CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP016800	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-3, complete sequence	0 crisprs	NA	0	0
NZ_CP016797	Lactobacillus brevis strain TMW 1.2112 chromosome, complete genome	2 crisprs	cas2,csn2,DinG,csa3,cas3,DEDDh	9	2
NZ_CP016801	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-4, complete sequence	0 crisprs	NA	0	0
NZ_CP016798	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-1, complete sequence	0 crisprs	NA	0	1
NZ_CP016799	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-2, complete sequence	0 crisprs	NA	0	0
NZ_CP016802	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence	0 crisprs	NA	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016797_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016797_1

10717-10843

Orphan

Consensus_repeat	Method
TTACTTTTGGCTGTGATTGCCCACCCGCTGGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016797_1

>merge|NZ_CP016797|1|10717-10843|CRISPRCasFinder
TTACTTTTGGCTGTGATTGCCCACCCGCTGGTCGTGGCAAATGAGCTGGAACGTAGTATGACGTGGACATATTGGTTAGGGTGCCTGTGTCAATTACTTTTGGCTGTGATTGCCCGCCCGCTGGTCG

>NZ_CP016797|1|1|10717-10843|CRISPRCasFinder
TTACTTTTGGCTGTGATTGCCCACCCGCTGGTCG	TGGCAAATGAGCTGGAACGTAGTATGACGTGGACATATTGGTTAGGGTGCCTGTGTCAA
TTACTTTTGGCTGTGATTGCCCGCCCGCTGGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016797.1\|WP_085762599.1\|13924_15532_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP016797.1\|WP_052471865.1\|20425_21055_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP016797.1\|WP_156646765.1\|121_1471_+\|chromosomal-replication-initiator-protein-DnaA	unknown	unknown	gnl\|CDD\|273037
NZ_CP016797.1\|WP_011666824.1\|12324_12561_+\|30S-ribosomal-protein-S18	unknown	unknown	gnl\|CDD\|178997
NZ_CP016797.1\|WP_085762598.1\|9238_10501_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP016797.1\|WP_024526042.1\|1740_2880_+\|DNA-polymerase-III-subunit-beta	unknown	unknown	gnl\|CDD\|235541
NZ_CP016797.1\|WP_085762597.1\|3526_4681_+\|DNA-replication/repair-protein-RecF	unknown	unknown	gnl\|CDD\|234608
NZ_CP016797.1\|WP_011666818.1\|3299_3527_+\|S4-domain-containing-protein-YaaA	unknown	unknown	gnl\|CDD\|274378
NZ_CP016797.1\|WP_011666821.1\|6649_9184_+\|DNA-gyrase-subunit-A	unknown	unknown	gnl\|CDD\|235502
NZ_CP016797.1\|WP_085762600.1\|16140_16917_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	unknown
NZ_CP016797.1\|WP_021741384.1\|4684_6628_+\|DNA-topoisomerase-(ATP-hydrolyzing)-subunit-B	unknown	unknown	gnl\|CDD\|235542
NZ_CP016797.1\|WP_085763713.1\|21135_21846_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP016797.1\|WP_080769713.1\|22102_24118_+\|DHH-family-phosphoesterase	unknown	unknown	gnl\|CDD\|226404
NZ_CP016797.1\|WP_011666822.1\|11399_11696_+\|30S-ribosomal-protein-S6	unknown	unknown	gnl\|CDD\|179034
NZ_CP016797.1\|WP_085768298.1\|12706_13894_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP016797.1\|WP_085762602.1\|18268_19870_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP016797.1\|WP_011666823.1\|11729_12296_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180915

Protein	Function_ID	Function_description	E-value
NZ_CP016797.1\|WP_085762599.1\|13924_15532_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	6.8719e-165
NZ_CP016797.1\|WP_052471865.1\|20425_21055_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.63041e-10
NZ_CP016797.1\|WP_156646765.1\|121_1471_+\|chromosomal-replication-initiator-protein-DnaA	gnl\|CDD\|273037	TIGR00362, DnaA, chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006). [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP016797.1\|WP_011666824.1\|12324_12561_+\|30S-ribosomal-protein-S18	gnl\|CDD\|178997	PRK00391, rpsR, 30S ribosomal protein S18; Reviewed.	1.12666e-36
NZ_CP016797.1\|WP_085762598.1\|9238_10501_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	8.09545e-59
NZ_CP016797.1\|WP_024526042.1\|1740_2880_+\|DNA-polymerase-III-subunit-beta	gnl\|CDD\|235541	PRK05643, PRK05643, DNA polymerase III subunit beta; Validated.	1.36694e-150
NZ_CP016797.1\|WP_085762597.1\|3526_4681_+\|DNA-replication/repair-protein-RecF	gnl\|CDD\|234608	PRK00064, recF, recombination protein F; Reviewed.	3.6394e-163
NZ_CP016797.1\|WP_011666818.1\|3299_3527_+\|S4-domain-containing-protein-YaaA	gnl\|CDD\|274378	TIGR02988, YaaA_near_RecF, S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage. [DNA metabolism, DNA replication, recombination, and repair].	4.94751e-31
NZ_CP016797.1\|WP_011666821.1\|6649_9184_+\|DNA-gyrase-subunit-A	gnl\|CDD\|235502	PRK05560, PRK05560, DNA gyrase subunit A; Validated.	0
NZ_CP016797.1\|WP_021741384.1\|4684_6628_+\|DNA-topoisomerase-(ATP-hydrolyzing)-subunit-B	gnl\|CDD\|235542	PRK05644, gyrB, DNA gyrase subunit B; Validated.	0
NZ_CP016797.1\|WP_085763713.1\|21135_21846_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.75515e-14
NZ_CP016797.1\|WP_080769713.1\|22102_24118_+\|DHH-family-phosphoesterase	gnl\|CDD\|226404	COG3887, COG3887, Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms].	0
NZ_CP016797.1\|WP_011666822.1\|11399_11696_+\|30S-ribosomal-protein-S6	gnl\|CDD\|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	3.24472e-37
NZ_CP016797.1\|WP_085768298.1\|12706_13894_-\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	6.9907e-103
NZ_CP016797.1\|WP_085762602.1\|18268_19870_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	3.37182e-175
NZ_CP016797.1\|WP_011666823.1\|11729_12296_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	7.3001e-60

>NZ_CP016797.1|WP_085762598.1|9238_10501_-|ISL3-family-transposase
MSQDQSTRLLLQIKDKNITHLRVSDTKRDALRVYGTLSYKLNVCPYCAQRQVVCNGHKTAYVRLPNVSERTVILILRKQRFRCKVCGKTSIAQTPVVRRQHQISENTRHAIDKSLIEDRTMKSIADQYNVSTNFVSRRILALSKQTMPAYDGLPQTLCIDEFRSTSNQMSFITIDGQKHDIITILPSRQTNEIKQFFLNHYSLKNREQVTQVVMDLNAQYQTVIRYLFPNAKLIVDNFHLVQMTLRALNQTRVQLMKRYHPDTPEYRVLKPYWRLYLMNYGALEKSQPQWFSHLRNRLTQEQLIWSGLNLSHEFENTYFTAHKLVEAFRNRDYAAFTSTLDEVENVSPQLFTTIKTFIKNRKLIQNMTSSTLSNGPIEGVNRKIKQIKRTAYGYRNWKNFVFRIQIEFKIRVKKRNPVRK
>NZ_CP016797.1|WP_011666821.1|6649_9184_+|DNA-gyrase-subunit-A
MADQDYLGRVTDVDLSQTMRTSFLDYAMSVIVQRALPDVRDGLKPVHRRILYDMHELGITPDKPFRKSARMVGDVLGKYHPHGDSAVYESMVRMAQDFSYRYMLVDGHGNFGSVDGDGAAAMRYTEARLSKIAMEMLRDINKDTIDFQDNYDGSEREPVVLPSRFPNLLVNGASGIAVGMATNIPPHNLTEVISALHILMKNPDASLADLMEALPGPDFPTGGIVMGKAAIRRAYETGKGTITLRAKVDIEEEKNGKQRIVATEIPYMVNKAKLIERIAELARDKRIEGITDVNDETDRTGMRIVIDVRRDASAEVILNNLYKMTLMQTSFGINMLAIVNGAPKVLGLKAILQYYLEFQLEVIRRRTEFDLRKAEARAHILEGLRIALDHIDEIITIIRQSQTADVAKQELITRFSLSDKQSQAILDMRLVRLTGLEREKVEKEYADVMANIKDYKEILASKERQQAIIYEELLEIQNKFGDDRRTELMVGEVLSLEDEDLIAEEDVVVSLTHNGYIKRLPTSEFKAQNRGGKGVQGMGVHDDDFIEHLVATSTHDMLLFFTNTGKVYRMKGYEIPEYGRTAKGIPVINLLGINNNEHVQAVINVANPGENDNRDLFFTTVQGTVKRTPVDEFANIRSNGLKAINLKEDDELIDVDIINADANMIIGTHLGYAVSFAATDVRSMGRSATGVRGIRLREHDYVIGASVLKPDSKVFVISEKGYGKQTAAAEYPIKGRGGKGIKTVNVSTKNGPLAGLTTLDGDEDIMLVTNKGVMIRFSASDVSETGRATLGVHLIRLADDTAVATMAKVAKEDETADEAPVVDGETPATTDGPVVPESDDPTEA
>NZ_CP016797.1|WP_021741384.1|4684_6628_+|DNA-topoisomerase-(ATP-hydrolyzing)-subunit-B
MADEKETKAQQAREYDASQIQVLEGLEAVRKRPGMYIGSTSSQGLHHLVWEIVDNGIDEALAGFADEIHVTVNQDNSITVTDNGRGIPVDIQKKTGKPALETVYTILHAGGKFGGGGYKVSGGLHGVGASVVNALSTDLEVQVIRGGKKYAIAFDHGHVKTPMHVIEEGLPQDQHGTIVHFLPDPDIFRETTVFDIKTLTTRIRELAFLNKGLRITIRDERPEKPTEEDFLYEGGIRHYVDYLNENKETLFEPPIYVEGQENGITVEVALQYTDDYHNNLLTFTNNIHTYEGGTHEEGFKRALTRVVNDYARQNKLMKDNEANLTGDDVREGLTAVVSVKHPDPQFEGQTKTKLGNSDARTAVDHTFADHFMRFMMEHPDVARKIVDKGTLASKARVAAKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAILPIRGKILNVEKASMDRILANEEIRSLFTAMGTGFGNDFDVSKANYHKLILMTDADVDGAHIRTLLLTLVYRYMRPLLDAGFVYIACPPLYRVRQGKMQRYLDSDEELKDLLGQLPPSPKPQIQRYKGLGEMDAEQLWETTMNPENRRLLRVDAQDAINADQVFTMLMGDKVAPRREFIENNATFAELDV
>NZ_CP016797.1|WP_085762597.1|3526_4681_+|DNA-replication/repair-protein-RecF
MYLQELQLQQFRNYPTAKLTFGQGINVLLGENAQGKTNLLEAIYVLALTRSHRTANDHDLVNWQAKTAKVSGRVVKAAGAVPLELTFSRQGKRARVNHLEQARLSQYVGQLNVILFAPEDLAIVKGAPTVRRRFMDMEFGQMNPRYLYNLSQYRTLLKQRNRYLKDLQHKQNKNLLFLSVLSDQLAAFGAEIIAQRLAMLQKLEHWAQAIHGEISQQREELTFHYATQVADDQLTDVPTITAALSALYAKQQDKELYQGTTLVGPHRDDLHFQVNGKNVQTFGSQGQQRTTALSVKLAEIDLMKEETGEYPVLLLDDVLSELDDARQTHLLTAIQDKVQTFITTTSLSGITRQLIKDPTIFHVAEGTVVADAVDSDDPAASKED
>NZ_CP016797.1|WP_011666818.1|3299_3527_+|S4-domain-containing-protein-YaaA
MKKEVLIETPYITLGQLLKEESVISTGGQAKWYLQENTVNINDEPDNRRGRKLYPGDTVAVPEAGLFFIRSKQGE
>NZ_CP016797.1|WP_024526042.1|1740_2880_+|DNA-polymerase-III-subunit-beta
MKFTINRAAFIKELNNVSRAISSKTTIPILTGLKIVASDAGLLLTGSNADISIETLIRADNPDVGLTIDEPGSIVLTARFFSEIVKRLPEKEMTVEVKDGFQTEITSGAAAFNINGQDANNYPHLPEIDAADSVVLSGAVFKELISQTVIAVSNQESRPILTGIHFVLNDNQFLAVATDSHRLSQRQIELPTPSEASFDVIIPGKSLTELSRMIGDDDADVKMQFSENQVLFLLGDTSFYSRLLEGNYPDTSRLIPKESSTTVEFEAPELLAAVERASLLSHESRNNVVKLTLTPTDHQVTIFSNSPDVGNVEEELAPKEIGGEPLEISFNPDYMKDALHSFGQATIRVAFTSALRPFTLVPTEDTSNFIQLITPVRTF
>NZ_CP016797.1|WP_156646765.1|121_1471_+|chromosomal-replication-initiator-protein-DnaA
MLTLWTDIKALFEENNSKTAYATWIETAKPIALDGNKLTLELPSPLHRDYWTHQHLDQQLVEYAYQAAHEDIQPVLILENERQQQATLKAKTAPVAAGEPVEPTPTFMKETALNSRYTFDTFVIGKGNQMAHAAALVVSEEPGVMYNPLFFYGGVGLGKTHLMHAIGNKMLEDRPDTKVKYVTSEAFTNDFINAIQTRTQEQFRQEYRNVDLLLVDDIQFFANKEGTQEEFFHTFNALYDDGKQIVLTSDRLPNEIPKLQDRLVSRFAWGLSVDITPPDLETRIAILRNKADADQIDIPDDTLSYIAGQIDSNVRELEGALARVQAYSQLMHQPIATDLAAEALKSLNLANASDAVTIPVIQDRVAKYFDVSLKDLKGKKRKKAIVMPRQIAMYLSRELTEASLPRIGNEFGGKDHTTVIHAYDKITESLKTDPQLQKDIDSLKDDLRR
>NZ_CP016797.1|WP_011666822.1|11399_11696_+|30S-ribosomal-protein-S6
METTKYEITYIIRPDLDDAAKTALVERFDKILTDNGAELINSKDWSKRRFAYEIGGFNEGIYHVITLNATDDKGLNEFDRLAKINDSILRHMIVKRED
>NZ_CP016797.1|WP_011666823.1|11729_12296_+|single-stranded-DNA-binding-protein
MINRVVLTGRLTRDVDLRYTQGGAAVATFTLAVDRRFTNQQGEREADFVSCVIWRKSAENFANFFHKGSLVGIEGRIQTRNYENQQGQRVYVTEVVVENFSFLEPRSRNENNGGGNYNGGSMNNNAPQNQNQNANPYTSGNPAPAAPSQGMAPNSGSNNQNSNANNNAADPFANSGDSIDISDDDLPF
>NZ_CP016797.1|WP_011666824.1|12324_12561_+|30S-ribosomal-protein-S18
MAGQRRGGRRRRKVDFIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRSRIMGLMPFVSEE
>NZ_CP016797.1|WP_085768298.1|12706_13894_-|amidohydrolase-family-protein
MTQTTFFNFTLFDGATDHNQPAAWFTVDDNTGRLTARGHGTPETTDHQVDLHEHYVMPGFFNVHTHVTLDPQSFSGDSGQSEAEAGVFAFENLQTLLKSGVTYVRELGTNYDVDVKLKRLQQRGLLPHTPHLLASGRAFSMTGGHGDSPHGGHAVDSPDEMRKAVRTAFKHGVETIKVMATGGVMTPNDFMEDPQLSVAEMRVAVEEAHHKRRLVAAHAEGNPGIQNALDAGVDSIEHGFYVTETEAKQMVAQGTYLTPTLIAEWTIPEFGKGQLPDWEVKKAADALDDTYVNLRRAYQLGVKFTCGTDAGTPFNGFDLTPAEFGLLTKLGMTPAQAYQCSSLNSAALLGVADDYGTLEVGKFADFQVLSADPLADTANVQQTDKHVYLSGKREF
>NZ_CP016797.1|WP_085762599.1|13924_15532_-|peptide-ABC-transporter-substrate-binding-protein
MKHFVWTLPVGLLLLASLSGCGHAAGHTTNKNRPLNVTLASEPATADPNKSTDTNSGSLIFQTMEGLYTYNRNGKITAGVATKMVKPTNNGKTYTFTLKKQAKWANGQRVTAQDFVTSLQRMANPKTKAQYASVLSAFKNFTAVQTGKVAPSKLGVKALSSTKLQFQLTKAVPYFNDLIASEYYPLNTAAVKKYGAQYGTSAAKTVSNGAYKLVGWTGSNASWSYVKNRHYWNADSVKINRVKVAVTKDESTAANLFNADKVQETTVTGNYVRANRNSKNLHTHLTGRLQYLYINSKKTATNSTNLRQAISDAINRSQLTKSVLQDGSKAALSAVPTGDQKNPQTGQDMAAQVGNLLPQDKQQAKTYWQKYLKETGQTKATLNLLTDDTDDDKKVGTYLQSELEKTLPGLTITTTAIPHAQHVARDFAGNFELNLTGWSTSWLDAADFLSLAAKGNSVNFTNWSDTTFNQLLTKANSQTGLARYNGLMAADKRLMAVKGYIPLYQPSEAKLISNQVGGLTYTLLHEAKYQYAYWK
>NZ_CP016797.1|WP_085762600.1|16140_16917_+|D-alanyl-D-alanine-carboxypeptidase
MKKVVMGSLVLGAVMGGLAVVQMPQHAQAATYQVKKLMGFRHPTSYYAKSAKSGYLWNKSHTKRLHNLKNYPKTTWYATAKYSMKSVRNSGTYLKVINGTGKAEGYVWTGYLKKGVNPANPNGTLTDPFGAAMSTYNVDDNLNKQLVALFPGTIPDEPLQLAADFIFANAGANPDDYTSVIEELVGAENEPSVFRLSSDKRIQKNQNFLSFQRNSLKEELVTKHKKFTSFKGYRIGAYAFPKHDKRYGESMILLLPSN
>NZ_CP016797.1|WP_085762602.1|18268_19870_-|peptide-ABC-transporter-substrate-binding-protein
MRRFVSLIPITLLLLAGLSACGSKTSANQNKTLNVTLADEPATVDPNKDTDTNSASVIAQTMEGLYTYSKSNKIIPGVATKVVKPTNHGKTYTFTLKKTAKWANGQRVTAQDFVTSLRRMADPTTKAQYASVLSAFKNYNAVQHGKLAPSKLGITALSKTKLQIQLTKAVPYFNDLVASKYYPLNTAAVRKYGSKYGTNAARAMSNGPYKLVGWTGSNSTWRYVKNPHYWNAQNVKIHQIKVAVTKDSTTAANLFNAGKIQETTVSGEYVRANGNSKQLHTHLLGRMNLLYFNSKRQTTASENLRQAVSYAIDRNQLTNSVLKDGSKAALSAVPRGDQTNPQTGKDMASEVGNLLTYNVSTAKRYWQKYLKEIGKTKVTLSILTDDSDDDKKVGTYLQSVLEKNLPGLTITLTQIPHAQHVSRDFAGNFDINLIGWSTNWLDASDYLDLAAKGNSVNFTNWNDQTYNQILTSAENQSGQARYNGLVKADKYLMRVKGYVPLYQPSEAKLISKQVGGLTYSLLNDAQYQYAYWK
>NZ_CP016797.1|WP_052471865.1|20425_21055_-|TetR/AcrR-family-transcriptional-regulator
MPLVNTVYLDYLRDNLKGVIFMRQDAQYNHQKILTTATHLLSTQDIATMKMTDIAHAAGIGVGTLYRNYPNKSALCLALVYDRLRVFITTTQAQIKQTTPTPATLKAVLTDYLAFRDANQALLNTISEVPQAGQDFYQSPLFQQLTDLFQKLLTPLHPDWSAQTIVFRSDMLVAMLKSEMYAFERQQRGLSNPDLLHELLSLLEVSPAD
>NZ_CP016797.1|WP_085763713.1|21135_21846_+|sulfite-exporter-TauE/SafE-family-protein
MIGVFVSLIGGGGASLYLGVLTSQLGLATAVAVPTSLFVALPALFLGFLTQVRIHNVNFKLGNQLLLTAIPGILAGALLAKYITAMLYNRIVGVILLVMGIIVVVKALRPGKQRDVRQSGWIASLFGLLSGLVVGIGGLSGGATTAAGLAILGLSALQAAGTATYVLWVMSAIGLAIHLITSTVDWSAGMGLMVGAIIGSIGTPLVLHRLNTERLNRWLMPFLGVIISYFGWRMLV
>NZ_CP016797.1|WP_080769713.1|22102_24118_+|DHH-family-phosphoesterase
MNKLFSRANVPEFLQNRRLRGIAMMTAGLAILGIVLAFLLNWIFGIVILILVGVATLMVFNTMAEIGADTTQYISDLSFRIQQGEQEALIRMPPGVMILGDSDQIEWVNPYLQHYFGDTDVLNRSLTAVDGELAKLIADAPAQTMTTVTWRDYRFTLYVQPDFHAVYLYDITHYQLIQEQYDNEKIAIGQIFLDNYDEITQSMTDQDISNLRNYVTNELSTWVQQFDMYLKQLDDDHYFILAYAKSLAAIEADKFKILDTIRESTSKQNFPLTLSMGIAYGDPNLNKLADQAQSNLDLALGRGGDQVVVKAADQEARYYGGKTNPMEKRTRVRARMISQALQELMNESDQIFVQGHSQPDMDSLGACLGIRRIAKMNNKTCWIVLDKETVHSDVQRLLDNLKQYPDIDAAIISPETALEKATDQSMLLMVDHSKPSISISADLYHRLENRVMIIDHHRRGEEFPENPLLVYIEPYASSTCELITEMFEYQSQEGEPINKLEATAMLTGIFVDTKHFSLRTGTRTFDAASYLRSAGADAVEMQQYMKENVDSYLQRNHLIEMVEFVNEDMALIVGEEDQSYDPVTAAQAADDLLNMSGVDASFVVTRRADGRVGISARSLGEINVQLTMEAMGGGGHLSNAATQIADKTVAEVRQQLLDILTHSDEPETATT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016797_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016797_2

217537-218232

TypeII-A

Consensus_repeat	Method
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	PILER-CR
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CRISPRCasFinder
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CRT
TGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	PILER-CR

10 spacers

csn2,cas2,cas1

The CRISPR arrays of NZ_CP016797_2

>merge|NZ_CP016797|2|217537-218232|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCCAAACGCTCCCCAATGAAGAGGCTCTGGGGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCTATGCGGTTGATGGTGTGCTGTCAGTATCGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACTCATTCTTCCCCTCACGCTGATATCGCGTCGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACTTATCGGTGCAACCATTGCCGTCACAACTGGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCCGTGTTTTGCCATTATTGGATAGTCAAATGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACATATTCGCTGTCGACATGCTATCAGGGACTGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCACAATTTGAAAAAGATCTTAACGCGATGTGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCACACAGGAACTTATGGACGCTTACGAGGGGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACATATCGTCCCGGTCTTCCCAGTTGCCATCTGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACATATTCTTCAATCGTATCGGCCCATGCTTTGCTTTAGAATCTTGGTAAATCAATAGGATCAAGAAT

>NZ_CP016797|2|1|217537-217836|PILER-CR
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CCAAACGCTCCCCAATGAAGAGGCTCTGGG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CTATGCGGTTGATGGTGTGCTGTCAGTATC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TCATTCTTCCCCTCACGCTGATATCGCGTC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TTATCGGTGCAACCATTGCCGTCACAACTG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCCGTGTTTTGCCATTATTGGATAGTCAAATGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACATATTCGCTGTCGACATGCTATCAGGGACTGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACAATTTGAAAAAGATCTTAACGCGATG
TGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACACAGGAACTTATGGACGCTTACGAGG
GGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATCGTCCCGGTCTTCCCAGTTGCCATC
TGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATTCTTCAATCGTATCGGCCCATGCTT


>NZ_CP016797|2|2|217537-218232|CRISPRCasFinder
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CCAAACGCTCCCCAATGAAGAGGCTCTGGG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CTATGCGGTTGATGGTGTGCTGTCAGTATC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TCATTCTTCCCCTCACGCTGATATCGCGTC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TTATCGGTGCAACCATTGCCGTCACAACTG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CCGTGTTTTGCCATTATTGGATAGTCAAAT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATTCGCTGTCGACATGCTATCAGGGACT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACAATTTGAAAAAGATCTTAACGCGATGT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACACAGGAACTTATGGACGCTTACGAGGG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATCGTCCCGGTCTTCCCAGTTGCCATCT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATTCTTCAATCGTATCGGCCCATGCTTT
GCTTTAGAATCTTGGTAAATCAATAGGATCAAGAAT

>NZ_CP016797|2|1|217537-218232|CRT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CCAAACGCTCCCCAATGAAGAGGCTCTGGG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CTATGCGGTTGATGGTGTGCTGTCAGTATC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TCATTCTTCCCCTCACGCTGATATCGCGTC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TTATCGGTGCAACCATTGCCGTCACAACTG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CCGTGTTTTGCCATTATTGGATAGTCAAAT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATTCGCTGTCGACATGCTATCAGGGACT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACAATTTGAAAAAGATCTTAACGCGATGT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACACAGGAACTTATGGACGCTTACGAGGG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATCGTCCCGGTCTTCCCAGTTGCCATCT
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATTCTTCAATCGTATCGGCCCATGCTTT
GCTTTAGAATCTTGGTAAATCAATAGGATCAAGAAT

>NZ_CP016797|2|2|217932-218232|PILER-CR
	CCAAACGCTCCCCAATGAAGAGGCTCTGGG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CTATGCGGTTGATGGTGTGCTGTCAGTATC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TCATTCTTCCCCTCACGCTGATATCGCGTC
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	TTATCGGTGCAACCATTGCCGTCACAACTG
GCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACCCGTGTTTTGCCATTATTGGATAGTCAAATGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAACATATTCGCTGTCGACATGCTATCAGGGACTGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACAATTTGAAAAAGATCTTAACGCGATG
TGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	CACACAGGAACTTATGGACGCTTACGAGG
GGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATCGTCCCGGTCTTCCCAGTTGCCATC
TGCTTTAGAATCTTGGTAAATCAATAGGGTTAAGAAC	ATATTCTTCAATCGTATCGGCCCATGCTT
TGCTTTAGAATCTTGGTAAATCAATAGGATCAAGAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016797.1\|WP_021741248.1\|226507_226822_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP016797.1\|WP_191982491.1\|224235_224805_+\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NZ_CP016797.1\|WP_085762705.1\|202744_203395_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016797.1\|WP_065200952.1\|216534_216840_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP016797.1\|WP_011668743.1\|225065_225899_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP016797.1\|WP_085762711.1\|216836_217502_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP016797.1\|WP_065200958.1\|206735_207734_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP016797.1\|WP_085762714.1\|227388_227811_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016797.1\|WP_085762713.1\|225972_226503_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP016797.1\|WP_085762709.1\|209163_210807_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP016797.1\|WP_085762707.1\|207968_208457_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016797.1\|WP_043022289.1\|218886_220266_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340890
NZ_CP016797.1\|WP_043022283.1\|226823_227150_-\|multidrug-resistance-protein-SMR	unknown	unknown	gnl\|CDD\|224987
NZ_CP016797.1\|WP_085762712.1\|221386_223624_+\|glycoside-hydrolase-family-65-protein	unknown	unknown	gnl\|CDD\|224471
NZ_CP016797.1\|WP_043022288.1\|220328_221381_+\|alpha/beta-hydrolase-fold-domain-containing-protein	unknown	unknown	gnl\|CDD\|369561
NZ_CP016797.1\|WP_085762706.1\|203465_205139_-\|alpha-glucosidase	unknown	unknown	gnl\|CDD\|200472
NZ_CP016797.1\|WP_085762710.1\|215651_216557_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP016797.1\|WP_085762708.1\|208443_208974_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016797.1\|WP_024526155.1\|202151_202574_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP016797.1\|WP_024526177.1\|228165_229041_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|366120

Protein	Function_ID	Function_description	E-value
NZ_CP016797.1\|WP_021741248.1\|226507_226822_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	4.18465e-25
NZ_CP016797.1\|WP_065200952.1\|216534_216840_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.90838e-22
NZ_CP016797.1\|WP_011668743.1\|225065_225899_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	9.78691e-35
NZ_CP016797.1\|WP_085762711.1\|216836_217502_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.20021e-61
NZ_CP016797.1\|WP_065200958.1\|206735_207734_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.12578e-88
NZ_CP016797.1\|WP_085762713.1\|225972_226503_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.64177e-18
NZ_CP016797.1\|WP_085762709.1\|209163_210807_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP016797.1\|WP_191982491.1\|224235_224805_+\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	4.83762e-07
NZ_CP016797.1\|WP_043022289.1\|218886_220266_+\|MFS-transporter	gnl\|CDD\|340890	cd17332, MFS_MelB_like, Salmonella enterica Na+/melibiose symporter MelB and similar transporters of the Major Facilitator Superfamily. This family is composed of Salmonella enterica Na+/melibiose symporter MelB, Major Facilitator Superfamily domain-containing proteins, MFSD2 and MFSD12, and other sugar transporters. MelB catalyzes the electrogenic symport of galactosides with Na+, Li+ or H+. The MFSD2 subfamily is composed of two vertebrate members, MFSD2A and MFSD2B. MFSD2A is more commonly called sodium-dependent lysophosphatidylcholine symporter 1 (NLS1). It is an LPC symporter that plays an essential role for blood-brain barrier formation and function. Inactivating mutations in MFSD2A cause a lethal microcephaly syndrome. MFSD2B is a potential risk or protect factor in the prognosis of lung adenocarcinoma. MelB-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.86927e-107
NZ_CP016797.1\|WP_043022283.1\|226823_227150_-\|multidrug-resistance-protein-SMR	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	1.56343e-21
NZ_CP016797.1\|WP_024526155.1\|202151_202574_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	3.44171e-56
NZ_CP016797.1\|WP_043022288.1\|220328_221381_+\|alpha/beta-hydrolase-fold-domain-containing-protein	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.10768e-33
NZ_CP016797.1\|WP_085762706.1\|203465_205139_-\|alpha-glucosidase	gnl\|CDD\|200472	cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins. The sucrose isomerases (SIs) Isomaltulose synthase (EC 5.4.99.11) and Trehalose synthase (EC 5.4.99.16) catalyze the isomerization of sucrose and maltose to produce isomaltulose and trehalulose, respectively. Oligo-1,6-glucosidase (EC 3.2.1.10) hydrolyzes the alpha-1,6-glucosidic linkage of isomaltooligosaccharides, pannose, and dextran. Unlike alpha-1,4-glucosidases (EC 3.2.1.20), it fails to hydrolyze the alpha-1,4-glucosidic bonds of maltosaccharides. Dextran glucosidase (DGase, EC 3.2.1.70) hydrolyzes alpha-1,6-glucosidic linkages at the non-reducing end of panose, isomaltooligosaccharides and dextran to produce alpha-glucose.The common reaction chemistry of the alpha-amylase family enzymes is based on a two-step acid catalytic mechanism that requires two critical carboxylates: one acting as a general acid/base (Glu) and the other as a nucleophile (Asp). Both hydrolysis and transglycosylation proceed via the nucleophilic substitution reaction between the anomeric carbon, C1 and a nucleophile. Both enzymes contain the three catalytic residues (Asp, Glu and Asp) common to the alpha-amylase family as well as two histidine residues which are predicted to be critical to binding the glucose residue adjacent to the scissile bond in the substrates. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP016797.1\|WP_085762710.1\|215651_216557_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	5.91715e-92
NZ_CP016797.1\|WP_085762712.1\|221386_223624_+\|glycoside-hydrolase-family-65-protein	gnl\|CDD\|224471	COG1554, ATH1, Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism].	3.10414e-148
NZ_CP016797.1\|WP_024526177.1\|228165_229041_+\|ROK-family-protein	gnl\|CDD\|366120	pfam00480, ROK, ROK family.	1.47909e-75

>NZ_CP016797.1|WP_085762711.1|216836_217502_+|type-II-A-CRISPR-associated-protein-Csn2
MNLTYYGFRPFKITPGKVVVLATGSPHIYQEIILGLQDRTDTVKLSDDNFTTVTVGKGAQWYGDPLLNVDLNALFKRKLQTRLLKVLADDQTVGLVDGLQSLLSQLLADSYLMDVPLELPETPELAKLIKFSGIQLVPDLRDDVYGILETLVKTLIELNDHRMVVLTNVGHYLQVSQLQSLVRFMANIDLPILLIEFSSTKQSDYFRNCDYHYIDSDFVLW
>NZ_CP016797.1|WP_065200952.1|216534_216840_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPMETSQDRRHYRHFRKALLQEGFFMMQYSVYVRVCPNSAGAAAIEKRIAALAPANGLVQSVMLTEKQYQAMHFIAGQPNQDLLNSAERTVMI
>NZ_CP016797.1|WP_085762710.1|215651_216557_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRTLLISQHAKISLTSGNLVIQTDSDRYHTPVRDINVLLIQSLQVVITTAAVAALAEAHAKIIFTGRDGQPICETAECYPHARTAALVRQQVGWSEGRIENLWTRVVAAKIQNQIAVGNLLEVSTMDLSGELEKLELNDATNREAVVARQYFPLIFGKDFSRSDLVPINAALNYGYSILLSLVNRIIVSRGYLTCFGIHHDNAGNAFNLASDLMEPFRPIIDYWVAQQNILDLTPDVKFGLARLFELEMRYNGKQEVLSNVVEKVIVQCLKYLSEETETIRIEVDVPDEVSNYAINDYV
>NZ_CP016797.1|WP_085762709.1|209163_210807_-|peptide-ABC-transporter-substrate-binding-protein
MQRKGTILTVAALSLLTLAGCGSRSSSSNNSGKYAAKQVLNWTESSELATTDLAQATDTLSFNVLQNTQEGLYRLNSKGTPAKALATSTKVTNGGKTYTFNLRHGVKWSNGDPVTAKDFVYSWQRTVSPKTASQDAFYLYQVKNAEAVNKGKKSLSALGIKATGKYTLTVNLTKPVSYFKKLLAWPLFYPVNQNAVNKYGKKYGTSSSTTVYNGPYRLTKWNGTSKSWTLAKNKTYWDKKAVHLTKINEQVTESTTTSYNLYNAKKVDETLLSGQQIKNNKNSKDFVKRLPTGSQRLDLNEKKVSAFKNVNIRKALSLAINRTQLVNDVLQDGSVASKGFVPSGMGNNPKTGEAFNQEASVKSAVSYNVKQAKTLLAKGLKQAGDKKLNVTLSVSDTDSSKQTAEFIQSSLEKLPNVTVTIKTVPYVQLITQQNNGNYELTLAGWQSVFADPINFLDVFEADSSYNTTGWKNSTYDKLLDEAENVYGNQPEKRWGKLVAAEQVLMKNQGTIPLYQAAKSQLLRSNVKSVVYNPAGVPYDWKTTYIAK
>NZ_CP016797.1|WP_085762708.1|208443_208974_+|hypothetical-protein
MSCIKRSGDTMKKGLKGIVLAAASLGVFAMASSTTANAASKTTLPKSYRGTWYIYGGSDTEDKITAYAVAKLNLTNKKMGYKVYTTTKKQLTSLKWQLSAAFPTIYSKKVNNKKKVTYRVKARIDDSVTLMTLGKTKVNVKVLGKKVTALRLRVDGTNVYAFRKPLRTHALSDITY
>NZ_CP016797.1|WP_085762707.1|207968_208457_+|hypothetical-protein
MRKQLLVGVITGLAAFTLAGMGHETAQAATLPADYQGDWVAYVGKTKHHHVNYYYTARLTLADTSLATQLNVTKNANLSDLTTQVTLQSAVTYQLKTTKKHQVSYKVRMATDNASLGKFSLSKVKVKGQKTTALAFDDGEDDVVYAFRSLNKTHAWGDDVLY
>NZ_CP016797.1|WP_065200958.1|206735_207734_+|LacI-family-DNA-binding-transcriptional-regulator
MAATIKDIAKLAGVSPATVSRVLANKTAFFSADTAAKVQTAATTLGYQKNTAAAELVTQQSHVIAAIVNSTKTNFANHIIEGIQDAAYRQGLNVIILYAGDADPEQQRRALTTVIERPVRGILLLSVDLSADNLTYLQAAQIPYCFLSISFEEDQLPFITSDDWQVGYQGTQALLAQGHRQIGLAAVDSVHAHTGKLRLAGYTQALTEAGITPDPAWIQPGDYSYVAGQAAMRAYGQAPQVTAVLAGSDMAAIGVLNQARDFGLTVPHDLSIMAIDGTELCELVQPQLSSVSQSFYDMGVAGVEQLTTAQQQPPKITPITVVTRESVRFIES
>NZ_CP016797.1|WP_085762706.1|203465_205139_-|alpha-glucosidase
MTKKWWQNAVVYQVYPRSYQDSNGDGIGDLAGLTQRLPYIKRLGADVIWLNPIYKSPDKDNGYDISDYQSIQPAYGTMADFDHLLDSAHRQGLKLLMDLVVNHTSDQHDWFQQSRQSKDNPYADYYIWRDPVDGHEPNNWGSYFSGSAWTFEPKRNQYYLHLFAPGQPDLNWENPQVRQEVWNLMRFWLDKGVDGFRMDVINLISKPAGLPDAPQAPGAAYGDSQPIVSDGPKLNDYLREMNDEVLSHYDVMTVGEMPGSTPEDAITYTGLNANELNMVFQFEHVGLSPNPDARLGKWNAVPVKLTELKDSLSRWQTALDGKGWNSLYWNNHDQPRAVSRFGNDTPEFRERSAKMLATTLHMMQGTPYVYEGEELGMTNVHYTQLDQYEDLESLNAYHELVDDQHIVDQPTMLKYLSHISRDNARTPMHWDDSTNAGFTTGQPWFALNPNYPTINAADQLDQDDSVFNYYRRLIALRHSSDLIVLGSYEELDPEDDQVFAYKRHYQGQTLLVMSNFTDQTVTRDYGQAEASERLIGNYADDQGTTLRPYETKVYVFK
>NZ_CP016797.1|WP_085762705.1|202744_203395_+|hypothetical-protein
MRQFNSQLAGADFVPLGEWTPQPQTLLSAFSWEARDLLVVDDATDEMQIIAQADPAQLLDRLGGTIYSRLNDQLTRALVPRPLPAARYLLLDLAMLSHATPQATVAGLMGLAVVTAKGQAFTSTALPGVVSQAVCWLRETGLTEHQLFQPIGEATLRRLYQQLSHQSAACDQQRRCHTRAEKLTHDTVALLQGQIQTLKLPVSWQLLRAASLEQTI
>NZ_CP016797.1|WP_024526155.1|202151_202574_-|MerR-family-transcriptional-regulator
MSYTIHEVAQKMGISTYSIRYYHDHGMLPFVQRDENNNRVFSDDDLEWLNIIVCLRATGMPVERIQHYLDLVQEGETTVPERYDMMKAQQERTLSEISDLKKHLSTINFKVDHYAQIMESHEPDSFVPSNLREDSADQTA
>NZ_CP016797.1|WP_043022289.1|218886_220266_+|MFS-transporter
MSKMQLWKQRFFYGATDMAGNLIWQIVGLYLLFYYTTVMGISPAFAGTLFFVVRIIDAFDGVVYGFLIDHTHSKFGKARPYFLWFGIPLGILTMLLFFNPSFGGNKVIQLAWVSVVYTLFSLVYSGANTPITAILPSLTKDPDERTNLASARMVMTNIGTAVIGAITLPMVAQLGGKNAEKGWLIWGVIIGIAIIALFLGAFANLREKDDIVAETEDAPEIKGHLSVKDSLKGAAKNKPWLILSASFILLQTFWMMRLQTAVYYLTYVSHQPALVGAFNGLVIVAVIGNISVPFLSKFMKHRNVMILAMVTFAFGELLMAFKNIPLLFIGNVIALVAMGAAFSIAFVMIADTVEYSRSELHIDEPGILSAVPMVGAKLGMGLAGLISGWLLSWGGFNAAAKVQGAKAVTAIATNFIWVPVVLALVIGGILYLWYQLDESKIASAKAAKEAEKKLSEEDA
>NZ_CP016797.1|WP_043022288.1|220328_221381_+|alpha/beta-hydrolase-fold-domain-containing-protein
MLNDTTTKQSLGYSDELRRLQGIGVTDIADGVTSWVKERDPLHTFEPLVWETVAGIEANPQLPTDLFSLRQGTETSGQRDLTTTAMKVEMQQIVAMNRRVRVIRIAREDHLNADKAYIYFHGGAYYGGTPEDVLLALKFVAEQANCVVYNVDYALAPEQPYPAGILDGLAVVAAMTAEYAHISLGGDSAGASIALGVSQLCKSMGICEIASHVLFYPTVIQGSKLTGPLWDDSQITIVPEQRAALHRSYQLFEQLDAIMSGYYVADQAVDLTAPLLSPLLADPTIFHNVTLLVGEYDPFRLQGEAFIKRVGHANGDANYFRYGGISHAFLNFTGNVPAVEDALMTAAKFI
>NZ_CP016797.1|WP_085762712.1|221386_223624_+|glycoside-hydrolase-family-65-protein
MQIRQLGEIMLTLQDYHLTLHDVANHQPAYLETVFSLANGHFGVRANDPITGNPIAGTLINGFYETAPITYGEAGVGYAKAHQTILNLPDFRHINVATTTGHSFTSSERTKVDLDLATGELTEHYTLQTRQGETIAMSVQSVIGQTQTAFWAVNYGFLAGNYAGGLVVNKTIAVPAEAESLPSADPRKTRLAGLPICETTFMAKDLQQYHVKTRQTKQSVTIYLGMLTTPGSLLRQPVDLGDHTTHHLSYEVYVGEMGQQNTIDPALPFPATALTALMTDSRDFWQDVWQRSEVTVGGNDELDLAIHYNLFQLNQAAGRDGRTNIAAKGLSGSGYEGHYFWDTEMYMLPYFIYTNQPMARQLLVYRYQTLPQARQRARALGVDQGALFAWRTINGEEASAYFPAGTAQYHIDADIAYAVGKYYEITRDIDFIKQCGFEMVLETAHFWEAFGSWHQVGTSQRFEFHTVTGPDEYTALVNNNYYTNRLAKHNFELVTYLAQEILKVDPNGLTKFGIDATDIDAFQNLAEHVYLPYNAEQQINAQDDSFLSKPRWPVAQSTPENFPLLLHYHPLTIYRYQVAKQADTLLADYLFPEDLSPEQLQREYHYYEGVTTHDSSLSRSIFSILAARMGDVEKGYRYFMDTAQMDLVNLQKNTADGLHLANLGGSWLALVAGFSGFYVQDEVVHFTNHLPSELTQLTYRMKIAESVLEIKLTATETTVVVISGPIPTYGVSVNGQLISLAKKVR
>NZ_CP016797.1|WP_191982491.1|224235_224805_+|SdpI-family-protein
MLLPDVALSKERVILLVNSVILALAWVRYLFLPKTRPSFGVLGAFTLVYAALLLIQIMVNRRHRGLKISLDLNVVFGSYCLILVLLPLAYANTAIVGHLTGVGIIVSLIGVPMSYVPQNRLLYGIRIPASKNSPAVWQKTNHLAARICFGFGGLIFLLGLLGQAAFVLTMAVGAVVLVVSTSLYARKLS
>NZ_CP016797.1|WP_011668743.1|225065_225899_+|histidine-phosphatase-family-protein
MKLTKVVSLLAVTAGALALVAVPSNAQAKTKKKAAVKPVTIYLTRHGETTGNVMGRVQGWSDFPLTSNGIAVANNLGRGLKGKTFKVAYAGNLTRQQVTAKQALKYSGNKKVKVNVSKYLREGGYGSFEGDSIAADNALIAGVYGFKSGDEMMAKQGKDYWNLLQDAYYKLDQENSQKTNLVASDRAESSKQVQKRMAKELLTIAKATQKRGGGNALVVSSGMSINEYLSTMAGSKYTGAPLKNAAVTKLVYKHGKLAVSGPIGSMTYVDKGAKLAK
>NZ_CP016797.1|WP_085762713.1|225972_226503_+|GNAT-family-N-acetyltransferase
MAVRLKPLASEEVAAFWQLAFRDPQAEWTQWNGPYFHDHVPTYAEFVTGPGHEDYVDQPWRQVIWVDGQMVGMVSAYYDDAPLNRWLDVGIIIYDQHRWQRGIGRTTLSQWIDWLWTQTPLPHIGLTTWSGNQRMCHLAESLGLREEARVRQVRYWQGRYWDSVKYGVLREEWHKR
>NZ_CP016797.1|WP_021741248.1|226507_226822_-|multidrug-efflux-SMR-transporter
MAWLFLIGAGLSEMLGVTFMNWALHRKTWWLWVLMILAFTLSFGGLELALKTLPMGTAYAIWTGIGAAGGVLTGMLFFGESKDWRKLVWVAVILSATLGLKLIS
>NZ_CP016797.1|WP_043022283.1|226823_227150_-|multidrug-resistance-protein-SMR
MWRHWLTVVLGAVFEVSWVVGFKHATTLWAWLITGVAVYLSFYFLIRASRSIPAGTAYAVFVGLGTLGTTSVGMFVFGEPISWLKIALILLLLAGIGGLQWTTTKEAN
>NZ_CP016797.1|WP_085762714.1|227388_227811_-|hypothetical-protein
MQRKYRDYFAYLKTINPDPNASFIAVSPSNVQKTDPDKFATLTARAGRRWGVILFHALYGNKTTKKTKVPYAVVHEDSFARDWDGIDRAEFDEDVAILVQCQMLQVKEVQGLTRLIMRYPEPLASLADLRIKGIDQINPG
>NZ_CP016797.1|WP_024526177.1|228165_229041_+|ROK-family-protein
MQLGSIEAGGTKFVCAIGNEDYRTQDKVRIPTTTPEETLSQTIAYFKQFPDLKAIAISSFGPIELRHNSPKYGYITNTPKVGWANTDFVGRLKQELDVPMYWTSDVNGSAYGEYVMSTLFNENINSLVYFTIGTGVGAGAIIDGHFVGSLGHPEMGHVRLKRHPDDLDFPGICPFHGDCLEGLVSGPTFDARLGKPGKDVPLTDHVWDILAYYVAQAALQVTLMMRPDKIVFGGGVVSEAFLDKVRHEFDQLLNHYVDVGKLTDYIVMPAVKDNGSATLGDFALALNEYNK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016797_2	2.2\|217639\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217639-217668	30	MN830254	Lactobacillus phage JNU_P2, complete genome	3717-3746	1	0.967
NZ_CP016797_2	2.2\|217639\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217639-217668	30	MN830255	Lactobacillus phage JNU_P4, complete genome	39261-39290	1	0.967
NZ_CP016797_2	2.10\|218167\|30\|NZ_CP016797\|CRISPRCasFinder,CRT	218167-218196	30	MK504446	Lactobacillus phage SAC12B, complete genome	117378-117407	1	0.967
NZ_CP016797_2	2.10\|218167\|30\|NZ_CP016797\|CRISPRCasFinder,CRT	218167-218196	30	MN830254	Lactobacillus phage JNU_P2, complete genome	43134-43163	1	0.967
NZ_CP016797_2	2.10\|218167\|30\|NZ_CP016797\|CRISPRCasFinder,CRT	218167-218196	30	MN830255	Lactobacillus phage JNU_P4, complete genome	29657-29686	1	0.967
NZ_CP016797_2	2.14\|218167\|29\|NZ_CP016797\|PILER-CR	218167-218195	29	MK504446	Lactobacillus phage SAC12B, complete genome	117379-117407	1	0.966
NZ_CP016797_2	2.14\|218167\|29\|NZ_CP016797\|PILER-CR	218167-218195	29	MN830254	Lactobacillus phage JNU_P2, complete genome	43135-43163	1	0.966
NZ_CP016797_2	2.14\|218167\|29\|NZ_CP016797\|PILER-CR	218167-218195	29	MN830255	Lactobacillus phage JNU_P4, complete genome	29658-29686	1	0.966
NZ_CP016797_2	2.11\|217969\|29\|NZ_CP016797\|PILER-CR	217969-217997	29	NC_013384	Staphylococcus epidermidis plasmid SAP110B, complete sequence	356-384	5	0.828
NZ_CP016797_2	2.1\|217573\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217573-217602	30	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	646916-646945	6	0.8
NZ_CP016797_2	2.7\|217969\|30\|NZ_CP016797\|CRISPRCasFinder,CRT	217969-217998	30	NC_013384	Staphylococcus epidermidis plasmid SAP110B, complete sequence	356-385	6	0.8
NZ_CP016797_2	2.4\|217771\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217771-217800	30	NZ_CP042264	Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence	165551-165580	7	0.767
NZ_CP016797_2	2.7\|217969\|30\|NZ_CP016797\|CRISPRCasFinder,CRT	217969-217998	30	NC_004528	Leuconostoc citreum pLC22R plasmid, complete genome	2593-2622	7	0.767
NZ_CP016797_2	2.13\|218101\|29\|NZ_CP016797\|PILER-CR	218101-218129	29	NC_047962	Xanthomonas phage Carpasina, complete genome	9907-9935	7	0.759
NZ_CP016797_2	2.1\|217573\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217573-217602	30	NZ_CP041766	Tomitella sp. HY188 plasmid unnamed, complete sequence	18561-18590	8	0.733
NZ_CP016797_2	2.4\|217771\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217771-217800	30	NZ_CP042264	Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence	166487-166516	8	0.733
NZ_CP016797_2	2.4\|217771\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217771-217800	30	MG969414	UNVERIFIED: Salmonella phage GE_vB_NS7, complete genome	44307-44336	8	0.733
NZ_CP016797_2	2.4\|217771\|30\|NZ_CP016797\|PILER-CR,CRISPRCasFinder,CRT	217771-217800	30	MK574078	Pseudomonas phage KP1, complete sequence	37487-37516	8	0.733
NZ_CP016797_2	2.9\|218101\|30\|NZ_CP016797\|CRISPRCasFinder,CRT	218101-218130	30	NC_047962	Xanthomonas phage Carpasina, complete genome	9906-9935	8	0.733
NZ_CP016797_2	2.11\|217969\|29\|NZ_CP016797\|PILER-CR	217969-217997	29	NC_004528	Leuconostoc citreum pLC22R plasmid, complete genome	2594-2622	9	0.69

1. spacer 2.2|217639|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 1, identity: 0.967

ctatgcggttgatggtgtgctgtcagtatc	CRISPR spacer
ctatgcggttgatggtgtgttgtcagtatc	Protospacer
*******************.**********

2. spacer 2.2|217639|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 1, identity: 0.967

ctatgcggttgatggtgtgctgtcagtatc	CRISPR spacer
ctatgcggttgatggtgtgttgtcagtatc	Protospacer
*******************.**********

3. spacer 2.10|218167|30|NZ_CP016797|CRISPRCasFinder,CRT matches to MK504446 (Lactobacillus phage SAC12B, complete genome) position: , mismatch: 1, identity: 0.967

atattcttcaatcgtatcggcccatgcttt	CRISPR spacer
atattcttcaatcgtatcggcccttgcttt	Protospacer
*********************** ******

4. spacer 2.10|218167|30|NZ_CP016797|CRISPRCasFinder,CRT matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 1, identity: 0.967

atattcttcaatcgtatcggcccatgcttt	CRISPR spacer
atattcttcaatcgtatcggcccatacttt	Protospacer
*************************.****

5. spacer 2.10|218167|30|NZ_CP016797|CRISPRCasFinder,CRT matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 1, identity: 0.967

atattcttcaatcgtatcggcccatgcttt	CRISPR spacer
atattcttcaatcgtatcggcccatacttt	Protospacer
*************************.****

6. spacer 2.14|218167|29|NZ_CP016797|PILER-CR matches to MK504446 (Lactobacillus phage SAC12B, complete genome) position: , mismatch: 1, identity: 0.966

atattcttcaatcgtatcggcccatgctt	CRISPR spacer
atattcttcaatcgtatcggcccttgctt	Protospacer
*********************** *****

7. spacer 2.14|218167|29|NZ_CP016797|PILER-CR matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 1, identity: 0.966

atattcttcaatcgtatcggcccatgctt	CRISPR spacer
atattcttcaatcgtatcggcccatactt	Protospacer
*************************.***

8. spacer 2.14|218167|29|NZ_CP016797|PILER-CR matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 1, identity: 0.966

atattcttcaatcgtatcggcccatgctt	CRISPR spacer
atattcttcaatcgtatcggcccatactt	Protospacer
*************************.***

9. spacer 2.11|217969|29|NZ_CP016797|PILER-CR matches to NC_013384 (Staphylococcus epidermidis plasmid SAP110B, complete sequence) position: , mismatch: 5, identity: 0.828

cacaatttgaaaaagatcttaacgcgatg	CRISPR spacer
cacaattagaaaaagatcttaaagagctt	Protospacer
******* ************** * * *

10. spacer 2.1|217573|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.8

ccaaacgctccccaatgaagaggctctggg	CRISPR spacer
tcaatttctcccgaaggaagaggctctggg	Protospacer
.*** . ***** ** **************

11. spacer 2.7|217969|30|NZ_CP016797|CRISPRCasFinder,CRT matches to NC_013384 (Staphylococcus epidermidis plasmid SAP110B, complete sequence) position: , mismatch: 6, identity: 0.8

cacaatttgaaaaagatcttaacgcgatgt	CRISPR spacer
cacaattagaaaaagatcttaaagagcttc	Protospacer
******* ************** * * * .

12. spacer 2.4|217771|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042264 (Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

ttatcggtgcaaccattgccgtcacaactg	CRISPR spacer
gtatcggtgccgccattgccgtcatcgatg	Protospacer
 ********* .************. . **

13. spacer 2.7|217969|30|NZ_CP016797|CRISPRCasFinder,CRT matches to NC_004528 (Leuconostoc citreum pLC22R plasmid, complete genome) position: , mismatch: 7, identity: 0.767

cacaatttgaaaaagatctta---acgcgatgt	CRISPR spacer
cacaatttgaaaaagatattacacgagcaa---	Protospacer
***************** ***   . **.*

14. spacer 2.13|218101|29|NZ_CP016797|PILER-CR matches to NC_047962 (Xanthomonas phage Carpasina, complete genome) position: , mismatch: 7, identity: 0.759

atatcgtcccggtcttcccagttgccatc	CRISPR spacer
acgatttcctggtcttcccagttgccaac	Protospacer
*.. . ***.***************** *

15. spacer 2.1|217573|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP041766 (Tomitella sp. HY188 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ccaaacgctccccaatgaagaggctctggg	CRISPR spacer
ggttccgctccccgatgaagaggttctgcg	Protospacer
     ********.*********.**** *

16. spacer 2.4|217771|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042264 (Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

ttatcggtgcaaccattgccgtcacaactg	CRISPR spacer
atatcggtgccgccattgccgtcatcgacg	Protospacer
 ********* .************. . .*

17. spacer 2.4|217771|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to MG969414 (UNVERIFIED: Salmonella phage GE_vB_NS7, complete genome) position: , mismatch: 8, identity: 0.733

ttatcggtgcaaccattgccgtcacaactg	CRISPR spacer
ctccaagtgcaaccattgctttcacaactc	Protospacer
.* . .*************. ********

18. spacer 2.4|217771|30|NZ_CP016797|PILER-CR,CRISPRCasFinder,CRT matches to MK574078 (Pseudomonas phage KP1, complete sequence) position: , mismatch: 8, identity: 0.733

ttatcggtgcaaccattgccgtcacaactg	CRISPR spacer
aaattattgcaactattgccgtcacaacga	Protospacer
  **.. ******.************** .

19. spacer 2.9|218101|30|NZ_CP016797|CRISPRCasFinder,CRT matches to NC_047962 (Xanthomonas phage Carpasina, complete genome) position: , mismatch: 8, identity: 0.733

atatcgtcccggtcttcccagttgccatct	CRISPR spacer
acgatttcctggtcttcccagttgccaacc	Protospacer
*.. . ***.***************** *.

20. spacer 2.11|217969|29|NZ_CP016797|PILER-CR matches to NC_004528 (Leuconostoc citreum pLC22R plasmid, complete genome) position: , mismatch: 9, identity: 0.69

cacaatttgaaaaagatcttaacgcgatg	CRISPR spacer
cacaatttgaaaaagatattacacgagca	Protospacer
***************** ***    ....

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

873044 : 926280

Lactobacillus_phage(83.67%)

tail,terminase,protease,plate,capsid,transposase,integrase

attL 868683:868701|attR 876915:876933

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
868683:868701	attL	NA	NA	NA	NA
WP_191981936.1\|873044_874244_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	1.3e-142	64.1
WP_085763003.1\|874675_875557_-	type II toxin-antitoxin system PemK/MazF family toxin	Q4ZE81	Staphylococcus_phage	4.1e-16	36.6
WP_085763004.1\|875675_876059_-	hypothetical protein	NA	NA	NA	NA
WP_085763005.1\|876112_876436_-	hypothetical protein	NA	NA	NA	NA
WP_155275714.1\|876546_876717_+	hypothetical protein	NA	NA	NA	NA
WP_052415627.1\|876728_877364_-	DUF4145 domain-containing protein	A0A1X9I6S1	Streptococcus_phage	8.7e-24	33.2
876915:876933	attR	NA	NA	NA	NA
WP_085763729.1\|877374_877761_-	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	1.3e-67	94.5
WP_085763006.1\|877789_878170_-	helix-turn-helix domain-containing protein	D6PSS9	Lactobacillus_phage	1.3e-22	53.1
WP_047021620.1\|878310_878538_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085763007.1\|878807_878993_+	hypothetical protein	NA	NA	NA	NA
WP_085763008.1\|878981_879230_-	hypothetical protein	NA	NA	NA	NA
WP_157128259.1\|879386_879551_+	hypothetical protein	NA	NA	NA	NA
WP_085763009.1\|879611_880121_+	helix-turn-helix domain-containing protein	D6PST4	Lactobacillus_phage	1.3e-41	53.8
WP_085763010.1\|880125_880401_+	hypothetical protein	D6PST5	Lactobacillus_phage	9.8e-25	60.9
WP_157128260.1\|880406_880565_+	hypothetical protein	D6PST6	Lactobacillus_phage	3.3e-17	78.8
WP_085763011.1\|880674_880989_+	hypothetical protein	NA	NA	NA	NA
WP_085763012.1\|880988_881876_+	YqaJ viral recombinase family protein	A0A0P0IJW5	Lactobacillus_phage	1.7e-94	56.6
WP_085763013.1\|881878_882832_+	recombinase RecT	D2IYT9	Enterococcus_phage	4.9e-79	56.9
WP_085763014.1\|882860_883802_+	DUF4373 domain-containing protein	A0A0H4TKJ7	Bacillus_phage	3.8e-15	35.2
WP_085763015.1\|883798_884500_+	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	4.1e-51	46.6
WP_085763016.1\|884492_884912_+	RusA family crossover junction endodeoxyribonuclease	D6PSU4	Lactobacillus_phage	9.4e-43	59.0
WP_085768350.1\|884899_885163_+	hypothetical protein	NA	NA	NA	NA
WP_085763018.1\|885332_886136_+	DNA adenine methylase	Q24LC8	Clostridium_phage	3.2e-63	43.3
WP_085763019.1\|886238_886436_+	hypothetical protein	NA	NA	NA	NA
WP_024525425.1\|886428_886704_+	DUF3850 domain-containing protein	U5U430	Lactobacillus_phage	2.3e-18	61.8
WP_069359856.1\|886737_887040_+	hypothetical protein	NA	NA	NA	NA
WP_085763020.1\|887069_887390_+	hypothetical protein	NA	NA	NA	NA
WP_085763021.1\|887394_887592_+	hypothetical protein	NA	NA	NA	NA
WP_085763022.1\|887670_888144_+	hypothetical protein	U5U7A6	Lactobacillus_phage	3.9e-13	35.9
WP_084994700.1\|889008_890085_+	hypothetical protein	A0A1S5S8Z0	Streptococcus_phage	1.6e-06	34.5
WP_157128261.1\|890143_890320_+	hypothetical protein	NA	NA	NA	NA
WP_035464847.1\|890357_890573_-	CsbD family protein	NA	NA	NA	NA
WP_085763023.1\|890770_891004_+	hypothetical protein	D6PSW7	Lactobacillus_phage	1.1e-32	87.0
WP_085763024.1\|891062_891815_+	TerS	D6PSW8	Lactobacillus_phage	5.1e-108	90.3
WP_085763025.1\|891792_893136_+\|terminase	PBSX family phage terminase large subunit	D6PSX1	Lactobacillus_phage	7.9e-168	99.6
WP_085763026.1\|893152_894514_+	DUF1073 domain-containing protein	D6PSX2	Lactobacillus_phage	4.9e-258	97.8
WP_085763027.1\|894516_895344_+\|capsid	minor capsid protein	D6PSX3	Lactobacillus_phage	9.0e-130	96.7
WP_191981937.1\|895366_895636_+	LysM peptidoglycan-binding domain-containing protein	D6PSX4	Lactobacillus_phage	8.7e-18	86.5
WP_085763029.1\|895647_896751_+	DUF2213 domain-containing protein	D6PSX5	Lactobacillus_phage	1.6e-158	89.6
WP_042254689.1\|896765_897230_+	hypothetical protein	D6PSX6	Lactobacillus_phage	6.4e-77	98.7
WP_085763030.1\|897244_898123_+	encapsulin	D6PSX7	Lactobacillus_phage	6.8e-160	98.6
WP_085763031.1\|898133_898496_+	hypothetical protein	D6PSX8	Lactobacillus_phage	8.1e-59	99.2
WP_085763032.1\|898507_898834_+	DUF4054 domain-containing protein	D6PSX9	Lactobacillus_phage	3.9e-52	95.4
WP_085763033.1\|898830_899433_+	hypothetical protein	D6PSY0	Lactobacillus_phage	1.5e-97	87.9
WP_085763034.1\|899432_899807_+	hypothetical protein	D6PSY1	Lactobacillus_phage	5.9e-65	94.4
WP_085763035.1\|899799_900270_+	hypothetical protein	D6PSY2	Lactobacillus_phage	4.2e-60	94.9
WP_085763036.1\|900282_901320_+	DUF3383 family protein	D6PSY3	Lactobacillus_phage	1.7e-141	95.1
WP_085763037.1\|901334_901733_+	hypothetical protein	D6PSY4	Lactobacillus_phage	3.1e-72	99.2
WP_085763038.1\|901803_902178_+	hypothetical protein	D6PSY5	Lactobacillus_phage	2.8e-62	91.1
WP_157128262.1\|902188_902359_+	hypothetical protein	D6PSY6	Lactobacillus_phage	9.7e-23	94.4
WP_085763039.1\|902373_908097_+\|tail	phage tail tape measure protein	D6PSY9	Lactobacillus_phage	1.1e-138	85.2
WP_085763040.1\|908096_908744_+	LysM peptidoglycan-binding domain-containing protein	D6PSZ4	Lactobacillus_phage	3.4e-108	92.1
WP_191981938.1\|908755_909148_+	hypothetical protein	D6PSZ5	Lactobacillus_phage	7.1e-69	100.0
WP_085763042.1\|909137_910379_+	hypothetical protein	D6PSZ6	Lactobacillus_phage	1.4e-206	90.8
WP_085763043.1\|910378_910723_+	hypothetical protein	D6PSZ7	Lactobacillus_phage	2.5e-57	97.4
WP_085763044.1\|910722_911121_+	hypothetical protein	D6PSZ8	Lactobacillus_phage	5.8e-50	80.2
WP_085763045.1\|911107_911875_+\|plate	baseplate J/gp47 family protein	D6PSZ9	Lactobacillus_phage	1.4e-89	81.0
WP_157128263.1\|911775_912285_+	hypothetical protein	D6PSZ9	Lactobacillus_phage	1.1e-72	79.9
WP_085763047.1\|912274_912934_+	hypothetical protein	D6PT00	Lactobacillus_phage	2.8e-73	82.4
WP_085763048.1\|912936_914832_+	hypothetical protein	A0A2K9VCK7	Lactobacillus_phage	3.6e-41	58.6
WP_085763049.1\|914843_915272_+	hypothetical protein	NA	NA	NA	NA
WP_157128264.1\|915283_915451_+	XkdX family protein	NA	NA	NA	NA
WP_191982493.1\|915476_916280_+	hypothetical protein	D6PSR9	Lactobacillus_phage	2.8e-43	67.2
WP_085763051.1\|916291_916810_+	hypothetical protein	D6PSS1	Lactobacillus_phage	8.2e-81	93.0
WP_085763076.1\|916809_917862_+	Lyzozyme M1 (1,4-beta-N-acetylmuramidase)	D6PSS2	Lactobacillus_phage	2.5e-177	97.2
WP_157128265.1\|917940_918738_+	hypothetical protein	NA	NA	NA	NA
WP_085763053.1\|918745_919879_+	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	3.5e-23	26.4
WP_085763054.1\|920285_920492_-	DUF3923 family protein	NA	NA	NA	NA
WP_042521251.1\|920664_921042_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085762957.1\|921459_922635_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_085768351.1\|923030_924212_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_043023458.1\|924989_925457_-	universal stress protein	NA	NA	NA	NA
WP_085763077.1\|925710_926280_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

1694554 : 1700782

Staphylococcus_phage(16.67%)

integrase

attL 1685211:1685229|attR 1708965:1708983

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1685211:1685229	attL	NA	NA	NA	NA
WP_085763353.1\|1694554_1695955_-	virulence protein	Q4ZD27	Staphylococcus_phage	5.3e-74	37.1
WP_085763354.1\|1695967_1696738_-	bifunctional DNA primase/polymerase	A0A060ADS5	Enterococcus_phage	2.1e-16	31.7
WP_085763355.1\|1696750_1696975_-	hypothetical protein	NA	NA	NA	NA
WP_085763356.1\|1696974_1697205_-	hypothetical protein	NA	NA	NA	NA
WP_085763357.1\|1697516_1697801_-	hypothetical protein	NA	NA	NA	NA
WP_085763358.1\|1697817_1698498_-	Rha family transcriptional regulator	R9QNB1	Lactococcus_phage	4.5e-26	36.0
WP_085763359.1\|1698499_1698715_-	helix-turn-helix transcriptional regulator	A0A1X9I5U5	Streptococcus_phage	3.6e-06	43.5
WP_085763360.1\|1698843_1699482_+	helix-turn-helix transcriptional regulator	A0A0P0IV68	Lactobacillus_phage	1.3e-11	48.8
WP_085763361.1\|1699627_1700782_+\|integrase	site-specific integrase	S6C485	Thermus_phage	3.3e-53	36.0
1708965:1708983	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016802

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13813

Staphylococcus_prophage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020090532.1\|743_1112_+	DUF5388 domain-containing protein	NA	NA	NA	NA
WP_051998327.1\|3792_4350_+	hypothetical protein	NA	NA	NA	NA
WP_103152830.1\|5610_6987_-	Nramp family divalent metal transporter	NA	NA	NA	NA
WP_085768485.1\|7234_7879_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_191982502.1\|8691_9240_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_085768487.1\|9404_10664_+	ABC transporter permease	NA	NA	NA	NA
WP_046870788.1\|11481_12399_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	5.6e-40	38.1
WP_011178833.1\|12865_13813_+	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	2.7e-45	36.9

DBSCAN-SWA_2

24878 : 32267

unidentified_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085763761.1\|24878_25802_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.1e-30	31.4
WP_033615067.1\|26130_26685_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-33	45.1
WP_085763762.1\|27060_29097_-	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.0e-62	33.2
WP_085763763.1\|29262_29964_-	response regulator transcription factor	A0A1J0GWE0	Alteromonas_phage	4.8e-07	29.1
WP_085763764.1\|31337_32267_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	4.8e-23	33.7

DBSCAN-SWA_3

42006 : 44142

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085763773.1\|42006_44142_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	5.6e-107	46.0

DBSCAN-SWA_4

48842 : 49997

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085768494.1\|48842_49997_-	C40 family peptidase	A0A1X9I9Q1	Staphylococcus_phage	1.6e-15	39.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP016798

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4443 : 40450

Lactobacillus_phage(56.25%)

head,terminase,capsid,portal,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085768431.1\|4443_5673_-	hypothetical protein	Q20DB8	Lactobacillus_phage	4.9e-07	29.7
WP_085768432.1\|5672_6275_-	hypothetical protein	NA	NA	NA	NA
WP_191982498.1\|6284_7520_-\|plate	baseplate J/gp47 family protein	A8ATI2	Listeria_phage	1.2e-42	30.0
WP_085768434.1\|7503_7902_-	hypothetical protein	NA	NA	NA	NA
WP_085768435.1\|7898_8312_-	hypothetical protein	NA	NA	NA	NA
WP_085768436.1\|8304_9237_-	hypothetical protein	A8ATH9	Listeria_phage	1.2e-29	31.6
WP_085768437.1\|9220_9577_-	hypothetical protein	A8ATH8	Listeria_phage	1.8e-15	43.6
WP_085768438.1\|9576_10761_-	LysM peptidoglycan-binding domain-containing protein	A8ATH7	Listeria_phage	8.1e-07	32.0
WP_191982499.1\|10760_14621_-	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	9.6e-142	34.2
WP_042253738.1\|14620_14818_-	hypothetical protein	NA	NA	NA	NA
WP_085768440.1\|14879_15509_-	hypothetical protein	NA	NA	NA	NA
WP_085768441.1\|15958_16459_-	hypothetical protein	NA	NA	NA	NA
WP_085768442.1\|16473_17562_-	hypothetical protein	D6PSY3	Lactobacillus_phage	1.1e-05	24.1
WP_085768443.1\|17565_18051_-	hypothetical protein	NA	NA	NA	NA
WP_157128293.1\|18043_18382_-	hypothetical protein	NA	NA	NA	NA
WP_085768445.1\|18417_18738_-	hypothetical protein	NA	NA	NA	NA
WP_157128295.1\|18742_19345_-	hypothetical protein	A0A2D1GQ83	Lysinibacillus_phage	2.2e-05	28.6
WP_085768447.1\|19337_19682_-	hypothetical protein	NA	NA	NA	NA
WP_085768448.1\|19696_20773_-\|capsid	phage capsid protein	O03966	Lactobacillus_phage	3.0e-53	42.6
WP_085768449.1\|20785_21424_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_085768480.1\|21636_22344_-\|head	phage head morphogenesis protein	NA	NA	NA	NA
WP_191982494.1\|22492_24280_-\|portal	phage portal protein	C9E2I8	Enterococcus_phage	7.8e-46	28.0
WP_085768451.1\|24236_24581_-	hypothetical protein	NA	NA	NA	NA
WP_085768452.1\|24753_26064_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.1e-110	51.3
WP_085768453.1\|26060_26660_-\|terminase	terminase small subunit	A0A1P8VVN7	Streptococcus_phage	2.0e-09	46.2
WP_191982495.1\|26659_26815_-	hypothetical protein	NA	NA	NA	NA
WP_085768454.1\|27358_27775_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.5e-32	48.2
WP_085768455.1\|27787_28003_-	hypothetical protein	NA	NA	NA	NA
WP_042253713.1\|28139_28439_-	hypothetical protein	NA	NA	NA	NA
WP_085768456.1\|28467_28659_-	hypothetical protein	D6PSV7	Lactobacillus_phage	8.6e-28	95.2
WP_085768457.1\|28639_29068_-	hypothetical protein	K4I239	Lactobacillus_phage	1.2e-13	41.4
WP_191982500.1\|29027_29216_-	hypothetical protein	D6PSV4	Lactobacillus_phage	4.2e-27	88.7
WP_085768458.1\|29199_29397_-	hypothetical protein	D6PSV3	Lactobacillus_phage	4.7e-21	78.5
WP_191982496.1\|29465_29621_-	hypothetical protein	D6PSV2	Lactobacillus_phage	1.5e-22	100.0
WP_085768459.1\|30442_30688_-	hypothetical protein	D6PSU9	Lactobacillus_phage	3.1e-30	86.4
WP_085768460.1\|30687_31092_-	hypothetical protein	D6PSU8	Lactobacillus_phage	8.8e-30	71.4
WP_085768461.1\|31261_32032_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	7.7e-67	52.1
WP_157128297.1\|32033_32789_-	conserved phage C-terminal domain-containing protein	A0A1W6JNI1	Staphylococcus_phage	3.9e-55	49.4
WP_085768462.1\|32818_33622_-	HNH endonuclease	H2EFU0	Moumouvirus	3.4e-17	36.1
WP_085768463.1\|33584_34310_-	hypothetical protein	E9LUU3	Lactobacillus_phage	3.5e-77	63.0
WP_085768464.1\|34324_34756_-	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	4.6e-45	62.1
WP_085768465.1\|34748_35492_-	ERF family protein	Q9G0C9	Lactococcus_phage	1.9e-14	42.3
WP_085768466.1\|35494_36037_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	9.0e-30	40.7
WP_085768467.1\|36036_36351_-	hypothetical protein	NA	NA	NA	NA
WP_085768468.1\|36460_36664_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.4e-07	45.5
WP_191982497.1\|36653_36818_-	hypothetical protein	NA	NA	NA	NA
WP_047021375.1\|36932_37169_+	hypothetical protein	NA	NA	NA	NA
WP_081082598.1\|37216_37402_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	2.0e-05	49.1
WP_085768470.1\|37665_37899_+	hypothetical protein	NA	NA	NA	NA
WP_157128298.1\|37895_38042_-	hypothetical protein	NA	NA	NA	NA
WP_085768471.1\|38358_38562_-	hypothetical protein	NA	NA	NA	NA
WP_085768472.1\|38574_39297_-	phage antirepressor KilAC domain-containing protein	A0A2I7SC24	Paenibacillus_phage	2.9e-52	45.9
WP_085768473.1\|39312_39564_-	helix-turn-helix transcriptional regulator	U5U3X7	Lactobacillus_phage	4.3e-19	55.6
WP_085768474.1\|39724_40450_+	helix-turn-helix domain-containing protein	A0A097BY95	Leuconostoc_phage	1.8e-49	47.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016797

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016802

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP016798

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection