete genome	40819-40845	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KP027197	Mycobacterium phage FluffyNinja, complete genome	40903-40929	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH651177	Mycobacterium phage KlimbOn, complete genome	40757-40783	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279877	Mycobacterium phage Roscoe, complete genome	41001-41027	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN698989	Mycobacterium phage JacAttac, complete genome	40889-40915	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH479918	Mycobacterium phage Labeouficaum, complete genome	40325-40351	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112553	Mycobacterium Phage Squiggle, complete genome	40485-40511	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_028907	Mycobacterium phage Kikipoo, complete genome	40907-40933	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279850	Mycobacterium phage Durga, complete genome	40917-40943	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279897	Mycobacterium phage Bishoperium, complete genome	40463-40489	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN585965	Mycobacterium phage Duggie, complete genome	40481-40507	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT310868	Mycobacterium phage Telesworld, complete genome	40464-40490	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279865	Mycobacterium phage Mecca, complete genome	40468-40494	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KC576784	Mycobacterium phage ShiVal, complete genome	40765-40791	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH479916	Mycobacterium phage GeneCoco, complete genome	40773-40799	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN444868	Mycobacterium phage Prickles, complete genome	40755-40781	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KY385383	Mycobacterium phage Maskar, complete genome	40451-40477	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH371117	Mycobacterium phage Kahve, complete genome	40473-40499	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH399773	Mycobacterium phage Craff, complete genome	40902-40928	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	GU247133	Mycobacterium phage Fang, complete genome	40910-40936	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_008197	Mycobacterium phage Orion, complete genome	40896-40922	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH479921	Mycobacterium phage Placalicious, complete genome	40461-40487	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT897901	Mycobacterium phage Adriana, complete genome	40892-40918	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN369744	Mycobacterium phage Beaglebox, complete genome	40469-40495	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919530	Mycobacterium phage Sheila, complete genome	40804-40830	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG925356	Mycobacterium phage OliverWalter, complete genome	40778-40804	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JX649098	Mycobacterium phage Nacho, complete genome	40901-40927	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT889369	Mycobacterium phage Inchworm, complete genome	40889-40915	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KP027208	Mycobacterium phage Pipsqueak, complete genome	40768-40794	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919519	Mycobacterium phage Longacauda, complete genome	40463-40489	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF704109	Mycobacterium phage Oosterbaan, complete sequence	40763-40789	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX369585	Mycobacterium phage PhatCats2014, complete genome	40913-40939	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK310139	Mycobacterium phage Emiris, complete genome	40885-40911	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KJ194580	Mycobacterium phage Badfish, complete genome	40917-40943	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KX576647	Mycobacterium phage CharlieGBrown, complete genome	40336-40362	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN369738	Mycobacterium phage Hocus, complete genome	40465-40491	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279889	Mycobacterium phage Valjean, complete genome	40764-40790	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH399775	Mycobacterium phage Gareth, complete genome	40458-40484	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279894	Mycobacterium phage YouGoGlencoco, complete genome	40763-40789	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279895	Mycobacterium phage Zaider, complete genome	40993-41019	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MN585967	Mycobacterium phage Kloppinator, complete genome	41182-41208	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK279858	Mycobacterium phage JakeO, complete genome	40484-40510	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_028681	Mycobacterium phage Pops, complete genome	40779-40805	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH744417	Mycobacterium phage Grand2040, complete genome	40476-40502	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JX649097	Mycobacterium phage Piglet, complete genome	40874-40900	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MG925350	Mycobacterium phage Mosaic, complete genome	40462-40488	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH479914	Mycobacterium phage FugateOSU, complete genome	40464-40490	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH825702	Mycobacterium phage Hamish, complete genome	40754-40780	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF704091	Mycobacterium phage ABU, complete sequence	40894-40920	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919528	Mycobacterium phage Phunky, complete genome	40761-40787	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_028690	Mycobacterium phage Eremos, complete genome	40758-40784	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KJ538723	Mycobacterium phage KingVeVeVe, complete genome	40751-40777	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JN192463	Mycobacterium phage Oline, complete genome	40329-40355	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NC_021310	Mycobacterium phage Newman, complete genome	40760-40786	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MK112542	Mycobacterium phage Jillium, complete genome	40478-40504	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MT310867	Mycobacterium phage Chaelin, complete genome	40461-40487	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KJ194583	Mycobacterium phage Numberten, complete genome	40767-40793	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH590594	Mycobacterium phage PinheadLarry, complete genome	40474-40500	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	KJ174157	Mycobacterium phage Soto, complete genome	40776-40802	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH399780	Mycobacterium phage Mutante, complete genome	40474-40500	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	JF704099	Mycobacterium phage KLucky39, complete sequence	40763-40789	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MH779516	Mycobacterium phage Waterdiva, complete genome	40761-40787	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	MF919507	Mycobacterium phage Horchata, complete genome	40756-40782	5	0.815
NZ_CP018403_1	1.8\|1009465\|27\|NZ_CP018403\|CRT	1009465-1009491	27	NZ_CP045374	Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence	161364-161390	5	0.815
NZ_CP018403_1	1.3\|1009233\|26\|NZ_CP018403\|CRT	1009233-1009258	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977344	6	0.769
NZ_CP018403_1	1.5\|1009326\|26\|NZ_CP018403\|CRT	1009326-1009351	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977344	6	0.769
NZ_CP018403_1	1.7\|1009419\|26\|NZ_CP018403\|CRT	1009419-1009444	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2977319-2977344	6	0.769

1. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.846

cggtcgaccgccgcggggccagagta	CRISPR spacer
cggtcgaccgcatcggggccagaaca	Protospacer
***********  **********..*

2. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.846

cggtcgaccgccgcggggccagagta	CRISPR spacer
cggtcgaccgcatcggggccagaaca	Protospacer
***********  **********..*

3. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

4. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

5. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

6. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

7. spacer 1.1|1009140|26|NZ_CP018403|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 5, identity: 0.808

cggtcgaccgccgcggggccagagta	CRISPR spacer
ttgtcgaccgtcgcggtgccagagtt	Protospacer
. ********.***** ********

8. spacer 1.2|1009186|27|NZ_CP018403|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggccgaccacggcatgggatcggagt	CRISPR spacer
cggccgaccgcggcctgggatcgggtt	Protospacer
.********.**** *********. *

9. spacer 1.3|1009233|26|NZ_CP018403|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

10. spacer 1.3|1009233|26|NZ_CP018403|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

11. spacer 1.3|1009233|26|NZ_CP018403|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

12. spacer 1.3|1009233|26|NZ_CP018403|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

13. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

14. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

15. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

16. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

17. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

18. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

19. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

20. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

21. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

22. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

23. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

24. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

25. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

26. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

27. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

28. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

29. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

30. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

31. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH513973 (Mycobacterium phage Kwksand96, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

32. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

33. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

34. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

35. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

36. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

37. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

38. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

39. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

40. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

41. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

42. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

43. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

44. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

45. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

46. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

47. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH371107 (Mycobacterium phage Doddsville, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

48. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

49. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

50. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

51. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

52. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

53. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

54. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

55. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

56. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

57. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

58. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

59. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

60. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

61. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

62. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

63. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

64. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

65. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

66. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

67. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

68. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

69. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

70. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

71. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

72. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

73. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH051264 (Mycobacterium phage Cobra, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

74. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

75. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

76. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

77. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

78. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

79. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

80. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

81. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KY385382 (Mycobacterium phage ImtiyazSitla, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

82. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

83. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

84. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279891 (Mycobacterium phage Wallhey, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

85. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

86. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

87. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

88. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

89. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgattt	Protospacer
******.******* ********.  *

90. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

91. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

92. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

93. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

94. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

95. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN945903 (Mycobacterium phage Jiminy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

96. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KM363597 (Mycobacteriophage Zonia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

97. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

98. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

99. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

100. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

101. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

102. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

103. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KR029086 (Mycobacterium phage PDRPv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

104. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KY385380 (Mycobacterium phage Ashraf, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

105. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

106. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

107. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

108. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

109. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

110. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

111. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KR029087 (Mycobacterium phage PDRPxv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

112. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

113. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

114. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

115. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX702319 (Mycobacterium phage Pinkman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

116. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

117. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

118. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

119. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

120. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

121. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

122. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

123. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

124. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

125. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

126. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

127. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

128. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

129. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

130. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

131. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

132. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

133. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

134. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

135. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

136. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH479918 (Mycobacterium phage Labeouficaum, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

137. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

138. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

139. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279850 (Mycobacterium phage Durga, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

140. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

141. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN585965 (Mycobacterium phage Duggie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

142. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

143. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

144. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

145. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH479916 (Mycobacterium phage GeneCoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

146. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

147. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KY385383 (Mycobacterium phage Maskar, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

148. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

149. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

150. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

151. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

152. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

153. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

154. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN369744 (Mycobacterium phage Beaglebox, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

155. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

156. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

157. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

158. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT889369 (Mycobacterium phage Inchworm, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

159. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

160. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919519 (Mycobacterium phage Longacauda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

161. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

162. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

163. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

164. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

165. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KX576647 (Mycobacterium phage CharlieGBrown, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

166. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN369738 (Mycobacterium phage Hocus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

167. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

168. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

169. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

170. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

171. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

172. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK279858 (Mycobacterium phage JakeO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

173. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

174. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

175. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

176. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

177. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

178. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

179. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

180. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

181. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

182. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

183. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JN192463 (Mycobacterium phage Oline, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

184. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

185. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

186. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

187. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

188. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

189. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

190. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

191. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

192. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

193. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

194. spacer 1.4|1009279|27|NZ_CP018403|CRT matches to NZ_CP045374 (Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
cggccatccacggcatgggagcggcgc	Protospacer
.***** ************* *** *.

195. spacer 1.5|1009326|26|NZ_CP018403|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

196. spacer 1.5|1009326|26|NZ_CP018403|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

197. spacer 1.5|1009326|26|NZ_CP018403|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

198. spacer 1.5|1009326|26|NZ_CP018403|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

199. spacer 1.6|1009372|27|NZ_CP018403|CRT matches to NZ_CP030128 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

tggccgaccacggcatgggatcggagt	CRISPR spacer
cggccgaccgcggcctgggatcgggtt	Protospacer
.********.**** *********. *

200. spacer 1.7|1009419|26|NZ_CP018403|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

201. spacer 1.7|1009419|26|NZ_CP018403|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

202. spacer 1.7|1009419|26|NZ_CP018403|CRT matches to NZ_CP024427 (Paracoccus yeei strain TT13 plasmid pTT13-5, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

203. spacer 1.7|1009419|26|NZ_CP018403|CRT matches to NZ_CP020443 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.808

cgatcgaccgccgcggggccagagta	CRISPR spacer
ctttcgcccgccgcggggccagaggg	Protospacer
*  *** ***************** .

204. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279887 (Mycobacterium phage Timmi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

205. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH651175 (Mycobacterium phage Gophee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

206. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to GQ303264 (Mycobacterium phage Puhltonio, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

207. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to GU247134 (Mycobacterium phage Scoot17C, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

208. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX683293 (Mycobacterium phage Daffy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

209. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279888 (Mycobacterium phage TomBombadil, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

210. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF957056 (Mycobacterium phage Thora, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

211. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT316463 (Mycobacterium phage Slatt, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

212. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX576645 (Mycobacterium phage Derpp, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

213. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH651184 (Mycobacterium phage Phareon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

214. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN006063 (Mycobacterium phage Serendipity, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

215. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH779500 (Mycobacterium phage Crownjwl, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

216. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH230875 (Mycobacterium phage CheetO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

217. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG962365 (Mycobacterium phage DoesntMatter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

218. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279882 (Mycobacterium phage Sophia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

219. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX670813 (Mycobacterium phage MitKao, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

220. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH576970 (Mycobacterium phage DonSanchon, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

221. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279866 (Mycobacterium phage MRabcd, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

222. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH513973 (Mycobacterium phage Kwksand96, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

223. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN945899 (Mycobacterium phage Skippy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

224. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279908 (Mycobacterium phage Roliet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

225. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_023727 (Mycobacterium phage Vista, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

226. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

227. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH727555 (Mycobacterium phage Mulan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

228. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_027985 (Mycobacterium phage UncleHowie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

229. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN698990 (Mycobacterium phage IsaacEli, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

230. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KY965066 (Mycobacterium phage BlackStallion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

231. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN703415 (Mycobacterium phage Mcshane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

232. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX592589 (Mycobacterium phage Iridoclysis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

233. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH051251 (Mycobacterium phage DuchessDung, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

234. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX576646 (Mycobacterium phage TyrionL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

235. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279871 (Mycobacterium phage Plmatters, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

236. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279883 (Mycobacterium phage Struggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

237. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN096366 (Mycobacterium phage AbsoluteMadLad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

238. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH371107 (Mycobacterium phage Doddsville, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

239. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_028942 (Mycobacterium phage Phipps, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

240. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KJ567044 (Mycobacterium phage EmpTee, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

241. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279881 (Mycobacterium phage Solosis, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

242. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG944223 (Mycobacterium phage Trypo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

243. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT897902 (Mycobacterium phage Boehler, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

244. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279855 (Mycobacterium phage Haleema, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

245. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JX649096 (Mycobacterium phage Serpentine, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

246. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK494104 (Mycobacterium phage HenryJackson, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

247. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG944225 (Mycobacterium phage Xavier, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

248. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JX649099 (Mycobacterium phage Gyarad, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

249. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH450116 (Mycobacterium phage Buckeye, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

250. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN638753 (Mycobacterium phage Morgushi, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

251. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG757158 (Mycobacterium phage HighStump, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

252. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112539 (Mycobacterium phage Dione, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

253. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279873 (Mycobacterium phage QueenBeane, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

254. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF668276 (Mycobacterium phage Lulumae, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

255. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT897903 (Mycobacterium phage DirtJuice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

256. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH513980 (Mycobacterium phage Roy17, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

257. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT316460 (Mycobacterium phage Kimbrough, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

258. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF937097 (Mycobacterium phage Hertubise, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

259. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH230874 (Mycobacterium phage Banjo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

260. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH651186 (Mycobacterium phage Podrick, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

261. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG962362 (Mycobacterium phage AltPhacts, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

262. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF704103 (Mycobacterium phage Vortex, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

263. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to FJ174694 (Mycobacterium phage Chah, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

264. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH051264 (Mycobacterium phage Cobra, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

265. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112536 (Mycobacterium phage Cannibal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

266. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX578071 (Mycobacterium phage Mana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

267. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919539 (Mycobacterium phage Virapocalypse, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

268. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KC661274 (Mycobacterium phage SDcharge11, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

269. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KJ194579 (Mycobacterium phage Swish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

270. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH371114 (Mycobacterium phage Childish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

271. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279852 (Mycobacterium phage Fringe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

272. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KY385382 (Mycobacterium phage ImtiyazSitla, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

273. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN699010 (Mycobacterium phage TallGrassMM, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

274. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG757159 (Mycobacterium phage JangoPhett, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

275. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279891 (Mycobacterium phage Wallhey, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

276. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919503 (Mycobacterium phage Dingo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

277. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KY676783 (Mycobacterium phage Chorkpop, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

278. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112527 (Mycobacterium phage Altwerkus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

279. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JX649100 (Mycobacterium phage Alex, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

280. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_028691 (Mycobacterium phage Apizium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgattt	Protospacer
******.******* ********.  *

281. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH371125 (Mycobacterium phage Morty, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

282. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF937109 (Mycobacterium phage Yoshand, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

283. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279878 (Mycobacterium phage Samaymay, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

284. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH399786 (Mycobacterium phage PhrodoBaggins, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

285. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112551 (Mycobacterium phage Riggan, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

286. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN945903 (Mycobacterium phage Jiminy, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

287. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KM363597 (Mycobacteriophage Zonia, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

288. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KF713485 (Mycobacterium phage Suffolk, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

289. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG770212 (Mycobacterium phage Haimas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

290. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279861 (Mycobacterium phage Legolas, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

291. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279843 (Mycobacterium phage CamL, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

292. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279846 (Mycobacterium phage Cosmolli16, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

293. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KM408320 (Mycobacterium phage Lasso, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

294. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KR029086 (Mycobacterium phage PDRPv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

295. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KY385380 (Mycobacterium phage Ashraf, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

296. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH825705 (Mycobacterium phage Mesh1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

297. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT952849 (Mycobacterium phage Windsor, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

298. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH576954 (Mycobacterium phage HSavage, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

299. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112555 (Mycobacterium phage Zelda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

300. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_028803 (Mycobacterium phage OSmaximus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

301. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279904 (Mycobacterium phage RedMaple, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

302. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KR029087 (Mycobacterium phage PDRPxv, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

303. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN699009 (Mycobacterium phage ThreeOh3D2, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

304. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_005259 (Mycobacterium phage PG1, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

305. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112552 (Mycobacterium phage Spartan300, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

306. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX702319 (Mycobacterium phage Pinkman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

307. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919523 (Mycobacterium phage Mikota, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

308. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KU867907 (Mycobacterium phage Potter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

309. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH590588 (Mycobacterium phage Vaticameos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

310. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279885 (Mycobacterium phage Surely, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

311. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279870 (Mycobacterium phage Omniscient, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

312. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN638752 (Mycobacterium phage Murdoc, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

313. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG962375 (Mycobacterium phage ProfessorX, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

314. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG925348 (Mycobacterium phage Megatron, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

315. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH077582 (Mycobacterium phage Olive, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

316. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF155947 (Mycobacterium phage LemonSlice, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

317. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KP027209 (Mycobacterium phage Sigman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

318. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH450122 (Mycobacterium phage KingTut, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

319. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279859 (Mycobacterium phage Kwadwo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

320. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112546 (Mycobacterium phage LuckyMarjie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

321. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX620786 (Mycobacterium phage Lego3393, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

322. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112544 (Mycobacterium phage Keitherie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

323. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KP027197 (Mycobacterium phage FluffyNinja, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

324. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH651177 (Mycobacterium phage KlimbOn, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

325. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279877 (Mycobacterium phage Roscoe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

326. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN698989 (Mycobacterium phage JacAttac, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

327. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH479918 (Mycobacterium phage Labeouficaum, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

328. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112553 (Mycobacterium Phage Squiggle, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

329. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_028907 (Mycobacterium phage Kikipoo, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

330. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279850 (Mycobacterium phage Durga, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

331. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279897 (Mycobacterium phage Bishoperium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

332. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN585965 (Mycobacterium phage Duggie, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

333. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT310868 (Mycobacterium phage Telesworld, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

334. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279865 (Mycobacterium phage Mecca, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

335. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KC576784 (Mycobacterium phage ShiVal, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

336. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH479916 (Mycobacterium phage GeneCoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

337. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN444868 (Mycobacterium phage Prickles, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

338. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KY385383 (Mycobacterium phage Maskar, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

339. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH371117 (Mycobacterium phage Kahve, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

340. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH399773 (Mycobacterium phage Craff, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

341. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to GU247133 (Mycobacterium phage Fang, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

342. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_008197 (Mycobacterium phage Orion, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

343. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH479921 (Mycobacterium phage Placalicious, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

344. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT897901 (Mycobacterium phage Adriana, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

345. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN369744 (Mycobacterium phage Beaglebox, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

346. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919530 (Mycobacterium phage Sheila, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

347. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG925356 (Mycobacterium phage OliverWalter, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

348. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JX649098 (Mycobacterium phage Nacho, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

349. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT889369 (Mycobacterium phage Inchworm, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcgtgggatcgatct	Protospacer
******.*******.********.  *

350. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

351. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919519 (Mycobacterium phage Longacauda, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

352. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF704109 (Mycobacterium phage Oosterbaan, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

353. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX369585 (Mycobacterium phage PhatCats2014, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

354. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK310139 (Mycobacterium phage Emiris, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

355. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KJ194580 (Mycobacterium phage Badfish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

356. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KX576647 (Mycobacterium phage CharlieGBrown, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

357. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN369738 (Mycobacterium phage Hocus, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

358. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279889 (Mycobacterium phage Valjean, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

359. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH399775 (Mycobacterium phage Gareth, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

360. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279894 (Mycobacterium phage YouGoGlencoco, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

361. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279895 (Mycobacterium phage Zaider, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

362. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MN585967 (Mycobacterium phage Kloppinator, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

363. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK279858 (Mycobacterium phage JakeO, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

364. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_028681 (Mycobacterium phage Pops, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

365. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH744417 (Mycobacterium phage Grand2040, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

366. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JX649097 (Mycobacterium phage Piglet, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

367. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

368. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH479914 (Mycobacterium phage FugateOSU, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

369. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH825702 (Mycobacterium phage Hamish, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

370. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF704091 (Mycobacterium phage ABU, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

371. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919528 (Mycobacterium phage Phunky, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

372. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_028690 (Mycobacterium phage Eremos, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

373. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KJ538723 (Mycobacterium phage KingVeVeVe, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

374. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JN192463 (Mycobacterium phage Oline, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

375. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NC_021310 (Mycobacterium phage Newman, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

376. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MK112542 (Mycobacterium phage Jillium, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

377. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MT310867 (Mycobacterium phage Chaelin, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

378. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KJ194583 (Mycobacterium phage Numberten, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

379. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH590594 (Mycobacterium phage PinheadLarry, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

380. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to KJ174157 (Mycobacterium phage Soto, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

381. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH399780 (Mycobacterium phage Mutante, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

382. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to JF704099 (Mycobacterium phage KLucky39, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

383. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MH779516 (Mycobacterium phage Waterdiva, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

384. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to MF919507 (Mycobacterium phage Horchata, complete genome) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
tggccagccacggcttgggatcgatct	Protospacer
******.******* ********.  *

385. spacer 1.8|1009465|27|NZ_CP018403|CRT matches to NZ_CP045374 (Sulfitobacter sp. THAF37 plasmid pTHAF37_b, complete sequence) position: , mismatch: 5, identity: 0.815

tggccaaccacggcatgggatcggagt	CRISPR spacer
cggccatccacggcatgggagcggcgc	Protospacer
.***** ************* *** *.

386. spacer 1.3|1009233|26|NZ_CP018403|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.769

cgatcgaccgccgcggggccagagta	CRISPR spacer
tgatcgaccgcagcggggccagtccg	Protospacer
.********** **********  ..

387. spacer 1.5|1009326|26|NZ_CP018403|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.769

cgatcgaccgccgcggggccagagta	CRISPR spacer
tgatcgaccgcagcggggccagtccg	Protospacer
.********** **********  ..

388. spacer 1.7|1009419|26|NZ_CP018403|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.769

cgatcgaccgccgcggggccagagta	CRISPR spacer
tgatcgaccgcagcggggccagtccg	Protospacer
.********** **********  ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

737523 : 817893

Burkholderia_phage(53.7%)

holin,terminase,transposase,head,protease,tRNA,tail,portal,capsid,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004203414.1\|737523_738060_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_004198316.1\|738069_739413_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	3.7e-40	28.8
WP_004198315.1\|739839_740382_-	response regulator transcription factor	NA	NA	NA	NA
WP_004198314.1\|740401_741682_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_004198312.1\|741699_741951_-	cysteine-rich CWC family protein	NA	NA	NA	NA
WP_004200214.1\|742275_743175_+	acetylglutamate kinase	NA	NA	NA	NA
WP_004198307.1\|743171_743975_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_004525865.1\|743941_744634_+	nucleoid occlusion factor SlmA	NA	NA	NA	NA
WP_004545672.1\|744982_746128_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_004545692.1\|746124_746739_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_071810894.1\|746750_748064_+	AmpG family muropeptide MFS transporter	NA	NA	NA	NA
WP_038800902.1\|748149_749106_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_004531039.1\|749479_750424_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004531040.1\|750635_751700_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	9.9e-81	46.1
WP_004190029.1\|752056_752827_-	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	3.4e-30	33.8
WP_004189747.1\|752858_753698_-	hypothetical protein	NA	NA	NA	NA
WP_004523090.1\|753824_755297_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_009962426.1\|755299_756790_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_004189769.1\|756902_757202_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_004189550.1\|757567_758611_+	rod shape-determining protein	NA	NA	NA	NA
WP_004189331.1\|758730_759804_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_004523092.1\|759800_760313_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_004525858.1\|760496_762908_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_004525857.1\|762919_764068_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_028201345.1\|764613_765390_-	sel1 repeat family protein	NA	NA	NA	NA
WP_004189570.1\|765386_766172_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_009962395.1\|766164_766497_+	hypothetical protein	NA	NA	NA	NA
WP_004189793.1\|766593_767046_-	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	7.6e-14	30.8
WP_004189241.1\|767065_767698_-	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	2.1e-06	30.9
WP_004190026.1\|767791_768526_-	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	1.6e-50	42.5
WP_009918037.1\|768522_768813_-	hypothetical protein	NA	NA	NA	NA
WP_071810896.1\|769500_770547_+	hypothetical protein	NA	NA	NA	NA
WP_145956470.1\|770590_770785_+	hypothetical protein	NA	NA	NA	NA
WP_071810401.1\|770834_771632_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.0e-33	37.7
WP_071810947.1\|771624_773130_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_145956471.1\|773265_774123_+	N-acetyltransferase	Q6SE88	Lactobacillus_prophage	2.3e-48	39.3
WP_071810898.1\|774100_774478_+	ASCH domain-containing protein	Q6SE87	Lactobacillus_prophage	1.0e-27	49.6
WP_071810899.1\|775432_776488_-\|portal	phage portal protein	A4JWQ2	Burkholderia_virus	2.7e-195	93.7
WP_071810900.1\|776484_778251_-\|terminase	terminase ATPase subunit family protein	A4JWQ1	Burkholderia_virus	0.0e+00	93.0
WP_071810901.1\|778395_779205_+\|capsid	GPO family capsid scaffolding protein	K4PAW2	Burkholderia_phage	5.5e-140	94.8
WP_071810902.1\|779238_780252_+\|capsid	phage major capsid protein, P2 family	A4JWP9	Burkholderia_virus	7.8e-176	92.0
WP_071810903.1\|780248_780938_+\|terminase	terminase endonuclease subunit	K4NX86	Burkholderia_phage	1.8e-112	95.6
WP_045597244.1\|781037_781517_+\|head	head completion/stabilization protein	A4JWU5	Burkholderia_virus	5.1e-77	95.6
WP_025405651.1\|781516_781768_+	hypothetical protein	K4NXI9	Burkholderia_phage	1.4e-30	80.7
WP_071810904.1\|781764_781971_+\|tail	phage tail protein	K4PAW7	Burkholderia_phage	3.8e-29	92.6
WP_009969796.1\|781985_782330_+	membrane protein	K4NZQ3	Burkholderia_phage	8.5e-50	98.2
WP_004524440.1\|782331_782604_+\|holin	phage holin family protein	K4NX91	Burkholderia_phage	8.8e-42	100.0
WP_071810905.1\|782600_783413_+	DUF3380 domain-containing protein	A4JWZ0	Burkholderia_virus	4.4e-137	90.0
WP_071810906.1\|783409_783850_+	protein LYSB	K4NXJ2	Burkholderia_phage	3.9e-55	78.8
WP_071810907.1\|783827_783962_+	peptidase	K4PAX1	Burkholderia_phage	8.1e-17	95.5
WP_071810908.1\|783954_784371_+\|tail	phage tail protein	A4JWT7	Burkholderia_virus	6.4e-68	94.9
WP_071810909.1\|784367_784835_+	phage virion morphogenesis protein	K4NZQ8	Burkholderia_phage	1.7e-72	93.5
WP_143293236.1\|784966_785557_-	hypothetical protein	NA	NA	NA	NA
WP_071810910.1\|785964_786756_-	site-specific DNA-methyltransferase	K4NZW3	Burkholderia_phage	1.2e-136	91.8
WP_071810911.1\|786929_787610_+\|plate	phage baseplate assembly protein V	A4JWT3	Burkholderia_virus	1.4e-117	94.7
WP_071810912.1\|787606_787969_+\|plate	baseplate assembly protein	A4JWY3	Burkholderia_virus	4.0e-58	95.0
WP_071810913.1\|787965_788871_+\|plate	baseplate assembly protein	K4NZR5	Burkholderia_phage	5.9e-151	93.0
WP_085504131.1\|788863_789418_+\|tail	phage tail protein I	A4JWT0	Burkholderia_virus	6.3e-95	95.1
WP_080495619.1\|789419_791792_+\|tail	phage tail protein	Q45YG3	Burkholderia_virus	0.0e+00	87.5
WP_071810915.1\|791808_792480_+\|tail	tail assembly chaperone	A4JWS8	Burkholderia_virus	6.2e-105	94.7
WP_071810916.1\|792537_793710_+\|tail	phage tail sheath protein	A4JWS7	Burkholderia_virus	1.6e-217	96.7
WP_028201169.1\|793725_794235_+\|tail	phage major tail tube protein	K4NZR9	Burkholderia_phage	1.0e-91	95.9
WP_071810917.1\|794292_794637_+\|tail	phage tail assembly protein	K4NXA3	Burkholderia_phage	2.6e-51	93.9
WP_071810918.1\|794645_794759_+\|tail	GpE family phage tail protein	A0A089FGX3	Burkholderia_phage	2.1e-13	97.3
WP_080495620.1\|794755_797722_+	hypothetical protein	A4JWS3	Burkholderia_virus	0.0e+00	82.7
WP_071810920.1\|797739_798165_+\|tail	phage tail protein	A4JWS2	Burkholderia_virus	2.7e-69	96.5
WP_071810921.1\|798164_799265_+	phage late control D family protein	K4PAY4	Burkholderia_phage	3.2e-191	93.4
WP_071810922.1\|799278_799710_-	hypothetical protein	A0A089FKT7	Burkholderia_phage	3.5e-69	93.7
WP_071810923.1\|800145_800874_-	alpha/beta hydrolase	A0A1S5NPT4	Burkholderia_phage	2.5e-67	59.0
WP_085517468.1\|800926_801385_-	helix-turn-helix domain-containing protein	K4NXA8	Burkholderia_phage	1.3e-74	95.4
WP_080495646.1\|801510_801705_+	hypothetical protein	K4NZX7	Burkholderia_phage	5.3e-25	92.2
WP_038708691.1\|801708_802005_+	hypothetical protein	E5E3P2	Burkholderia_phage	5.4e-37	84.3
WP_071810924.1\|801992_802241_+	ogr/Delta-like zinc finger family protein	K4PAZ0	Burkholderia_phage	2.6e-40	98.8
WP_071810925.1\|802324_802870_+	Bro-N domain-containing protein	K4NZS9	Burkholderia_phage	1.1e-96	98.3
WP_071810926.1\|802885_803104_+	hypothetical protein	K4NXB1	Burkholderia_phage	6.8e-29	87.5
WP_071810927.1\|803109_803307_+	hypothetical protein	K4NZY3	Burkholderia_phage	2.7e-24	89.2
WP_080495621.1\|803335_803545_+	hypothetical protein	K4NXL1	Burkholderia_phage	4.5e-30	98.6
WP_071810928.1\|803548_803788_+	hypothetical protein	K4PAZ5	Burkholderia_phage	5.0e-33	92.4
WP_071810929.1\|803956_804163_+	hypothetical protein	K4NZT3	Burkholderia_phage	7.1e-12	55.9
WP_080495622.1\|804156_804525_+	hypothetical protein	K4NXB4	Burkholderia_phage	1.1e-58	94.3
WP_071810930.1\|804521_804776_+	hypothetical protein	A4JWQ9	Burkholderia_virus	3.0e-36	92.9
WP_071810931.1\|804787_807580_+	hypothetical protein	K4NXL6	Burkholderia_phage	0.0e+00	96.7
WP_071810932.1\|808270_808621_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004189647.1\|809648_810332_-	response regulator	NA	NA	NA	NA
WP_004523096.1\|810332_812741_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_004188929.1\|812742_813333_-	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_009962382.1\|813329_814739_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_129558595.1\|814815_815022_-	hypothetical protein	NA	NA	NA	NA
WP_004189409.1\|815186_816044_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_009962380.1\|816153_816789_-	LysE family translocator	NA	NA	NA	NA
WP_004535363.1\|816909_817893_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.3e-07	38.0

DBSCAN-SWA_2

1064311 : 1075537

Burkholderia_virus(22.22%)

integrase

attL 1061719:1061736|attR 1078315:1078332

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1061719:1061736	attL	NA	NA	NA	NA
WP_071810426.1\|1064311_1066399_+	AAA family ATPase	A7KV33	Bacillus_phage	1.1e-99	35.8
WP_028201459.1\|1066719_1067619_-	cytochrome c	NA	NA	NA	NA
WP_004525725.1\|1068644_1069388_+\|integrase	site-specific integrase	A0A0S2SYQ7	Pseudomonas_phage	9.4e-54	47.3
WP_009922658.1\|1069767_1070085_+	helix-turn-helix transcriptional regulator	A0A088CD40	Shigella_phage	6.2e-15	57.0
WP_004530410.1\|1070084_1071002_+	hypothetical protein	A4PE40	Ralstonia_virus	4.0e-46	40.6
WP_009932250.1\|1071255_1071798_+	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	8.1e-47	55.8
WP_009932249.1\|1072055_1072508_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.3e-31	58.8
WP_004530408.1\|1072507_1073587_+	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	2.2e-160	99.0
WP_004525721.1\|1073743_1073992_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.0e-41	97.6
WP_011857935.1\|1074835_1075537_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	4.8e-07	30.4
1078315:1078332	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1299381 : 1315589

Xylella_phage(66.67%)

plate,integrase,protease

attL 1291979:1291995|attR 1309016:1309032

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1291979:1291995	attL	NA	NA	NA	NA
WP_004535032.1\|1299381_1299909_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	2.0e-21	51.0
WP_071810439.1\|1300078_1300606_-	hypothetical protein	NA	NA	NA	NA
WP_145956480.1\|1300602_1301640_-	hypothetical protein	NA	NA	NA	NA
WP_071810441.1\|1301728_1302748_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	2.7e-96	56.3
WP_071810442.1\|1302751_1302967_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_123850113.1\|1304784_1305258_-	hypothetical protein	NA	NA	NA	NA
WP_080003363.1\|1305651_1306509_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	2.0e-84	58.9
WP_004521948.1\|1306595_1307381_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_009980978.1\|1307377_1308724_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004521950.1\|1308832_1309447_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
1309016:1309032	attR	NA	NA	NA	NA
WP_004531875.1\|1309821_1310493_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_009967200.1\|1310529_1311048_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004521953.1\|1311064_1312555_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004527837.1\|1312627_1313131_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_080495565.1\|1313158_1313671_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_011205262.1\|1313762_1315589_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_4

1648161 : 1657418

Hokovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004533561.1\|1648161_1650114_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	49.2
WP_004522147.1\|1650380_1651511_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.7e-22	27.6
WP_028201129.1\|1651544_1653563_+	bifunctional anthranilate synthase component I family protein/class IV aminotransferase	S4VT78	Pandoravirus	7.0e-51	34.2
WP_004194137.1\|1653746_1654562_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	8.8e-37	33.3
WP_004532195.1\|1654626_1655310_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	2.0e-05	26.0
WP_004194373.1\|1655306_1655834_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_071810472.1\|1655870_1657418_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.3e-24	31.2

DBSCAN-SWA_5

1919214 : 1957773

Stx2-converting_phage(25.0%)

tRNA,integrase,capsid,transposase

attL 1916413:1916429|attR 1959899:1959915

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1916413:1916429	attL	NA	NA	NA	NA
WP_004546277.1\|1919214_1920516_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.8e-93	44.0
WP_080495627.1\|1921692_1922043_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_080495572.1\|1922395_1923505_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_145956484.1\|1924588_1924900_+	hypothetical protein	NA	NA	NA	NA
WP_071810961.1\|1925023_1925620_+	hypothetical protein	NA	NA	NA	NA
WP_071810507.1\|1925616_1926765_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	1.4e-32	31.8
WP_145956485.1\|1926991_1927735_+	hypothetical protein	NA	NA	NA	NA
WP_071810510.1\|1927884_1928184_+	hypothetical protein	NA	NA	NA	NA
WP_071810947.1\|1928275_1929781_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_071810401.1\|1929773_1930571_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.0e-33	37.7
WP_043224931.1\|1930797_1931145_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085517532.1\|1931223_1931934_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_085517533.1\|1932024_1932423_-	hypothetical protein	NA	NA	NA	NA
WP_009891843.1\|1932488_1932746_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085503846.1\|1932749_1933076_-	hypothetical protein	NA	NA	NA	NA
WP_085503847.1\|1933151_1933958_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_085517535.1\|1934022_1935150_-	hypothetical protein	NA	NA	NA	NA
WP_085517537.1\|1935146_1936052_-\|capsid	phage capsid protein	NA	NA	NA	NA
WP_085517538.1\|1936101_1936329_-	hypothetical protein	NA	NA	NA	NA
WP_085517540.1\|1937410_1937611_-	hypothetical protein	NA	NA	NA	NA
WP_085517542.1\|1937607_1938576_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	4.5e-56	42.5
WP_085517543.1\|1938671_1938899_-	hypothetical protein	NA	NA	NA	NA
WP_085517545.1\|1939686_1942218_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.8e-32	30.6
WP_085517547.1\|1942222_1943230_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_145956486.1\|1943250_1946115_+	hypothetical protein	NA	NA	NA	NA
WP_085517550.1\|1946117_1946855_+	hypothetical protein	NA	NA	NA	NA
WP_071810512.1\|1946905_1947649_+	hypothetical protein	NA	NA	NA	NA
WP_071810515.1\|1947702_1947978_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_009982080.1\|1948920_1949328_+\|transposase	transposase	B6DZU5	Stx2-converting_phage	1.0e-14	37.2
WP_017335489.1\|1949324_1949672_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_071810516.1\|1949701_1951264_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.3e-149	53.5
WP_080495573.1\|1951271_1951901_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	2.7e-25	38.1
WP_145956487.1\|1954193_1954796_+	hypothetical protein	A0A1V0SHS2	Klosneuvirus	9.1e-15	33.6
WP_071810520.1\|1954925_1956116_-\|integrase	tyrosine-type recombinase/integrase	A0A077KET4	Ralstonia_phage	1.2e-63	40.8
WP_095413466.1\|1956592_1957773_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.1e-59	41.5
1959899:1959915	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2042261 : 2051094

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004537711.1\|2042261_2043662_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	4.2e-79	38.5
WP_009921652.1\|2043693_2044617_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.3e-15	27.1
WP_004537712.1\|2044675_2045668_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	9.1e-28	30.9
WP_004189725.1\|2045739_2046057_+	competence protein ComE	NA	NA	NA	NA
WP_004550116.1\|2046400_2047303_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	3.3e-53	39.9
WP_101607178.1\|2047529_2048858_-	lytic murein transglycosylase B	NA	NA	NA	NA
WP_004188957.1\|2048985_2049909_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	8.4e-44	36.5
WP_009966840.1\|2050251_2051094_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	9.8e-15	29.5

DBSCAN-SWA_7

2567663 : 2572144

Burkholderia_virus(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196630.1\|2567663_2567927_+	hypothetical protein	Q8W6S4	Burkholderia_virus	2.2e-26	85.5
WP_076833215.1\|2567910_2568096_+	hypothetical protein	Q8W6S4	Burkholderia_virus	4.4e-21	85.2
WP_076804729.1\|2568116_2568428_-	hypothetical protein	A4PE26	Ralstonia_virus	4.5e-26	60.2
WP_071810609.1\|2568848_2569451_-	hypothetical protein	NA	NA	NA	NA
WP_028200809.1\|2569792_2570299_-	DUF4123 domain-containing protein	A4PE24	Ralstonia_virus	1.0e-19	40.9
WP_028200808.1\|2570295_2570718_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	9.2e-14	48.3
WP_004557051.1\|2570998_2571394_-	hypothetical protein	NA	NA	NA	NA
WP_004531416.1\|2571647_2571875_+	hypothetical protein	Q8W6S4	Burkholderia_virus	3.8e-22	75.8
WP_004527234.1\|2571910_2572144_-	hypothetical protein	A4PE26	Ralstonia_virus	4.3e-13	60.6

DBSCAN-SWA_8

3298962 : 3341322

Klosneuvirus(16.67%)

tRNA,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004204967.1\|3298962_3301587_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.5e-80	39.2
WP_004531186.1\|3302156_3303377_+	CoA transferase	NA	NA	NA	NA
WP_004534928.1\|3303705_3303915_-	hypothetical protein	NA	NA	NA	NA
WP_004193654.1\|3304194_3305904_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	8.8e-188	57.5
WP_011205108.1\|3306260_3306734_-	NUDIX hydrolase	A0A0G2SS60	Proteus_phage	3.3e-20	42.0
WP_004193860.1\|3306761_3307148_-	hypothetical protein	NA	NA	NA	NA
WP_076852755.1\|3307435_3309484_-	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_071810978.1\|3309460_3309640_+	hypothetical protein	NA	NA	NA	NA
WP_071810689.1\|3309636_3310497_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_079999958.1\|3310540_3311935_-	cytochrome-c peroxidase	NA	NA	NA	NA
WP_080495598.1\|3312090_3313764_+	acid phosphatase	NA	NA	NA	NA
WP_004538373.1\|3313966_3315160_+	enoyl-[acyl-carrier-protein] reductase FabV	NA	NA	NA	NA
WP_071810979.1\|3315779_3316967_+	HlyD family secretion protein	NA	NA	NA	NA
WP_004538374.1\|3317139_3318759_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_004538375.1\|3318760_3320470_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004192810.1\|3320773_3321406_-	response regulator transcription factor	NA	NA	NA	NA
WP_071810692.1\|3321406_3323488_-	response regulator	A0A1V0SGR3	Hokovirus	1.7e-12	26.8
WP_009966443.1\|3323898_3324864_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_080495633.1\|3324879_3327228_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_071810694.1\|3327335_3328175_-	molecular chaperone	NA	NA	NA	NA
WP_004526783.1\|3328192_3328717_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004191870.1\|3328793_3329354_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004542516.1\|3329406_3329952_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_004542449.1\|3329938_3330124_-	hypothetical protein	NA	NA	NA	NA
WP_004531175.1\|3330209_3330431_-	hypothetical protein	NA	NA	NA	NA
WP_004196705.1\|3330768_3331662_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009920897.1\|3331875_3332013_+	hypothetical protein	NA	NA	NA	NA
WP_004538381.1\|3332078_3333365_+	MFS transporter	NA	NA	NA	NA
WP_004526776.1\|3333409_3334393_+	hydrolase	NA	NA	NA	NA
WP_009937836.1\|3334600_3334861_+	hypothetical protein	NA	NA	NA	NA
WP_004193855.1\|3334860_3335142_+	H-NS histone family protein	NA	NA	NA	NA
WP_076850283.1\|3335394_3335706_-	hypothetical protein	NA	NA	NA	NA
WP_009966449.1\|3335790_3336045_+	hypothetical protein	NA	NA	NA	NA
WP_004554453.1\|3336336_3336513_-	hypothetical protein	NA	NA	NA	NA
WP_004554454.1\|3336561_3337875_-	divalent metal cation transporter	NA	NA	NA	NA
WP_080003325.1\|3338134_3338527_-	hypothetical protein	NA	NA	NA	NA
WP_009980631.1\|3339365_3339692_-\|transposase	transposase	S5WIU1	Leptospira_phage	4.4e-24	57.5
WP_095413466.1\|3340141_3341322_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.1e-59	41.5

DBSCAN-SWA_9

3802620 : 3866077

Stx2-converting_phage(27.27%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095413471.1\|3802620_3802950_+\|transposase	transposase	NA	NA	NA	NA
WP_080495604.1\|3803251_3803344_+	hypothetical protein	NA	NA	NA	NA
WP_157129841.1\|3803523_3803853_+	hypothetical protein	NA	NA	NA	NA
WP_085517640.1\|3804531_3807399_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	5.6e-70	35.4
WP_004524588.1\|3807523_3807865_-	hypothetical protein	NA	NA	NA	NA
WP_009951642.1\|3807893_3808415_-	DNA-binding protein	NA	NA	NA	NA
WP_076831080.1\|3808822_3809740_-	hypothetical protein	NA	NA	NA	NA
WP_009969683.1\|3809732_3810734_-	hypothetical protein	NA	NA	NA	NA
WP_009969682.1\|3811460_3812036_+	recombinase family protein	A0A219Y912	Aeromonas_phage	8.7e-23	39.6
WP_076852973.1\|3812508_3813534_-	hypothetical protein	NA	NA	NA	NA
WP_080495573.1\|3813883_3814513_-	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	2.7e-25	38.1
WP_071810516.1\|3814520_3816083_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.3e-149	53.5
WP_017335489.1\|3816112_3816460_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_009982080.1\|3816456_3816864_-\|transposase	transposase	B6DZU5	Stx2-converting_phage	1.0e-14	37.2
WP_004541745.1\|3818313_3818898_-	hypothetical protein	NA	NA	NA	NA
WP_004543939.1\|3819072_3819270_-	hypothetical protein	NA	NA	NA	NA
WP_004556790.1\|3819302_3821060_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_071810771.1\|3821084_3821267_-	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_071810994.1\|3821327_3821522_-	hypothetical protein	NA	NA	NA	NA
WP_071810772.1\|3821617_3830941_-	contact-dependent inhibition toxin BcpA	A0A0R6PJK4	Moraxella_phage	1.2e-33	33.9
WP_004193468.1\|3832610_3833087_-	hypothetical protein	NA	NA	NA	NA
WP_076811750.1\|3833184_3833526_+	hypothetical protein	NA	NA	NA	NA
WP_071810773.1\|3833542_3833767_+	hypothetical protein	NA	NA	NA	NA
WP_071810774.1\|3834031_3835168_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_004522511.1\|3835265_3835805_-\|protease	serine protease inhibitor ecotin	NA	NA	NA	NA
WP_004550750.1\|3835977_3836358_+	hypothetical protein	NA	NA	NA	NA
WP_153260185.1\|3836323_3836470_+	hypothetical protein	NA	NA	NA	NA
WP_080495606.1\|3836964_3837375_-	hypothetical protein	NA	NA	NA	NA
WP_004192184.1\|3837391_3837772_+	hypothetical protein	NA	NA	NA	NA
WP_009935757.1\|3837973_3838198_-	hypothetical protein	NA	NA	NA	NA
WP_009969852.1\|3838347_3838860_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_071810776.1\|3838983_3840357_+	MFS transporter	NA	NA	NA	NA
WP_004550754.1\|3840468_3840726_-	hypothetical protein	NA	NA	NA	NA
WP_004191641.1\|3841084_3841696_+	membrane protein	NA	NA	NA	NA
WP_004522515.1\|3841868_3842471_-	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	3.3e-25	62.8
WP_004192381.1\|3842463_3843882_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_071810777.1\|3844014_3844212_-	hypothetical protein	NA	NA	NA	NA
WP_004526348.1\|3844500_3845052_+	lipoprotein	NA	NA	NA	NA
WP_004522517.1\|3845048_3845555_+	lipoprotein	NA	NA	NA	NA
WP_004555428.1\|3845611_3845773_+	hypothetical protein	NA	NA	NA	NA
WP_145956496.1\|3846613_3847426_+	sce7726 family protein	A0A0U2RXY7	Escherichia_phage	3.2e-07	29.0
WP_071810779.1\|3847436_3848501_-	hypothetical protein	NA	NA	NA	NA
WP_145956497.1\|3848497_3848941_-	hypothetical protein	NA	NA	NA	NA
WP_145956498.1\|3848925_3849213_+	hypothetical protein	NA	NA	NA	NA
WP_085517685.1\|3849273_3849687_-	hypothetical protein	NA	NA	NA	NA
WP_071810781.1\|3849778_3850627_-	hypothetical protein	NA	NA	NA	NA
WP_095413466.1\|3851438_3852618_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.1e-59	41.5
WP_085561474.1\|3852856_3854581_-	hypothetical protein	NA	NA	NA	NA
WP_085517644.1\|3854594_3856304_-	molecular chaperone HscC	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.1e-86	38.0
WP_085517645.1\|3856712_3857387_-	DUF799 domain-containing protein	NA	NA	NA	NA
WP_085517647.1\|3857397_3857769_-	DUF4810 domain-containing protein	NA	NA	NA	NA
WP_085517686.1\|3857814_3858438_-	curli production assembly protein CsgG	NA	NA	NA	NA
WP_085517649.1\|3858724_3859318_-	hypothetical protein	NA	NA	NA	NA
WP_085517651.1\|3859724_3861485_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_085517653.1\|3861514_3861736_-	CDI system lipoprotein BcpO	NA	NA	NA	NA
WP_145956499.1\|3861764_3862577_-	contact-dependent inhibition immunity protein BcpI	NA	NA	NA	NA
WP_071810947.1\|3864571_3866077_+\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

4019250 : 4030204

Agrobacterium_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004196461.1\|4019250_4021551_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	5.1e-167	42.1
WP_004194131.1\|4021547_4021862_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	4.4e-13	44.6
WP_004196460.1\|4022394_4022598_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
WP_071810809.1\|4022727_4024338_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_009929279.1\|4024350_4024533_+	hypothetical protein	NA	NA	NA	NA
WP_004189552.1\|4024505_4025765_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	5.2e-12	63.0
WP_004189780.1\|4026032_4026611_+	pseudouridine synthase	NA	NA	NA	NA
WP_071810810.1\|4026872_4027091_+	hypothetical protein	NA	NA	NA	NA
WP_004530837.1\|4027282_4027792_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.5e-13	41.2
WP_004197486.1\|4028089_4030204_+	elongation factor G	E4ZFJ7	Streptococcus_phage	5.8e-56	26.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP018402

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018402_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018402_1

1492275-1492408

Orphan

Consensus_repeat	Method
GCATCCCGATGATCGGGTATTCCG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP018402_1

>merge|NZ_CP018402|1|1492275-1492408|CRISPRCasFinder
GTCACTCGACGACCGAGTATTCCGGAGAGGGCGCACCCAGGCGATCGAGCATCCCGATGATCGGGTATTCCGGCGGCGGCGCCTCTGCGGTGGAGTGCTTCGGCGAGCAGGCATCCCGATGATCGGGCATTCCG

>NZ_CP018402|1|1|1492275-1492408|CRISPRCasFinder
GTCACTCGACGACCGAGTATTCCG	GAGAGGGCGCACCCAGGCGATCGA
GCATCCCGATGATCGGGTATTCCG	GCGGCGGCGCCTCTGCGGTGGAGTGCTTCGGCGAGCAG
GCATCCCGATGATCGGGCATTCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018402.1\|WP_009950893.1\|1501966_1502272_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240624
NZ_CP018402.1\|WP_038793455.1\|1496226_1497885_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP018402.1\|WP_038767373.1\|1493669_1495943_+\|pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|369639
NZ_CP018402.1\|WP_009982175.1\|1484920_1485952_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236122
NZ_CP018402.1\|WP_076804964.1\|1498184_1498616_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018402.1\|WP_004532595.1\|1486521_1488333_-\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	unknown	unknown	gnl\|CDD\|225098
NZ_CP018402.1\|WP_004200700.1\|1500023_1501139_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP018402.1\|WP_071811367.1\|1483079_1484924_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP018402.1\|WP_004196898.1\|1501440_1501881_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP018402.1\|WP_009927403.1\|1499852_1499963_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018402.1\|WP_004552281.1\|1481046_1481700_-\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|380318
NZ_CP018402.1\|WP_004545438.1\|1490464_1491736_-\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|130908
NZ_CP018402.1\|WP_004530663.1\|1482153_1482603_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341411
NZ_CP018402.1\|WP_085517213.1\|1486049_1486505_-\|quinone-oxidoreductase	unknown	unknown	unknown
NZ_CP018402.1\|WP_004529498.1\|1480544_1480979_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|223149
NZ_CP018402.1\|WP_076851866.1\|1488407_1490192_-\|ribonucleotide-reductase-like-protein	unknown	unknown	gnl\|CDD\|180772
NZ_CP018402.1\|WP_004188381.1\|1477170_1478976_+\|fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|235730
NZ_CP018402.1\|WP_154233013.1\|1502276_1502552_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018402.1\|WP_004187469.1\|1493141_1493537_+\|conjugal-transfer-protein-TraR	unknown	unknown	gnl\|CDD\|224648
NZ_CP018402.1\|WP_004523291.1\|1498790_1499726_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109

Protein	Function_ID	Function_description	E-value
NZ_CP018402.1\|WP_009950893.1\|1501966_1502272_+\|hypothetical-protein	gnl\|CDD\|240624	cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor. The transcriptional corepressor CtBP is a dehydrogenase with sequence and structural similarity to the d2-hydroxyacid dehydrogenase family. CtBP was initially identified as a protein that bound the PXDLS sequence at the adenovirus E1A C terminus, causing the loss of CR-1-mediated transactivation. CtBP binds NAD(H) within a deep cleft, undergoes a conformational change upon NAD binding, and has NAD-dependent dehydrogenase activity.	0.0059154
NZ_CP018402.1\|WP_038793455.1\|1496226_1497885_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	1.99057e-37
NZ_CP018402.1\|WP_038767373.1\|1493669_1495943_+\|pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|369639	pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.	7.17896e-57
NZ_CP018402.1\|WP_009982175.1\|1484920_1485952_-\|hypothetical-protein	gnl\|CDD\|236122	PRK07877, PRK07877, Rv1355c family protein.	2.5119e-30
NZ_CP018402.1\|WP_071811367.1\|1483079_1484924_-\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	4.54954e-107
NZ_CP018402.1\|WP_004200700.1\|1500023_1501139_+\|hypothetical-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	2.16274e-11
NZ_CP018402.1\|WP_076851866.1\|1488407_1490192_-\|ribonucleotide-reductase-like-protein	gnl\|CDD\|180772	PRK06948, PRK06948, ribonucleotide reductase-like protein; Provisional.	0
NZ_CP018402.1\|WP_004196898.1\|1501440_1501881_-\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	3.1145e-25
NZ_CP018402.1\|WP_004552281.1\|1481046_1481700_-\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|380318	cd02142, McbC_SagB-like_oxidoreductase, oxidase similar to the microcin B17 processing protein McbC. This family is the oxidase domain of NRPS (non-ribosomal peptide synthetase) and other systems that modify polypeptides by cyclizing a thioester to form a ring. These include EpoB, part of the epothilone biosynthesis pathway; TubD, part of the tubulysin biosynthesis pathway, MtsD, part of the myxothiozol biosynthesis pathway; IndC, part of the indigoidine biosynthesis pathway and TfxB, part of the trifitoxin processing pathway. All are FMN-dependent and oxidize the product of the cyclization of thioesters in short polypeptides.	4.23582e-20
NZ_CP018402.1\|WP_004545438.1\|1490464_1491736_-\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|130908	TIGR01849, unnamed_protein_product, polyhydroxyalkanoate depolymerase, intracellular. This model represents an intracellular depolymerase for polyhydroxyalkanoate (PHA), a carbon and energy storing polyester that accumulates in granules in many bacterial species when carbon sources are abundant but other nutrients are limiting. This family is named for PHAs generally, rather than polyhydroxybutyrate (PHB) specificially as in Ralstonia eutropha H16, to avoid overcalling chemical specificity in other species. Note that this family lacks the classic GXSXG lipase motif and instead shows weak similarity to some [Fatty acid and phospholipid metabolism, Degradation].	2.62791e-114
NZ_CP018402.1\|WP_004530663.1\|1482153_1482603_+\|CBS-domain-containing-protein	gnl\|CDD\|341411	cd17775, CBS_pair_bact_arch, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and archaea. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	3.14402e-50
NZ_CP018402.1\|WP_004532595.1\|1486521_1488333_-\|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein	gnl\|CDD\|225098	COG2187, COG2187, Uncharacterized protein conserved in bacteria [Function unknown].	3.75845e-75
NZ_CP018402.1\|WP_004529498.1\|1480544_1480979_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|223149	COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones].	9.00264e-33
NZ_CP018402.1\|WP_004188381.1\|1477170_1478976_+\|fatty-acid--CoA-ligase	gnl\|CDD\|235730	PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP018402.1\|WP_004187469.1\|1493141_1493537_+\|conjugal-transfer-protein-TraR	gnl\|CDD\|224648	COG1734, DksA, DnaK suppressor protein [Signal transduction mechanisms].	1.7869e-14
NZ_CP018402.1\|WP_004523291.1\|1498790_1499726_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.07132e-61

>NZ_CP018402.1|WP_004545438.1|1490464_1491736_-|polyhydroxyalkanoate-depolymerase
MLYAWLEAQREFFRACQPWAGAAQRAGAGAGARPAGWPTWGPMARAADAVPAPPPFAIASIEIDGAAVPVDECVVDDTPFCALRKFSRRLRGDAAARPAVFLCTPLAGHHAVMLRETVETILATRDVYVTDWRNARDVPLEAGAFGLDDYVCTLERFVAGAAGDGLHMMAVCQATVPALAAVALLAARDVHVTSVALLGGPVDTRSHPTLIDRFALEHDLDWFRRTAIDIVPPPYAGAGRRVYPGFIQHAAIIVAHPQRRASLESRYWAAWMTGDFAAAARCLREMNEYGAVLDMTERYFLDTIRVIFHERLLAQGRWSIGRRLVAPRRLTRTALCTIEGGRDDIAGAGQTHAAHALCDAVPDAVRERITEPDCDHYDLFLGPRWRRTIHPALDAFWTRAEAARAAAGEPRPTAERAERRIAH
>NZ_CP018402.1|WP_076851866.1|1488407_1490192_-|ribonucleotide-reductase-like-protein
MIGDMDDQPICDAVFADRYALPGEHSRAQACARVARALALAEPMATRSGAARRFYRNLLNGAFGAGRIMARAGAAPDQTMASCFVHPIRAPAALTRFHPNLDEALDEARLALAMGADIGYDFSAIPPAGARPDADHPDSPGVCAALDRFDRIGTQAGERDGRRRAQLAVLRCDHPDLLAFAAAKHRHAGRHARWTTLELAVAATDAFMQAVEQDLPWTLRHTAPPRDAPGGALPGADGAWTYASVPARHVWREIVSAARDGAGPGLVFVDAIDAADPLRGRERIDATSPCGAQPLPPYGSAMLGAINLSRFVRNPFGAGGEPRFDFAAFDTAVRIEVRLLDNALDVTRWPLAAHARESYQKRRIGVGVTGLADMLAMMRLRYDSPAAREMARYIASDLRHHAYAASAELAAERGAYPLCDRHAHLDALRAGPPLPHAVCHAIERDGLRHSHLTSFAPVIGVSLAFGDHCSPGIEPARAWIEHRPVRAGAAGAPGMRAENHAHRLFRSLRGERAALPDYFATDADVAPGERLAMRVALQPYVDAGIDNTLTLANHYSLEEVNALLFAAWRAKLKSVAIRRADLARDAQPSDDDGV
>NZ_CP018402.1|WP_004532595.1|1486521_1488333_-|bifunctional-aminoglycoside-phosphotransferase/ATP-binding-protein
MTTGAVAARRLPRRGTARGRRAPSRAFTIHGGDEMRRSRPPKPAKPAAVRRRPHGAARAHAIRGNGPQRRAVRERAARRLSRDIDAALRRASTYPHPAGPIVRIETHLSVVYLVGRFAYKRLKPFDFGFANFSELAARRRACEAELALNRPLAAPIYLAAGPLVRRARGLRLFGAGAAVDHVVRMRRFDERMLFSRLLARGALDAADIDAAATRLAAYHLHAPRDIPRRAYGSARELRRQLDDMLAPLERALGAALPASLRAWCVRRCDELAAHLDARRADGYVRACHGDLHLNNVVKRGRDALMFDCIDFDDALRWIDVINDLSFLLMDLHAHDRAALAHRLLNRWLDETGDFAGLAALPLYVAYRALVRALVATMRAGGDAAARAARIERARRYVDVAAHAARARRPCLLLCHGYSGSGKSVASRALADVSGAIRLSSDSERKRARPFAAVDARPLPASAYTPQQIDAQYERLRALARDVLRAGYTALVDATFLSHARRARFFALARELGVPVYVLDFHASRACLERRVDARAAARDDHSDAGAAVLATQRASADPLDADERARTIGFDTDVPLATLRSAGYWRPVLDALDAARVDAQATR
>NZ_CP018402.1|WP_085517213.1|1486049_1486505_-|quinone-oxidoreductase
MRNRCRDTSRQRGPRRPRRRPFARGHLAAPLRSLAHSLSATPRHAMPCHAAPHRTAPQRNATQRNGNGDGDGNDDRTPPPAGSARAARRADSRANRTRSRAHARRAGEIRRSRGPRRNGRRPRERRPNARSTHRPSAVDLGQSAPAGRSID
>NZ_CP018402.1|WP_009982175.1|1484920_1485952_-|hypothetical-protein
METSPLKTTTPEAIPPFNPSASVEDKLRLAIHYAILAPSSHNTQPWRFMVGDGSVMLCADRLRALSVVDPYDRELLISCGAALLNLRVALSRFGFAYVIDMFPSPSDPDVIALVRLDPHGYHDESLVPLFDAILERVTTRTPYANEAVPCDVQRALVDAGAAEGAEIACVDAPHALDEIAELIADADRLQFADPRFRRELANWVHPRRHDDGMPAFAAGVPALLDFATPVVASAIRTFDLGGGLAAMHHKLVDGSPLIVGISTASDDRDAWVAAGQALERVLLVAAAAGLTASYLNQPIEIDALRERLRPLLHVDAHPQLLLRIGRGPVVAHAPRRPLMDVVS
>NZ_CP018402.1|WP_071811367.1|1483079_1484924_-|STAS-domain-containing-protein
MTERERAARGRNDARRGGGDSGDDKAWRRWLPGIATLRTYRRAWLARDLYAGVALTAVLVPVGMSYAQAAGLPVIAGLNASIAALVGYAIFGPSRILVLGPDSALAALIAGAIAPLAHGEPAHAVALAAALALMSGGFCVLAGLLKLGFVTDLLSKPIQYGYLNGLALTLIASQLPSLLGTVPLGGTFVDQVASLAATVAQGRIDFASLALGGGCLAGIALLRRVAPAWPGMLIAVAGASIVAAWLGAAPDAGGAHAHVAYAHVAYAHVANAHVALVGSLAGTLPPLGLPSISLADASRLIAGALAIAMVSVADISVLSHVFAQHDGSETDRNQELCALGAANLLAGMLRGCAVSSSASRTPVALAAGARTQLTSLVAAACIALLLVAPTLLARVPLAALAAVVVYSANALVDVRAIVRLYRVRRGECAVSVLCFAGVVLLGVVPGILLAVGLSLLSFVWRAWHPYDAVLGRVEGMHGYHDVSRHPGAALTRGLVAFRWDAPLFHANATIFRDHVRDAIAEADAPVRCVVIAAEPITDVDVTAADMLATLRDELAARRIALVFAEMKGPVKDRLRTYGLFEKIGADHFFPTVTDAIEHFTRMRKDVATARRARR
>NZ_CP018402.1|WP_004530663.1|1482153_1482603_+|CBS-domain-containing-protein
MNAAEICTREVVACRRTDTVLDAAHLMRDRHVGDLIVVDDAGHAHAPVGMLTDRDIVLSLIAKDVDPAALFVGEIMSAPAAVVHEHDSLWTIAQRMRLTGVRRMPVVNADGALVGMVSVDDLLASVAALFDEIASISRRQIHFEEKARD
>NZ_CP018402.1|WP_004552281.1|1481046_1481700_-|SagB/ThcOx-family-dehydrogenase
MSDPELLTYQPIAVALPGPAEAGAPAVIDLPPPDLGAGLPLMSALSLRASTREFSSAALAPTTLGELLWAADGVNRPTTGGRTAPSAHAFNEIDVYAALPDGVYRYDAALHRLLLKHAVDARNLTGYQDFVGAAPLDLIYVVRMSRLLSMPKPLRETFSAVAAGAIAQNVALYCASTGLGCVVRGWINHRLLAEALSLNEDELPILAQTVGKPAAHP
>NZ_CP018402.1|WP_004529498.1|1480544_1480979_+|Hsp20/alpha-crystallin-family-protein
MSNVTRYDPFSLEPVSDLFQGLFRPLRGIADADDEKLASMKIDVTENDQAYAVKAELPGVDKNDINVQIDGNTVSISAKVERNKELKEGERVIRRERYSGEFARTFSLANELDRDAASAQYQDGVLSLTLPKKASSEKKKLTIG
>NZ_CP018402.1|WP_004188381.1|1477170_1478976_+|fatty-acid--CoA-ligase
MHATDQHSALNAAPSAYVYPLLVGQLLTHARGADAGRQIVYRGDVRHSYAQFRERIGRLAGALAALGVGADATVAVMDWDSHRYLESYFAIPMMGATLFTVNVRLSPRQIAHTLRDARASVVVAHADFLPLLEQVRDALGDSTCVIVACDGGAMPATSLPLAGEYERLVAAADPDYPFADFDENARAVLFYTTGTTGDPKGVCYSHRQIVLHALATAAALGAARDGQRLHRDDVYMPITPMFHVMAWGMPYIAVMLGLKIVLPGRYRAHALLDLRQAERVTFSHCVPAVLQMLLDEARLRACDLSGWKMIVGGSALPASLCRAARARRIDVFAGYGMSETGPVVALAQLRGTEGGVDVHADEDAGIDADVGAGIDVDTDVDADINANAGANASDSSVTTAAAHADDETAKRCAAGWPPPLVELRVVDAAMRDVPRDGRTPGEIVLRGPALALGYRGNPQASAALWAGGYLHTQDVAVMHGDGAIRIVDRIKDVIKTGGEWVSSLELEGLLNDIAGIRESAVVGVPDARWGERPAAVVVCERDAPLAAQDVRARLLEHVAANRISRYAVPECERIVFVDALPKTSVGKIDKKSLRRLVERID
>NZ_CP018402.1|WP_004187469.1|1493141_1493537_+|conjugal-transfer-protein-TraR
MAAFDEHQLQVLGALLRACRQALQADVRAGERQRADEPYANLAGPAPDEGDEANADLFVDVDHALLGMKLAELRDVDAALQRIARRDYGCCADCGQPIAYERLLARPTALRCAPCQRAHERRFATQPRPSL
>NZ_CP018402.1|WP_038767373.1|1493669_1495943_+|pyridine-nucleotide-disulfide-oxidoreductase
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPASITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPGFGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGVMPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVGVTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVRQGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLADDVLRAAFTIDRPAVEIAALNDAIRLHVNVAARKTKLSDPNYPLDKLPVQTILILQGGGALGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLPYESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDFDSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDGGVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKTLPTNLVEVMLRREEIAYMDRVRNDLRFEEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIEDYDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
>NZ_CP018402.1|WP_038793455.1|1496226_1497885_-|GMC-family-oxidoreductase
MKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGRRWTPENLPESTWNLSRWQWRPALGLRGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPPDKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYPTEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAERLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGTQDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTHIEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARETMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPMTSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALAEHAMSHVPAAREQRWDSTAETLVAA
>NZ_CP018402.1|WP_076804964.1|1498184_1498616_-|hypothetical-protein
MHQERRKRNADRHGTHQYDADSRAAPREAPRFEHEPKKQRDAAQHEVDRDRAAREIRERIEHKARPDVRRAERPISQDVAQAPIGAAGAISPSTAHSIFLEIGLALAGRPIQVRRNRAPFTHGTPRRRPARGPTARTASPAPV
>NZ_CP018402.1|WP_004523291.1|1498790_1499726_-|LysR-family-transcriptional-regulator
MIQNLRQLDLNLLLVFDALMQEQNLSRAAIRLHMSQPAVSNALTRLRQQLGEPLFTRTARGMTPTAQARTLYEPVRQALYLLQIGLGPQADFEPDTHHLFKLSMNDYGQTVLLPDLLAHIKSRAPNVMLSVQSDDAGSIPAQLTTGTLDLAIDYLHFDNPELCYEPLHEEHLVVIGRAGHPAFAGGLALRGYEESGHVSIQPRDRRGSPLEIVLGSARVRRVVHLQVPHYLTIPALVAKSDLLGTIPRRLAERFADVYALQIAPLPIDIAPIQVSLIWHRQQDAQPGLRWLREQVVLTHRAIIGCDEHAPA
>NZ_CP018402.1|WP_009927403.1|1499852_1499963_+|hypothetical-protein
MQSTGSFDISARRMIEFRSVNKSNHDCPLEKSSGLL
>NZ_CP018402.1|WP_004200700.1|1500023_1501139_+|hypothetical-protein
MTQDVTVFRARYRASVHPRYNAWLHGGFVLAYGCAAIAFFLKDVARVSAVQWASVPAAFLLFNWLEFTVHRHVGHVKRRFGAMFYRRHTGDHHSFFANEQIAYREARDWRVILFPAWLIVVFSLGLFALHAVLGRFDANVAGLFASTMLGGYLLYECVHACEHLPDAHPLAKWPWIRQMRVLHRVHHRDALMRSCNFDVIWPLMDWLHGTLRWSEAPGADMSTRMRHEIDIACAGADVLAYASDASRWPEWHPSSLRVDGPAGSLAAGSRFDEDVRAAGRVDRLHWDVVRNEPGVMWQARAANTAGSLRILLTYECSGGPRGARFVRTLHYHSPNPLLRLANALVMRGRVERESAYSLTLLKRRLEAARDA
>NZ_CP018402.1|WP_004196898.1|1501440_1501881_-|SRPBCC-family-protein
MKQQRIEIAEEFDAPVHQVFRFFSEHENLKSIFSPAKIRRISDGEPARNGVGSAREMRVPGAPPFVETVTAYQENELIEYRITRGSPLRDHLGVMRFVPIDERRTYFHYVITFEGKVPFVAPVVRHVLEGSIRRGLGKVATRRLWG
>NZ_CP018402.1|WP_009950893.1|1501966_1502272_+|hypothetical-protein
MRHDSRLRCTRDDDDIDQCHRQSGRSPLDAEPNRGCAARRLRASGGRRPRGANTEPRRRKPHARVIRQRSWRAARTRPCRRFSAACGRFGQAMARRARPPA
>NZ_CP018402.1|WP_154233013.1|1502276_1502552_+|hypothetical-protein
MRIAEALCARIVETRVDASAARSLPGSGAVTTARASADISGLVRVAEAGGALSGARIEFMGESGAGGTPRAAKACRFGIRTISRVRAVSLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018402_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018402_2

1921113-1921205

Orphan

Consensus_repeat	Method
TCGCCGCCGCGCGCGACGACGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018402_2

>merge|NZ_CP018402|2|1921113-1921205|CRISPRCasFinder
TCGCCGCCGCGCGCGACGACGCGCTGAAGGACGCGCTCGCGCAGGCCGCCGCCGAGCGCGAGCGGCTGATCGCCGCCGCGCGCGCCGACGCGC

>NZ_CP018402|2|2|1921113-1921205|CRISPRCasFinder
TCGCCGCCGCGCGCGACGACGCGC	TGAAGGACGCGCTCGCGCAGGCCGCCGCCGAGCGCGAGCGGCTGA
TCGCCGCCGCGCGCGCCGACGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018402.1\|WP_004524990.1\|1927411_1928977_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185008
NZ_CP018402.1\|WP_071811428.1\|1921640_1923635_+\|F0F1-ATP-synthase-subunit-alpha	unknown	unknown	gnl\|CDD\|183987
NZ_CP018402.1\|WP_004524989.1\|1926361_1926871_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018402.1\|WP_004533337.1\|1923631_1924480_+\|F0F1-ATP-synthase-subunit-gamma	unknown	unknown	gnl\|CDD\|376304
NZ_CP018402.1\|WP_004529178.1\|1924698_1925724_+\|alcohol-dehydrogenase-AdhP	unknown	unknown	gnl\|CDD\|176257
NZ_CP018402.1\|WP_004187193.1\|1920645_1920894_+\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|184067
NZ_CP018402.1\|WP_004187346.1\|1919947_1920649_+\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|237383
NZ_CP018402.1\|WP_004524981.1\|1916874_1917132_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018402.1\|WP_004548632.1\|1914949_1916743_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|213656
NZ_CP018402.1\|WP_009969306.1\|1935773_1936847_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP018402.1\|WP_071811430.1\|1929404_1931240_-\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP018402.1\|WP_004188221.1\|1918697_1919153_+\|F0F1-ATP-synthase-subunit-epsilon	unknown	unknown	gnl\|CDD\|184057
NZ_CP018402.1\|WP_071811431.1\|1932516_1935777_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP018402.1\|WP_011853763.1\|1917103_1918708_+\|F0F1-ATP-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183615
NZ_CP018402.1\|WP_050020039.1\|1913535_1914966_-\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	unknown	unknown	gnl\|CDD\|236180
NZ_CP018402.1\|WP_004530237.1\|1919149_1919650_+\|AtpZ/AtpI-family-protein	unknown	unknown	gnl\|CDD\|378198
NZ_CP018402.1\|WP_004524985.1\|1919642_1919951_+\|membrane-protein	unknown	unknown	gnl\|CDD\|274462
NZ_CP018402.1\|WP_014920159.1\|1931389_1932514_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP018402.1\|WP_009982021.1\|1925800_1926304_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018402.1\|WP_004529184.1\|1912360_1913539_-\|acetate/propionate-family-kinase	unknown	unknown	gnl\|CDD\|235922

Protein	Function_ID	Function_description	E-value
NZ_CP018402.1\|WP_071811428.1\|1921640_1923635_+\|F0F1-ATP-synthase-subunit-alpha	gnl\|CDD\|183987	PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional.	0
NZ_CP018402.1\|WP_004533337.1\|1923631_1924480_+\|F0F1-ATP-synthase-subunit-gamma	gnl\|CDD\|376304	pfam00231, ATP-synt, ATP synthase.	4.46992e-34
NZ_CP018402.1\|WP_004529178.1\|1924698_1925724_+\|alcohol-dehydrogenase-AdhP	gnl\|CDD\|176257	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP018402.1\|WP_004187193.1\|1920645_1920894_+\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|184067	PRK13468, PRK13468, F0F1 ATP synthase subunit C; Provisional.	4.45015e-37
NZ_CP018402.1\|WP_004187346.1\|1919947_1920649_+\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|237383	PRK13421, PRK13421, F0F1 ATP synthase subunit A; Provisional.	1.54059e-122
NZ_CP018402.1\|WP_004524990.1\|1927411_1928977_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	2.47951e-79
NZ_CP018402.1\|WP_004548632.1\|1914949_1916743_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|213656	TIGR01838, Poly-beta-hydroxybutyrate_polymerase, poly(R)-hydroxyalkanoic acid synthase, class I. This model represents the class I subfamily of poly(R)-hydroxyalkanoate synthases, which polymerizes hydroxyacyl-CoAs with three to five carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids. These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell. [Fatty acid and phospholipid metabolism, Biosynthesis].	1.95969e-179
NZ_CP018402.1\|WP_009969306.1\|1935773_1936847_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	2.70657e-39
NZ_CP018402.1\|WP_004188221.1\|1918697_1919153_+\|F0F1-ATP-synthase-subunit-epsilon	gnl\|CDD\|184057	PRK13447, PRK13447, F0F1 ATP synthase subunit epsilon; Provisional.	4.44077e-63
NZ_CP018402.1\|WP_071811431.1\|1932516_1935777_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	2.45304e-92
NZ_CP018402.1\|WP_011853763.1\|1917103_1918708_+\|F0F1-ATP-synthase-subunit-beta	gnl\|CDD\|183615	PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional.	0
NZ_CP018402.1\|WP_050020039.1\|1913535_1914966_-\|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase	gnl\|CDD\|236180	PRK08190, PRK08190, bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated.	0
NZ_CP018402.1\|WP_004530237.1\|1919149_1919650_+\|AtpZ/AtpI-family-protein	gnl\|CDD\|378198	pfam09527, ATPase_gene1, Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter. This model represents a protein found encoded in F1F0-ATPase operons in several genomes, including Methanosarcina barkeri (archaeal) and Chlorobium tepidum (bacterial). It is a small protein (about 100 amino acids) with long hydrophobic stretches and is presumed to be a subunit of the enzyme. It carries two transmembrane helices and is a magnesium or calcium uniporter. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI.	4.39073e-17
NZ_CP018402.1\|WP_004524985.1\|1919642_1919951_+\|membrane-protein	gnl\|CDD\|274462	TIGR03165, F1F0_chp_2, F1/F0 ATPase, Methanosarcina type, subunit 2. Members of this protein family are uncharacterized, highly hydrophobic proteins encoded in the middle of apparent F1/F0 ATPase operons. We note, however, that this protein is both broadly and sparsely distributed. It is found in about only about two percent of microbial genomes sequenced, with the first ten examples found coming from the Euryarchaeota, Chlorobia, Betaproteobacteria, Deltaproteobacteria, and Planctomycetes. In most of these species, surrounding operon appears to represent a second F1/F0 ATPase system, and the member proteins belong to subfamilies with the same phylogenetic distribution as the current protein family.	4.12229e-10
NZ_CP018402.1\|WP_014920159.1\|1931389_1932514_-\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	6.07186e-26
NZ_CP018402.1\|WP_071811430.1\|1929404_1931240_-\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	5.65725e-132
NZ_CP018402.1\|WP_004529184.1\|1912360_1913539_-\|acetate/propionate-family-kinase	gnl\|CDD\|235922	PRK07058, PRK07058, acetate/propionate family kinase.	0

>NZ_CP018402.1|WP_004187193.1|1920645_1920894_+|F0F1-ATP-synthase-subunit-C
MNNLIEVVSIAAAALAVSFGAIGPALAEGRAVGAAMDAIARQPDASGTVSRTLFVGLAMIETMAIYCLVVALLLLFANPFVK
>NZ_CP018402.1|WP_004187346.1|1919947_1920649_+|F0F1-ATP-synthase-subunit-A
MNASPLSTVPLFSVGPVGISAPVLATWAIMAVLVALALVARRRLSVDAPSRLQSVLELFVATVDAQIADTMQTPPARYRALIGTIFVLVFCANGASLVPGVEPPTAHLETDAALALVVLAATLYYGVRARGVRGYLATFAEPTWVMIPLNVVEQLTRTFSLIVRLFGNVMSGVFVIGIVLSLAGLFVPIPLMALDLLTGTVQAYIFMVLSMVFIGAAVSGDETSAPRRGQENT
>NZ_CP018402.1|WP_004524985.1|1919642_1919951_+|membrane-protein
MIEMWETARASFDGIAAAIGLALGFVAGACHFVSLGWNSRLFVAGRAGVALALQLARVALAVAVLVVLARAGFGMLVAGSAGFFAARAIAVRRAAALTGARR
>NZ_CP018402.1|WP_004530237.1|1919149_1919650_+|AtpZ/AtpI-family-protein
MMKRRPPEVKREAREARDDAARGDARHAGAGAAPDDPRGAARRDPPPGSRAARGGATHPAARAAEPAAPKPAADRVERAAHTAAARAARGARDPEPSLGRRLAQIGVLGWTIVAPTLAALALGRWLDRMFATRVFFSAPLLMLGAALGLWLAWRWMKAQQHGDRDD
>NZ_CP018402.1|WP_004188221.1|1918697_1919153_+|F0F1-ATP-synthase-subunit-epsilon
MGAELRVTIATPARVCVDDLPIVSLRAEDASGAFGIRAGHVDFVTLLRASVVRWRTADGATHYAALDGGVLRVTRGARIEIACRDAVLGESLAELEAVVRGVRATQLDEKRRARVDETRLHAQAVRRLLTYLRPEHAKDGVHAPLKPETLE
>NZ_CP018402.1|WP_011853763.1|1917103_1918708_+|F0F1-ATP-synthase-subunit-beta
MADPQATNGTGAACAERDASDVGDVSDVGDARDEGAGRVVAVRGAVVDVAFDGGALPALNEALTIPVDGAAPILAEVHAHLSDAAVRALALGPTGGLRRGAAVRATGGPIRVPVGDAVLGRLLSVTGAPGDDGAALAADVERRPIHRGAPPLAEQKSANALFATGIKVIDLLAPLAQGGKAAMFGGAGVGKTVLVMELIHAMVERYRGISVFAGIGERSREGHEMLLDMRGSGVLGRTVLVYGQMNEPPGARWRVPLTALAIAEYFRDERAQNVLLLMDNVFRFVQAGAEVSGLLGRLPSRVGYQPTLASEVAALQERIASVEGAAVTAIEAVYVPADDFTDPAVTAIAAHVDSMVVLSRAMAAEGMYPAIDPVASSSILLDPLVVGEAHVEVAIEVRRVIEHYRELQDVIALLGIDELGADDRRLVGRARRLQRFLTQPFAVTEAFTGQAGASVEIADTIAGCRAILRGDCDDWRESSLYMVGTLDDARRKEAAAREADARREAAAAASGAGPGTTSDPASGSAEPQGARHGR
>NZ_CP018402.1|WP_004524981.1|1916874_1917132_-|hypothetical-protein
MPFVACGSATVAPVWLVRRWLHHNGARRPPADLGQETGNRQTKRGIAQSETIDASASGADTVRAASIVDSNQIPQTYAWLQWPCQ
>NZ_CP018402.1|WP_004548632.1|1914949_1916743_-|alpha/beta-fold-hydrolase
MDTRHAPESGAPDAPLPAHPPASYAPESPYRIFDLAKEASVAKLTSGLSPASLQLALADWLIHLAAAPGKRAELATLALRHAALLGQYLLEAATGRTPAAPAQPSPGDRRFRAGAWQLEPYRFWHQSFLLAEQWWRAATRDVPGVSPHHEDVVAFSARQMLDTFAPANYVATNPEIAQRTALTGGANLAQGVWNYLDDVRRLITKQPPAGAEQFELGRNLATTPGRVVFRNHLIELLQYSPTTPDVYAQPVLIVPAWIMKYYILDLSAHNSLIRYLVGEGHTVFCISWRNVDASDRDLSLDDYRKLGVMDALDTIGAIVPGEKIHATGYCLGGTLLSIAAAAMANTGDDRLASVTLLAAQTDFAEPGELQLFIDDSEIHFLESMMWERGYLGAHQMAGSFQLLMSNDLIWSRVIHDYLLGERTPMIDLMAWNADSTRMPYRMHSEYLRHLFLDNDLATNRYVIDGQTVSVHNIRAPFFVVGTEHDHIAPWRSVYKIHYLSGSDVTFVLTAGGHNAGIVSEPGHAKRHYRMKMTAAAAPSISPDEWLAGATDFEGSWWPAWHAWLARHSSPQRVAPPPLGKPGAHTLGDAPGTYVFQK
>NZ_CP018402.1|WP_050020039.1|1913535_1914966_-|bifunctional-enoyl-CoA-hydratase/phosphate-acetyltransferase
MCSRNKECRVDREILQNRPFDSLAIGDSASLVRTASRDDIDLFAAMSGDVNPAHLDAAFAAHDLFGHVVVHGMWTGALVSAVLGTKLPGPGTIYLDQTLEFRHPVAPGDTITATVTVAEKRPEKRIVLLDTRCTNQDGHVVLRGTATVIAPDTPITWERVPGPEVAVRRHDRYETFVRDAREQPPLRTAIVHPCSPDALRAAIDARDANLIEPILIGPQAKIRAIADAAGVDLAGVPIEAVEHSHAAAARAVEMGGAGEVAALMKGSLHTDELLAAVIGPASRLRTERRISHVYAMDVPAYPKPLLITDAAINIAPTLEQKRDICQNAVDLLHVLGVERPRVAVLAAVETVNPKMPSTLDAAALTVMAARGQIAGAIVDGPLAFDNAVSAVAAMSKGIASPVAGDADVLLVPDLEAGNMLAKQLMYFAGADAAGLVLGARLPIILTSRADSLRVRIASAALAKLVAERTRAGALAS
>NZ_CP018402.1|WP_004529184.1|1912360_1913539_-|acetate/propionate-family-kinase
MSEPLLLTFNAGSSTLKIGLYSVANGEPAPLGRGKIDFNRAPLQFEYANGGEAHAVPLAAPVTDDLHAVLDEALGWIDAHLSVHELVSVGHRVVHGGDTFDGPVRIDERTLDAIAALVPLAPLHQPQSVRLIRALRHLRPHLPQVASFDTAFHRTQSDLVRRFALPRALFDAGIKRYGFHGLSYRYVAGRLRERHPSIARGKVVAAHLGSGASLCALDAGVSRDTSMGFSTLDGIPMATRCGALDAGVVLHLQKTLGRTLDDVEQMLYHRSGLLGVSGVSGDARALLADPSAGARDALELFAFRIAGETARLAATLGGLDALVFTAGIGEHQPQTRAAVCERLRWLGVELDAHANARNAETVSRDGSRVAVLVVPTDEEQVIARDAASVLHA
>NZ_CP018402.1|WP_071811428.1|1921640_1923635_+|F0F1-ATP-synthase-subunit-alpha
MTPTPDAPAAAAADAATGAGWLARRRGALARVALAPVAQAIGRVERVADGIAFVSGLEDTMLNEVLRFEGGVTGFAHTLDEDLISVVLLDPDAGVRAQTAVARTGAVLEVPAGPQLLGRVVDPLGRPLDGGAPLDAAHTLPIERAAPAIIERDLVSEPLDTGVLIVDALFTIGRGQRELIIGDRATGKTSLAIDAIVNQRHSDVICVYVAIGQRASAVRRVIDAVRRYGAPERCVFVVAPAACAPGLQWIAPFAGFSIAEYFRDRGQHALVVVDDLTKHAATHRELALLTREPPGREAYPGDIFYVHARLLERAAKLSAALGGGSLSALPIAETDAGNLAAYIPTNLISITDGQIVLDSALFAANQRPAVDVGLSVSRVGGKAQHPALRAASGRLRLDYAQFLELEAFTRFGGLTDARLRAQITRGERIRALITQPRFRALRTLDEVVLLKALAAGALDAMSPDLVAPLRERLPAWLDARIAALTPALAPPRDWLADDAALDALAESVGELIERIAADAARRATAGMPAEDAAGDIGGAFGGEQARGDADRDADHGANREVSPEASREVSREVSHEADRDAAADAARVAGRAPGRAEPDRAAPRAMPDGPPRAQADGDRASASRPRPDARGDAARTAPSPQGGADANVNADANVDAEAEARHKR
>NZ_CP018402.1|WP_004533337.1|1923631_1924480_+|F0F1-ATP-synthase-subunit-gamma
MSDKLAAIEARTDTARQLQTVIGAMQGVAAARAHEAQQRLPGIRASAATVGAAIGDALSAGARSGDTAAGARAAPRARLVVVLCSEQGFVGAYNAQLIEHATRPEPSVSREYMMVGSRGAMLADAGGVPLVWRTPMAARADDVVHLANRITDALYAHLAKRGAQPVSIVHAMPGGAARLEVTERRLLPFDYARFDTAPRAQPPLVHLPPATLLAELAQAYVFVELCEAAMLAFAAENEARTRAMIAARESVERALGDLLQAYRIARQDEITADIVELAASGL
>NZ_CP018402.1|WP_004529178.1|1924698_1925724_+|alcohol-dehydrogenase-AdhP
MAQYMKAAVVHAFGEPLRIEEVPVPTPGAGQILVNVKASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGFVAAVGEGVRHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSVNGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGLGHVAVQYAKAMGLHVVAVDVAPQKLELARKLGAAFVVDASKDDPAAVIQKEIGGVHGVLVTAVSRGAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESLDFAAEGLVRAHIHRDKLEHINGVFSALREGKVDGRIVLTGQ
>NZ_CP018402.1|WP_009982021.1|1925800_1926304_+|hypothetical-protein
MRGAGRASPSRARRYENVSKEPNTHREARAPVHRYRLQVRNMNGECRTYELRLSSLDDGYTLEIDEWLNFPDMHLGDVTPVHVSRPVQFAVPAHEFYRRRRAFRTELIESVAAALRAGEVVRMRDSPDEYPGGRAGNPWVNWIRADLRANPGGRPPPVGDDMQDLIH
>NZ_CP018402.1|WP_004524989.1|1926361_1926871_-|hypothetical-protein
MRRIYFLLPDADTARAIVDELLLKRIEWRHIHVVANDRVPLENLPEASIAQSSDLLPALARGTAAGGVTGALAGLAAIAFPPAGLTIAGGAVVAFAIAGAGFGAWVGTMIGVSVPNTRLKHFEDAVDNGELLMMIDVHRDRVEEIEALVKQHHPNAHLEGTDPTIPAFP
>NZ_CP018402.1|WP_004524990.1|1927411_1928977_+|methyl-accepting-chemotaxis-protein
MPTLSFRQKLWLPLVISLIALLLVSISSAWLSYQTRMEERRNDLTNVAHVGLSIVREYAALAQRGVLTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSPQGGFVDYVFAHPNAHPAKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEALGC
>NZ_CP018402.1|WP_071811430.1|1929404_1931240_-|response-regulator
MHVEVFAQHSSCPGWHGEMARRIRAFDWSATELGPLERWPASLVAAVRTVLASPVPLVMLWGASGYMLYNDAYAAFAGGRHPYLLGQPVELGWPEVADFNRNVMRTCLAGGALSYRDKALVLLRNGRPEEVWMDLYYSPLAGDDGAPAGVLAVVVETTERVLAARHRDRAKAALHETNAELRRLTETLEQRVADAITERASIEEQLRQAQKMEAIGSLTGGIAHDFNNVLQVVSSNLQMLSAELGEDARAQRRIASAANAVARGAQLASHLLAFARRQPLAPAVLEPRGLIDGMREMLHRALGESVHVDADLRDDVWNVLADRHQFENALLNLAINARDAMRGEGTLKITACNIVLDAGRHARRNGLPPGEYVAFDIADNGVGMTPDILERVFEPFFTTKPDGQGTGLGLSMVFGFVKQSGGHTSIESAPGRGTTVRLLLPRCREAPAGEPAAQRRLPAEGGRETILVVEDDADVRLAVVDMLAQLGYKVITASDGEAGLLALESGAPIDLLFTDVIMPGRIKGGELARRAAQRVPPVPVLFTSGYTRDEIFHAGRLDPGVMLLGKPYRRDELAHKVRSVLDAHASARRARGARHAQADPRAKTAAARVQR
>NZ_CP018402.1|WP_014920159.1|1931389_1932514_-|ABC-transporter-permease
MRRLAIVYRLGVKELWSLVRDPILLVLIAYTFTASIYSAATARPDTLHMAPIAIIDEDASPLSARIASAFFPPQFALPRMVTLAEADRGMDAGDFTFALDIPPNFQRDVLAGRPAQIQLNVDATRMSQAFTGNGYVQQIVSGEIDDFARRYRANTAPPVDIAMHMRFNPNLDQTWFGSLMEVINNVTLLSMVLTGAALIREREHGTIEHLLVMPVTPGEIMLAKVWSMGLVVACAAAFSLAFVVRGALHVPIEGSVALFVIGMAIHLFATTSMGIFLATLVRSMPQFGMLLVLVLLPLQLLSGSLTPRESMPFAVQNIMLAAPTTHFVEIGQAILYRGAGIETVWRKFLILAVIGTALFLLSLKRFRKTIGQMA
>NZ_CP018402.1|WP_071811431.1|1932516_1935777_-|ATP-binding-cassette-domain-containing-protein
MSAPSVVRFSDVSLRYGKTVALERITLEIPAGLTIGLIGPDGVGKSSLLALAAGARALQTGAVDALGGDMRSRRHRERVCRRIAYMPQGLGKNLYPTLSVEENLQFFARLFGHDADERRRRIDALTRSTGLFAFLSRPAGKLSGGMKQKLGLCCALIHDPDLLILDEPTTGVDPLARAQFWDLIARIRSERPAMSVIVATAYMDEAQRFDWLIAMDAGRVLATGAPAELLARTGCDSLEAAFIALLPEDERRGHKPVTLEPLRADAQTGTAIEARGLTMRFGDFTAVDHVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTAQLFGKTVDPKDINTRRRVGYMSQAFSLYSELTVRQNLVLHARLFGVPAAEIDARVDEMARRFGLADIYDMLPDSLPLGMRQRLSLAVAMVHKPELLILDEPTSGVDPVARDSFWQLMIDLARRDRVTIFISTHFMNEAQRCDRISLMHAGRVLASDAPAALVRARGAATLEEAFIGYLVDASAQEAQGGAGGRPGAGERAAGESLAGRGAATDGDADGAHARPAAYANGAAQHRAPDADAAGTDVAAETGARDDARTAHAAGHSAGNDVRATVGSEVGSEVGSEVGSDVGSDVASEAGPEAGLAASAESGAERAREPAADITADAGAAIDVEPGASAESATAAVAPARHAESAATSPRAGNAPAGTPFAAAPPSHAAPAEPPHRAFSAQRALSYMWREMLELRRDPVRATLALIGSLVLMCVIGIGISLDVEDLTYAVLDRDQTELSHDYALNLSGSRYFVERPPIADYAALDRRMRDGELSLAIEIPPNFARDVERGAPAQIGMWIDGAMPQRAETIRGYAIGMHTMWLADKARHRLGVTLAPRAEVVTRYRYNPDVKSLPAMIPAVMPLLLLMLPAMLTALAVVRERELGSILNLYVTPVTRTEFLIGKQVPYVVLAMLNFLLMTMLARIAFDVPVKGSFMTLLLAVLIFNVVATGIGLLASTFTRSQVAAIVMTIIGTMIPTVQFAGLLTPLSSLEGTGRLIGLVYPATYMLSISRGVFNKALSLHDLYSQFWPLAACVPVILGATILLLKKQER
>NZ_CP018402.1|WP_009969306.1|1935773_1936847_-|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MIQVTRKQIVAAAAVVVVALGAYYGWTLLRHQGPGDGFASGNGRIEATEIDVATKLPGRIDAILVDEGDFVKAGQPLANMQIQVLRAQYDEATAQRQRALNTAAGVQSQVAQRKSDKAAAQAMVVLRESELDAAERRLARSQTLSREGASSLQELDDDRARARSAQAAVSAAAAQVAAAQAAIEATEAQLVAAHSAVTAADATVARVQADIDDSQLASPRDGRVQYRVAQPGEVLPAGGKVLNLVDLSDVYMTFFLPETVVGRVALGADARIILDAAPNYVIPATVSFVSSTAQFTPKTVETANERQKLMFRVKARIDRELLQKHLKLVKTGLPGVAWVRVDPSKPWPAQLMVKVAQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

614002 : 681582

Aeromonas_phage(25.0%)

holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530063.1\|614002_614953_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004523149.1\|615220_616165_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_004530060.1\|616636_618340_+	thermolysin metallopeptidase	NA	NA	NA	NA
WP_038769383.1\|618457_619684_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_021252053.1\|619738_620881_-	porin	NA	NA	NA	NA
WP_004198249.1\|620989_621112_-	hypothetical protein	NA	NA	NA	NA
WP_004535106.1\|621108_622107_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_025986125.1\|622142_623696_-\|holin	choline-sulfatase	NA	NA	NA	NA
WP_004523143.1\|623831_624731_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_071811250.1\|624874_625750_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_004530057.1\|625836_627492_-	APC family permease	NA	NA	NA	NA
WP_004186918.1\|627672_628536_-	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004530056.1\|628645_629791_-	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004523139.1\|629811_631080_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_071811251.1\|631104_631890_-	drug:proton antiporter	NA	NA	NA	NA
WP_071811252.1\|631886_633059_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_004186901.1\|633063_634989_-	(Fe-S)-binding protein	NA	NA	NA	NA
WP_004523137.1\|634991_637055_-	NADH:flavin oxidoreductase	NA	NA	NA	NA
WP_004186987.1\|637115_637649_-	4-vinyl reductase	NA	NA	NA	NA
WP_004186989.1\|637799_638771_-	membrane dipeptidase	NA	NA	NA	NA
WP_004530801.1\|638843_640118_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	5.3e-105	54.1
WP_009923708.1\|640129_640393_-	hypothetical protein	NA	NA	NA	NA
WP_004198247.1\|640551_641577_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_004523135.1\|641754_642954_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	8.4e-12	27.2
WP_004530800.1\|643399_644416_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_080495686.1\|644604_646170_+	glycoside hydrolase 68 family protein	NA	NA	NA	NA
WP_071811254.1\|646301_647966_+	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	7.0e-57	31.6
WP_004186853.1\|648519_649773_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_071811074.1\|650301_651885_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_004186828.1\|652180_653176_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_045597683.1\|653440_655027_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_024428512.1\|655023_656343_-	glycosyltransferase	NA	NA	NA	NA
WP_004199051.1\|656350_656479_-	hypothetical protein	NA	NA	NA	NA
WP_004524288.1\|656576_657476_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_009967872.1\|657755_657929_+	hypothetical protein	NA	NA	NA	NA
WP_004530793.1\|658026_658398_-	hypothetical protein	NA	NA	NA	NA
WP_004530792.1\|658622_659045_-	hypothetical protein	NA	NA	NA	NA
WP_004190863.1\|659067_659427_-	hypothetical protein	NA	NA	NA	NA
WP_071811256.1\|659485_662989_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004530043.1\|662985_664701_-	OmpA family protein	NA	NA	NA	NA
WP_004525552.1\|664726_666088_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004530042.1\|666084_666678_-	lipoprotein	NA	NA	NA	NA
WP_004190606.1\|666683_667073_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_071811257.1\|667115_667832_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004525550.1\|667834_668905_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_004547074.1\|668904_671121_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_004190563.1\|671124_673413_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_004535244.1\|673578_675870_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_009981282.1\|675860_678731_-	type VI secretion system ATPase TssH	A0A2I7REQ1	Vibrio_phage	2.4e-60	27.2
WP_004190851.1\|678733_679723_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004196180.1\|679719_681582_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_2

838460 : 849195

Stx2-converting_phage(50.0%)

transposase,integrase

attL 842689:842704|attR 849900:849915

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_119011596.1\|838460_838700_-\|transposase	transposase	NA	NA	NA	NA
WP_119011631.1\|838621_839032_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_009967729.1\|839592_840525_-	glycerophosphoryl diester phosphodiesterase	NA	NA	NA	NA
WP_080495688.1\|840681_842052_-	c-type cytochrome	NA	NA	NA	NA
WP_020850157.1\|842102_843563_-	calcineurin-like phosphoesterase	NA	NA	NA	NA
842689:842704	attL	NA	NA	NA	NA
WP_085517173.1\|844902_845706_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	1.4e-58	47.4
WP_009982080.1\|845808_846216_+\|transposase	transposase	B6DZU5	Stx2-converting_phage	1.0e-14	37.2
WP_017335489.1\|846212_846560_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-40	72.9
WP_071810516.1\|846589_848152_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.3e-149	53.5
WP_080495573.1\|848159_848789_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	2.7e-25	38.1
WP_085517174.1\|848790_849195_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	6.7e-22	42.7
849900:849915	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1233895 : 1299398

Xanthomonas_phage(20.0%)

transposase,holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004523686.1\|1233895_1234414_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004523687.1\|1234415_1236296_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_071811335.1\|1236292_1237342_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_009967433.1\|1237360_1238431_+	type VI secretion protein ImpA	NA	NA	NA	NA
WP_009981089.1\|1238485_1239514_+	fimbrial protein	NA	NA	NA	NA
WP_038718765.1\|1239546_1240905_+	hypothetical protein	A0A292GJ55	Xanthomonas_phage	9.0e-111	45.6
WP_071811336.1\|1240797_1244250_-	RHS repeat protein	NA	NA	NA	NA
WP_004523693.1\|1244262_1244532_-	PAAR motif protein	NA	NA	NA	NA
WP_028201324.1\|1247375_1247945_-	hypothetical protein	NA	NA	NA	NA
WP_071811337.1\|1248134_1252043_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_004531577.1\|1252057_1253359_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_085517382.1\|1253355_1254705_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_095413485.1\|1254710_1255253_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004529642.1\|1255380_1255863_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_004523699.1\|1256062_1257562_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004523700.1\|1257595_1258135_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_071811339.1\|1258512_1260189_-	OmpA family protein	NA	NA	NA	NA
WP_076847500.1\|1260191_1260848_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_025986099.1\|1260912_1261485_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_076896864.1\|1261477_1264111_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_004533804.1\|1264334_1265072_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_004533867.1\|1265136_1265682_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_071811340.1\|1266266_1266821_+	hypothetical protein	NA	NA	NA	NA
WP_004523708.1\|1266831_1267047_-	hypothetical protein	NA	NA	NA	NA
WP_076852902.1\|1267082_1268570_+	PhoPQ-regulated protein	NA	NA	NA	NA
WP_153260193.1\|1271128_1271488_+	hypothetical protein	NA	NA	NA	NA
WP_004533827.1\|1273981_1274185_+	hypothetical protein	NA	NA	NA	NA
WP_004523716.1\|1274439_1276035_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.9e-06	33.3
WP_076836123.1\|1276115_1276739_+	DUF2244 domain-containing protein	NA	NA	NA	NA
WP_009967412.1\|1277324_1278017_-	hypothetical protein	NA	NA	NA	NA
WP_004523720.1\|1278488_1278815_+	thioredoxin family protein	NA	NA	NA	NA
WP_004523721.1\|1278834_1279254_+	YjbQ family protein	NA	NA	NA	NA
WP_045597630.1\|1279668_1279932_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_095413486.1\|1279941_1281480_-	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_071811342.1\|1281618_1283859_-	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	4.4e-22	27.1
WP_085517384.1\|1283872_1286650_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.0e-89	35.1
WP_004528499.1\|1286979_1287285_-	H-NS histone family protein	NA	NA	NA	NA
WP_004552621.1\|1287872_1288904_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004533801.1\|1288900_1289755_-	ABC transporter permease	NA	NA	NA	NA
WP_004533742.1\|1289738_1290659_-	ABC transporter permease	NA	NA	NA	NA
WP_004533753.1\|1291142_1291595_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_009939053.1\|1291614_1292634_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_080002191.1\|1292630_1292885_-	SET domain-containing protein-lysine N-methyltransferase	NA	NA	NA	NA
WP_023358215.1\|1294247_1295417_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.9e-32	30.1
WP_076802259.1\|1295970_1296717_-	hypothetical protein	NA	NA	NA	NA
WP_009939047.1\|1296855_1297011_-	hypothetical protein	NA	NA	NA	NA
WP_071811344.1\|1297202_1299398_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA

DBSCAN-SWA_4

1696510 : 1748915

Acanthocystis_turfacea_Chlorella_virus(16.67%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004530163.1\|1696510_1697914_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004529328.1\|1697929_1699246_+	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_004524806.1\|1699248_1702878_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_076851828.1\|1702883_1703807_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_004529325.1\|1703791_1704019_-	hypothetical protein	NA	NA	NA	NA
WP_071811395.1\|1704017_1706600_+	serine/threonine protein kinase	M1I231	Acanthocystis_turfacea_Chlorella_virus	5.0e-09	26.6
WP_009982092.1\|1706639_1707719_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004524810.1\|1707781_1708360_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_004190849.1\|1708352_1709861_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004190698.1\|1709920_1710412_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_009935240.1\|1710430_1710979_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004524812.1\|1710983_1712855_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_028358324.1\|1712851_1714297_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004533146.1\|1714309_1716976_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	5.2e-78	30.6
WP_071811397.1\|1716972_1719177_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.3e-45	29.9
WP_004533449.1\|1719192_1719903_+	hypothetical protein	NA	NA	NA	NA
WP_085508576.1\|1721327_1721846_+\|transposase	transposase	S5WIU1	Leptospira_phage	4.3e-21	53.1
WP_080002868.1\|1722810_1723140_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071811525.1\|1723150_1724302_-	hypothetical protein	NA	NA	NA	NA
WP_004544694.1\|1728584_1728986_+	VENN motif pre-toxin domain-containing protein	NA	NA	NA	NA
WP_071811399.1\|1728989_1729244_+	hypothetical protein	NA	NA	NA	NA
WP_071811400.1\|1729245_1729812_+	suppressor of fused domain protein	NA	NA	NA	NA
WP_004552182.1\|1733154_1733940_-	hypothetical protein	NA	NA	NA	NA
WP_009927050.1\|1735753_1736812_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_004553674.1\|1737162_1739223_+	hypothetical protein	NA	NA	NA	NA
WP_004524825.1\|1739265_1740510_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-22	32.8
WP_004524827.1\|1740545_1741787_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_004544732.1\|1741819_1742773_+	sugar ABC transporter permease	NA	NA	NA	NA
WP_004524829.1\|1742773_1743625_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004546333.1\|1743629_1745801_+	alpha-galactosidase	NA	NA	NA	NA
WP_009969406.1\|1746041_1748075_+	hypothetical protein	NA	NA	NA	NA
WP_038728064.1\|1748507_1748915_+\|transposase	transposase	A0A0P0ZCV4	Stx2-converting_phage	1.9e-11	36.5

DBSCAN-SWA_5

2271448 : 2330311

Burkholderia_virus(88.24%)

portal,terminase,holin,head,capsid,integrase,protease,transposase,tail,tRNA

attL 2264543:2264559|attR 2314278:2314294

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2264543:2264559	attL	NA	NA	NA	NA
WP_004187099.1\|2271448_2272891_+\|tRNA	L-seryl-tRNA(Sec) selenium transferase	NA	NA	NA	NA
WP_025988305.1\|2272887_2274813_+	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	1.8e-16	30.0
WP_085517398.1\|2275094_2275811_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	5.5e-51	51.9
WP_085517248.1\|2276166_2276403_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_085517250.1\|2276478_2276703_+	hypothetical protein	Q6JIJ6	Burkholderia_virus	1.8e-32	87.8
WP_085517253.1\|2276784_2276994_+	hypothetical protein	Q6JIJ5	Burkholderia_virus	1.1e-31	91.3
WP_085517399.1\|2277002_2277248_+	hypothetical protein	Q6JIJ4	Burkholderia_virus	2.8e-31	86.1
WP_145956464.1\|2277401_2277761_-	hypothetical protein	Q8W6R5	Burkholderia_virus	8.1e-27	51.3
WP_157131331.1\|2277904_2278072_-	hypothetical protein	NA	NA	NA	NA
WP_085517257.1\|2279316_2280696_-	hypothetical protein	A9YX44	Burkholderia_phage	1.4e-23	50.3
WP_085517259.1\|2280697_2281621_-	hypothetical protein	A1YZU8	Burkholderia_virus	3.6e-18	61.0
WP_085517261.1\|2281635_2281914_-	hypothetical protein	Q6JII7	Burkholderia_virus	1.1e-36	80.4
WP_085517401.1\|2281913_2282309_-	hypothetical protein	Q6JII6	Burkholderia_virus	1.1e-61	91.6
WP_085517263.1\|2282311_2282983_-	hypothetical protein	Q6JII5	Burkholderia_virus	8.3e-118	95.5
WP_085517265.1\|2282996_2283704_-	hypothetical protein	Q6JII4	Burkholderia_virus	3.2e-120	91.9
WP_085517267.1\|2283977_2284790_-	prohibitin family protein	Q8W6Q7	Burkholderia_virus	6.3e-144	97.8
WP_009910640.1\|2284786_2284936_-	hypothetical protein	Q8W6Q6	Burkholderia_virus	3.1e-17	91.8
WP_145956463.1\|2285132_2285732_+	hypothetical protein	A4JX33	Burkholderia_virus	6.8e-63	70.1
WP_085517271.1\|2285909_2286125_-	hypothetical protein	Q6JIH9	Burkholderia_virus	2.8e-27	76.1
WP_045601918.1\|2286169_2286445_-	hypothetical protein	A1YZS4	Burkholderia_virus	1.2e-30	69.8
WP_085517403.1\|2286472_2286655_-	hypothetical protein	NA	NA	NA	NA
WP_085517273.1\|2286677_2286797_-	hypothetical protein	Q8W6Q2	Burkholderia_virus	3.6e-08	81.6
WP_085517275.1\|2286807_2287074_-	hypothetical protein	Q8W6Q1	Burkholderia_virus	8.3e-37	90.6
WP_009901181.1\|2287799_2288192_-	hypothetical protein	Q8W6P8	Burkholderia_virus	6.9e-64	94.6
WP_009901180.1\|2288277_2288520_+	Cro/Cl family transcriptional regulator	C7BGF8	Burkholderia_phage	5.4e-27	71.4
WP_019254602.1\|2288644_2288977_+	hypothetical protein	Q6JIG8	Burkholderia_virus	5.3e-49	88.2
WP_085517277.1\|2288973_2289192_-	hypothetical protein	Q6JIG7	Burkholderia_virus	1.4e-29	90.3
WP_019254600.1\|2289406_2289847_+	hypothetical protein	Q6JIG6	Burkholderia_virus	3.2e-78	98.6
WP_085517404.1\|2289852_2290686_+	DNA adenine methylase	A0A0K1LM14	Caulobacter_phage	4.9e-75	52.6
WP_085517279.1\|2290682_2292080_+	DNA cytosine methyltransferase	Q6JIG4	Burkholderia_virus	4.9e-213	82.4
WP_085517281.1\|2292090_2292912_+	hypothetical protein	Q8W6P2	Burkholderia_virus	6.4e-144	97.8
WP_085517283.1\|2292908_2293169_+	helix-turn-helix domain-containing protein	Q6JIG2	Burkholderia_virus	4.9e-34	86.0
WP_085517406.1\|2293322_2294315_+	helix-turn-helix domain-containing protein	A4JX55	Burkholderia_virus	1.9e-174	98.2
WP_085504503.1\|2294311_2294863_+	DUF1064 domain-containing protein	A4JX56	Burkholderia_virus	6.9e-94	96.2
WP_019254593.1\|2294859_2295234_+	hypothetical protein	Q6JIF8	Burkholderia_virus	4.0e-61	95.2
WP_085517285.1\|2295230_2295647_+	DUF1364 family protein	Q6JIF7	Burkholderia_virus	2.1e-50	70.0
WP_085517289.1\|2295963_2296224_+	hypothetical protein	Q8W6N5	Burkholderia_virus	9.6e-38	83.7
WP_085517291.1\|2296232_2296880_+	hypothetical protein	Q8W6N4	Burkholderia_virus	4.7e-102	89.2
WP_085517293.1\|2297418_2297961_+	hypothetical protein	NA	NA	NA	NA
WP_085962187.1\|2297977_2299211_+\|transposase	IS3-like element ISButh1 family transposase	A0A1B0Z042	Pseudomonas_phage	3.1e-102	65.2
WP_145956462.1\|2299356_2299800_+	hypothetical protein	NA	NA	NA	NA
WP_085517297.1\|2300330_2300855_-	hypothetical protein	NA	NA	NA	NA
WP_004548635.1\|2301121_2301508_-	helix-turn-helix transcriptional regulator	Q8W6N2	Burkholderia_virus	1.4e-64	99.2
WP_059601806.1\|2301504_2301762_-	type II toxin-antitoxin system RelE/ParE family toxin	Q8W6N1	Burkholderia_virus	7.0e-41	98.8
WP_085517298.1\|2302004_2302214_+	HNH endonuclease	NA	NA	NA	NA
WP_029227272.1\|2302333_2302813_+\|terminase	terminase small subunit	Q3HQS6	Burkholderia_phage	9.0e-58	82.1
WP_085517300.1\|2302812_2304486_+\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	3.9e-265	80.6
WP_009901146.1\|2304482_2305796_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	1.0e-204	81.2
WP_009901144.1\|2305776_2306463_+\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	3.7e-121	95.2
WP_085517302.1\|2306465_2307722_+\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	1.1e-214	94.5
WP_038710381.1\|2307784_2308009_+	hypothetical protein	Q6JIM6	Burkholderia_virus	6.1e-25	75.3
WP_029227269.1\|2308012_2308375_+\|head,tail	phage gp6-like head-tail connector protein	Q6JIM5	Burkholderia_virus	1.2e-46	80.0
WP_085517303.1\|2308377_2308707_+\|head	phage head closure protein	Q6JIM4	Burkholderia_virus	1.3e-44	78.9
WP_085517305.1\|2308699_2309122_+	HK97 gp10 family phage protein	Q8W6U1	Burkholderia_virus	8.2e-63	89.3
WP_085517307.1\|2309118_2309466_+	DUF3168 domain-containing protein	Q8W6U0	Burkholderia_virus	3.6e-56	94.8
WP_085517309.1\|2309527_2309986_+\|tail	phage tail protein	Q8W6T9	Burkholderia_virus	7.0e-76	98.0
WP_085517311.1\|2310012_2310477_+\|tail	phage tail protein	Q6JIM0	Burkholderia_virus	3.2e-76	91.6
WP_085517313.1\|2310476_2310761_+	DUF4035 domain-containing protein	Q6JIL9	Burkholderia_virus	1.9e-39	91.5
WP_085517316.1\|2310774_2314839_+\|tail	phage tail tape measure protein	Q6JIL8	Burkholderia_virus	0.0e+00	86.3
2314278:2314294	attR	NA	NA	NA	NA
WP_019254573.1\|2314835_2315174_+\|tail	phage tail protein	Q8W6T5	Burkholderia_virus	1.5e-59	96.4
WP_085504482.1\|2315182_2316571_+\|tail	tail fiber domain-containing protein	Q8W6T4	Burkholderia_virus	1.4e-244	89.4
WP_085517318.1\|2316567_2317251_+\|tail	phage minor tail protein L	Q8W6T3	Burkholderia_virus	5.9e-127	95.2
WP_085504480.1\|2317300_2318053_+	C40 family peptidase	Q6JIL4	Burkholderia_virus	2.3e-140	93.6
WP_085517320.1\|2318049_2318634_+\|tail	tail assembly protein	Q8W6T1	Burkholderia_virus	1.1e-94	93.8
WP_085517321.1\|2318630_2321942_+	host specificity protein J	Q8W6T0	Burkholderia_virus	0.0e+00	93.3
WP_085504760.1\|2321986_2322253_+	hypothetical protein	Q8W6S9	Burkholderia_virus	9.4e-49	97.7
WP_085504477.1\|2322252_2322987_+	hypothetical protein	Q8W6S8	Burkholderia_virus	2.0e-141	96.3
WP_085504476.1\|2323029_2323242_+\|holin	holin	Q8W6S7	Burkholderia_virus	8.6e-29	98.6
WP_085517323.1\|2323234_2323726_+	lysozyme	Q6JIK8	Burkholderia_virus	9.5e-87	96.3
WP_085504474.1\|2323725_2324271_+	lysozyme	Q8W6S5	Burkholderia_virus	4.6e-74	86.7
WP_085517324.1\|2324414_2325203_+	DNA adenine methylase	Q8W6S4	Burkholderia_virus	1.6e-152	97.7
WP_085504759.1\|2325455_2326190_+	hypothetical protein	Q8W6S3	Burkholderia_virus	4.7e-130	99.1
WP_085504472.1\|2326371_2326932_+	PAAR domain-containing protein	A4JX23	Burkholderia_virus	2.8e-103	99.5
WP_085517326.1\|2326928_2327663_+	VRR-NUC domain-containing protein	Q8W6S1	Burkholderia_virus	2.6e-136	98.8
WP_085517328.1\|2328915_2329557_-	hypothetical protein	Q8W6R9	Burkholderia_virus	2.3e-109	90.6
WP_085517330.1\|2329642_2330311_+	DUF159 family protein	Q8W6R8	Burkholderia_virus	8.9e-120	88.7

DBSCAN-SWA_6

2542130 : 2607852

Ralstonia_phage(14.29%)

transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080003069.1\|2542130_2542736_-\|transposase	transposase	NA	NA	NA	NA
WP_004551886.1\|2543403_2543847_+	hypothetical protein	NA	NA	NA	NA
WP_009934666.1\|2544280_2544583_-	hypothetical protein	NA	NA	NA	NA
WP_153260200.1\|2544553_2545408_+	hypothetical protein	NA	NA	NA	NA
WP_009968905.1\|2547103_2547397_-	hypothetical protein	NA	NA	NA	NA
WP_071811479.1\|2547355_2547598_+	hypothetical protein	NA	NA	NA	NA
WP_085517409.1\|2549659_2553628_-	type VI secretion system protein ImpL	NA	NA	NA	NA
WP_028201661.1\|2553639_2554305_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_004536933.1\|2554301_2555699_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_004200965.1\|2555731_2556529_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_004200966.1\|2556538_2556931_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_038719660.1\|2556959_2557715_-	DUF3540 domain-containing protein	NA	NA	NA	NA
WP_004549384.1\|2557711_2558776_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_009981800.1\|2558793_2561427_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_009968887.1\|2561452_2564476_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	7.1e-23	24.8
WP_085517347.1\|2564502_2567640_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	7.2e-79	29.6
WP_004525341.1\|2567626_2568649_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_004525342.1\|2568636_2570379_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_004525343.1\|2570415_2570877_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_004525344.1\|2570869_2571379_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_004528790.1\|2571598_2573098_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_004530571.1\|2573121_2573616_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_071811047.1\|2573875_2575708_+	histidine kinase	NA	NA	NA	NA
WP_009968875.1\|2575704_2576442_+	response regulator transcription factor	NA	NA	NA	NA
WP_085517348.1\|2576438_2578322_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_004184741.1\|2578564_2578942_-	hypothetical protein	NA	NA	NA	NA
WP_085517350.1\|2579021_2580557_-	intracellular motility protein A	B0FIT1	Escherichia_phage	2.5e-08	37.0
WP_076910156.1\|2580579_2581839_-	autotransporter strand-loop-strand O-heptosyltransferase	NA	NA	NA	NA
WP_004206324.1\|2582126_2583152_-	N-acetylmuramoyl-L-alanine amidase	A0A076YN96	Rhizobium_phage	2.4e-07	27.1
WP_004557768.1\|2583253_2583430_+	hypothetical protein	NA	NA	NA	NA
WP_004525356.1\|2584188_2584803_-	SCO family protein	NA	NA	NA	NA
WP_009981785.1\|2584799_2585636_-	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_071811050.1\|2585660_2587223_-	nitrite reductase, copper-containing	NA	NA	NA	NA
WP_004184911.1\|2587629_2588070_-	SRPBCC family protein	NA	NA	NA	NA
WP_004201924.1\|2588115_2588958_-	phosphoenolpyruvate hydrolase family protein	NA	NA	NA	NA
WP_004546897.1\|2588960_2590178_-	UPF0261 family protein	NA	NA	NA	NA
WP_004533248.1\|2590289_2591315_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004525360.1\|2591569_2592424_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.0e-59	47.4
WP_076856926.1\|2592998_2593130_+	hypothetical protein	NA	NA	NA	NA
WP_071811051.1\|2593107_2594013_-	DMT family transporter	NA	NA	NA	NA
WP_004198523.1\|2594098_2594284_-	hypothetical protein	NA	NA	NA	NA
WP_004198526.1\|2595166_2596198_-	Zn-dependent oxidoreductase	NA	NA	NA	NA
WP_004525362.1\|2596246_2597455_-	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	2.5e-43	29.2
WP_011326133.1\|2597476_2598244_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_004525364.1\|2598376_2599846_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	2.4e-45	33.8
WP_076853162.1\|2600146_2601502_+	MFS transporter	NA	NA	NA	NA
WP_004525366.1\|2602106_2602865_+	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_009925808.1\|2603578_2605384_+	phospholipase	NA	NA	NA	NA
WP_004184857.1\|2605845_2606544_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_080495655.1\|2606757_2607852_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018403

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP018402

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection