CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP017362	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-8	0 crisprs	NA	0	0
NZ_CP017357	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-3, complete sequence	0 crisprs	NA	0	0
NZ_CP017354	Lactiplantibacillus plantarum strain TMW 1.25 chromosome, complete genome	0 crisprs	WYL,csa3,DinG,cas3,RT,DEDDh	0	5
NZ_CP017360	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-6	0 crisprs	NA	0	0
NZ_CP017359	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-5	0 crisprs	NA	0	0
NZ_CP017355	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-1, complete sequence	0 crisprs	NA	0	1
NZ_CP017358	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	1 crisprs	NA	1	0
NZ_CP017361	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-7	0 crisprs	NA	0	0
NZ_CP017356	Lactiplantibacillus plantarum strain TMW 1.25 plasmid pL125-2, complete sequence	0 crisprs	NA	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

318986 : 373928

Bacillus_virus(50.0%)

protease,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|318986_319550_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003641929.1\|319743_320412_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_085764293.1\|320569_322075_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|322339_322708_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|322820_323330_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643764.1\|323360_324557_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641934.1\|324666_325137_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|325155_325611_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|325714_326287_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_085764294.1\|326452_327373_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_047672629.1\|327509_328421_+	oxidoreductase	NA	NA	NA	NA
WP_085764295.1\|329310_329757_-	ribonuclease H	NA	NA	NA	NA
WP_003641940.1\|329994_331521_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|331521_332493_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|332570_333902_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|334367_335885_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003641944.1\|335899_337729_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|337743_338466_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_085764296.1\|339052_342736_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_085764297.1\|342737_344429_+	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_063484811.1\|344425_345343_+	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|345386_345650_+	hypothetical protein	NA	NA	NA	NA
WP_072540096.1\|345761_346040_+	hypothetical protein	NA	NA	NA	NA
WP_053339238.1\|346178_346424_-	hypothetical protein	NA	NA	NA	NA
WP_151502030.1\|346465_346690_+	hypothetical protein	NA	NA	NA	NA
WP_053339239.1\|346818_347211_+	hypothetical protein	NA	NA	NA	NA
WP_053339240.1\|348838_349102_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|349218_349422_+	hypothetical protein	NA	NA	NA	NA
WP_003646452.1\|349546_349786_+	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|349803_350190_+	hypothetical protein	NA	NA	NA	NA
WP_157113079.1\|351032_351179_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_047672648.1\|351255_351663_+	immunity 63 family protein	NA	NA	NA	NA
WP_003641957.1\|352204_352342_+	hypothetical protein	NA	NA	NA	NA
WP_076655685.1\|353248_353665_+	hypothetical protein	NA	NA	NA	NA
WP_085764299.1\|353727_353991_+	hypothetical protein	NA	NA	NA	NA
WP_057136835.1\|354382_354628_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|355202_355622_+	hypothetical protein	NA	NA	NA	NA
WP_033608295.1\|355913_356378_+	hypothetical protein	NA	NA	NA	NA
WP_085764300.1\|356656_357274_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_085764301.1\|357277_358432_-	MFS transporter	NA	NA	NA	NA
WP_053566434.1\|358435_359227_-	HAD family hydrolase	NA	NA	NA	NA
WP_085764302.1\|359297_360170_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_085764303.1\|360329_361145_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_027821507.1\|361670_363047_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|363091_364276_+	cation:proton antiporter	NA	NA	NA	NA
WP_072533003.1\|364616_364817_+	hypothetical protein	NA	NA	NA	NA
WP_157113081.1\|365006_365180_+	hypothetical protein	NA	NA	NA	NA
WP_072533006.1\|365773_366442_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_063487606.1\|367633_367834_+	hypothetical protein	NA	NA	NA	NA
WP_003641975.1\|367961_368129_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_063487605.1\|369475_370222_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643807.1\|370353_370503_+	hypothetical protein	NA	NA	NA	NA
WP_003643808.1\|370516_371857_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_085764305.1\|371857_372601_+	response regulator transcription factor	NA	NA	NA	NA
WP_085764306.1\|372894_373668_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|373769_373928_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA

DBSCAN-SWA_2

1227784 : 1235051

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643099.1\|1227784_1228732_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|1229075_1229690_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_063720948.1\|1229692_1232131_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_003643095.1\|1232218_1232779_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643094.1\|1232849_1233290_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_052098033.1\|1233634_1234102_+	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	6.1e-83	99.4
WP_053566592.1\|1234076_1235051_+	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	5.0e-31	90.7

DBSCAN-SWA_3

1735241 : 1797523

Lactobacillus_phage(17.65%)

tRNA,integrase,protease,transposase

attL 1777731:1777748|attR 1804346:1804363

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764514.1\|1735241_1736951_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.3e-93	41.5
WP_003640703.1\|1737118_1738954_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-23	26.1
WP_085764515.1\|1739117_1740395_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003640705.1\|1740391_1740634_-	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_003640706.1\|1740657_1741872_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-27	30.5
WP_085764516.1\|1741868_1743395_-	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	7.6e-42	27.6
WP_003640708.1\|1743437_1743587_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_003640709.1\|1743618_1744812_-	serine hydrolase	NA	NA	NA	NA
WP_003640710.1\|1745227_1746370_-	molecular chaperone DnaJ	A0A2K9L588	Tupanvirus	4.3e-21	32.0
WP_003640711.1\|1746471_1748340_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	7.7e-137	47.2
WP_003645970.1\|1748383_1748983_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_003640713.1\|1749003_1750047_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_003640714.1\|1750437_1751148_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_003640715.1\|1751148_1752150_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_003640716.1\|1752162_1753086_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_085764517.1\|1753570_1754092_-	shikimate kinase	NA	NA	NA	NA
WP_085764518.1\|1754094_1755192_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_003640719.1\|1755194_1756493_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_024971663.1\|1756506_1757034_-	hypothetical protein	NA	NA	NA	NA
WP_003640721.1\|1757042_1758212_-	chorismate synthase	NA	NA	NA	NA
WP_003640722.1\|1758204_1759659_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1760306_1760660_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_046947639.1\|1760682_1763247_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640725.1\|1763261_1763567_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1763556_1763856_-	YlxR family protein	NA	NA	NA	NA
WP_003640727.1\|1763900_1765118_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1765138_1765615_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1765910_1770224_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1770717_1772427_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1772466_1773744_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1773781_1774567_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1774582_1775362_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1775481_1776045_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1776046_1776769_-	UMP kinase	NA	NA	NA	NA
WP_003640738.1\|1776968_1777847_-	elongation factor Ts	NA	NA	NA	NA
1777731:1777748	attL	NA	NA	NA	NA
WP_085764519.1\|1777949_1778753_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1778977_1779700_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1779988_1780987_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1781071_1781377_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_015825656.1\|1781360_1782119_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_025015626.1\|1782230_1782866_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1782923_1783160_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1783257_1783497_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1783648_1784281_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_089197934.1\|1784370_1784601_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003640748.1\|1784904_1785534_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1785583_1786753_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1786788_1787181_-	hypothetical protein	NA	NA	NA	NA
WP_003640751.1\|1787344_1787737_+	hypothetical protein	NA	NA	NA	NA
WP_003640752.1\|1788182_1789124_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_003640753.1\|1789593_1789812_+	hypothetical protein	NA	NA	NA	NA
WP_003640754.1\|1789882_1790134_+	DUF4428 domain-containing protein	NA	NA	NA	NA
WP_003640755.1\|1790355_1790739_+	SHOCT domain-containing protein	O48432	Lactobacillus_phage	4.7e-09	27.4
WP_085764520.1\|1790883_1793010_+	DUF4428 domain-containing protein	O48432	Lactobacillus_phage	2.2e-15	25.7
WP_158070696.1\|1793074_1793629_+	DUF4428 domain-containing protein	NA	NA	NA	NA
WP_003640758.1\|1794023_1794245_-\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	1.6e-09	42.5
WP_015825666.1\|1794412_1794829_-\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	9.1e-06	35.0
WP_033607682.1\|1794888_1795356_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_077726998.1\|1795603_1795993_+\|transposase	transposase	NA	NA	NA	NA
WP_085764521.1\|1796359_1797523_+\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	1.1e-61	38.4
1804346:1804363	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2097747 : 2158314

Lactobacillus_phage(34.88%)

integrase,protease,terminase,transposase,capsid,portal,tail,head

attL 2141886:2141907|attR 2155657:2155678

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024002521.1\|2097747_2098131_-	hypothetical protein	A0A2K9VCG4	Lactobacillus_phage	7.6e-15	62.5
WP_003641414.1\|2098117_2098414_-	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	4.9e-38	75.5
WP_187337988.1\|2098414_2099530_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.3e-32	77.4
WP_003642832.1\|2099708_2100143_-	hypothetical protein	NA	NA	NA	NA
WP_003642831.1\|2100145_2100595_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.1e-24	40.5
WP_085764563.1\|2100601_2105830_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	1.8e-143	59.4
WP_033608823.1\|2105844_2106207_-	hypothetical protein	V5UQS8	Oenococcus_phage	3.3e-44	71.2
WP_085764564.1\|2106220_2112052_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	1.0e-219	40.0
WP_031275283.1\|2112067_2112331_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
WP_033608825.1\|2112438_2112837_-	hypothetical protein	V9QJA0	Oenococcus_phage	6.6e-46	74.0
WP_099447638.1\|2112936_2113320_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
WP_033608826.1\|2113421_2113787_-	hypothetical protein	V5UQS4	Oenococcus_phage	1.8e-29	54.2
WP_060417584.1\|2113786_2114338_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	6.7e-65	62.3
WP_003642822.1\|2114339_2114687_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
WP_013355731.1\|2114686_2115019_-\|head,tail	phage head-tail connector protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
WP_003642820.1\|2115030_2115207_-	hypothetical protein	NA	NA	NA	NA
WP_003642819.1\|2115219_2116242_-\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
WP_013355732.1\|2116261_2116609_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
WP_013355733.1\|2116623_2117301_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
WP_013355734.1\|2117473_2117680_-	hypothetical protein	NA	NA	NA	NA
WP_003642815.1\|2117731_2118010_-	hypothetical protein	NA	NA	NA	NA
WP_013355736.1\|2117984_2119670_-\|capsid	minor capsid protein	V5US81	Oenococcus_phage	6.5e-119	58.0
WP_024971552.1\|2119816_2120113_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
WP_085764565.1\|2120042_2121551_-\|portal	phage portal protein	V5US18	Oenococcus_phage	6.9e-136	51.8
WP_033098955.1\|2121562_2122801_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	1.9e-139	61.3
WP_085764566.1\|2122790_2123318_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.7e-57	75.1
WP_085764567.1\|2123551_2123767_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.5e-07	61.2
WP_085764568.1\|2123969_2124581_-	hypothetical protein	NA	NA	NA	NA
WP_085764569.1\|2124552_2125449_-	hypothetical protein	NA	NA	NA	NA
WP_063096770.1\|2126321_2126783_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	6.3e-40	57.0
WP_021356389.1\|2126860_2127001_-	hypothetical protein	E9LUN8	Lactobacillus_phage	3.4e-05	96.3
WP_071665406.1\|2126993_2127374_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_057138635.1\|2127370_2127889_-	hypothetical protein	O03915	Lactobacillus_phage	2.9e-54	69.1
WP_022638119.1\|2127885_2128173_-	hypothetical protein	NA	NA	NA	NA
WP_060598975.1\|2128169_2129078_-	DnaD domain protein	NA	NA	NA	NA
WP_052748123.1\|2129157_2130123_-	hypothetical protein	A6M982	Geobacillus_virus	5.3e-65	54.5
WP_080392647.1\|2130134_2130665_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	2.3e-54	58.6
WP_187337990.1\|2130685_2130850_-	hypothetical protein	NA	NA	NA	NA
WP_060598973.1\|2131169_2131682_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.6e-28	42.9
WP_003642793.1\|2131749_2132055_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_003642792.1\|2132066_2132237_-	hypothetical protein	NA	NA	NA	NA
WP_011101086.1\|2132395_2132596_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101085.1\|2132742_2132979_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
WP_013355753.1\|2133016_2133331_+	hypothetical protein	NA	NA	NA	NA
WP_060598972.1\|2133387_2133615_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011101778.1\|2133743_2134106_+	helix-turn-helix domain-containing protein	A0A2R2ZGJ3	Clostridioides_phage	1.7e-08	48.4
WP_003644968.1\|2134117_2134531_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_060598971.1\|2134553_2135345_+	hypothetical protein	NA	NA	NA	NA
WP_003642782.1\|2135354_2135609_+	hypothetical protein	NA	NA	NA	NA
WP_003642781.1\|2135688_2136057_+	hypothetical protein	NA	NA	NA	NA
WP_003642780.1\|2136660_2137380_+	hypothetical protein	NA	NA	NA	NA
WP_003642779.1\|2137601_2137883_+	hypothetical protein	NA	NA	NA	NA
WP_003642778.1\|2138157_2138334_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
WP_003642777.1\|2138538_2138976_+	hypothetical protein	Q4ZCB9	Staphylococcus_virus	7.8e-16	37.0
WP_003642776.1\|2139023_2139797_+	DUF1828 domain-containing protein	NA	NA	NA	NA
WP_003642775.1\|2139899_2141021_+\|integrase	tyrosine-type recombinase/integrase	D6PSS4	Lactobacillus_phage	1.7e-46	32.4
WP_003642774.1\|2141372_2141579_-	hypothetical protein	NA	NA	NA	NA
2141886:2141907	attL	NA	NA	NA	NA
WP_063487358.1\|2141998_2142304_-	hypothetical protein	NA	NA	NA	NA
WP_178138091.1\|2142386_2142758_-	hypothetical protein	NA	NA	NA	NA
WP_063487356.1\|2142915_2143185_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_085764570.1\|2144838_2145939_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.2e-49	34.9
WP_061468352.1\|2145939_2146140_-	hypothetical protein	NA	NA	NA	NA
WP_085764571.1\|2146093_2147797_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.2e-122	40.7
WP_062690051.1\|2147793_2148267_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_085764572.1\|2149041_2149431_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	8.8e-19	44.7
WP_072535850.1\|2149423_2149762_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	7.1e-09	35.6
WP_027823040.1\|2149748_2149940_-	hypothetical protein	NA	NA	NA	NA
WP_072534928.1\|2149955_2150435_-	hypothetical protein	NA	NA	NA	NA
WP_085764573.1\|2150580_2151975_-	virulence protein	A0A1W6JQD6	Staphylococcus_phage	4.3e-68	39.4
WP_072534925.1\|2152772_2152991_-	hypothetical protein	NA	NA	NA	NA
WP_015640734.1\|2153271_2153451_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	4.3e-21	87.9
WP_072534924.1\|2153598_2154243_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_076633652.1\|2154321_2155479_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	2.5e-53	34.3
WP_003642773.1\|2155969_2156203_+	hypothetical protein	NA	NA	NA	NA
2155657:2155678	attR	NA	NA	NA	NA
WP_003642772.1\|2156227_2156500_+	hypothetical protein	NA	NA	NA	NA
WP_085764574.1\|2156658_2158314_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.5e-93	41.5

DBSCAN-SWA_5

2355182 : 2363693

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642593.1\|2355182_2355761_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0
WP_003642592.1\|2355753_2356779_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642591.1\|2356775_2358230_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642590.1\|2358214_2360434_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.7e-144	39.3
WP_003644726.1\|2360426_2361107_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2361106_2361361_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2361362_2362094_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003644727.1\|2362096_2363227_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2363210_2363693_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017358

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017358_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017358_1

4740-4895

Orphan

Consensus_repeat	Method
AAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017358_1

>merge|NZ_CP017358|1|4740-4895|CRISPRCasFinder
AAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGACCTTCGCGGGAGACCGTTGAAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGACCTTCGCGAAAGTCCGTTGATGACACCCCGCAAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGAC

>NZ_CP017358|1|1|4740-4895|CRISPRCasFinder
AAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGAC	CTTCGCGGGAGACCGTTGAAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGACCTTCGCGAAAGTCCGTTGATGACACCCCGC
AAACCCTTGCTACGAGCGAAAGTCTAAAAAATAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017358.1\|WP_085764848.1\|1593_2178_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP017358.1\|WP_085764861.1\|10286_10901_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017358.1\|WP_187337993.1\|7310_7538_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017358.1\|WP_010014831.1\|5829_6111_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP017358.1\|WP_085764849.1\|909_1551_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017358.1\|WP_085764844.1\|7789_9847_+\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP017358.1\|WP_085764846.1\|6339_7020_+\|zeta-toxin-family-protein	unknown	unknown	gnl\|CDD\|226648
NZ_CP017358.1\|WP_014216295.1\|11258_11621_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274860
NZ_CP017358.1\|WP_003646549.1\|64_568_+\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP017358.1\|WP_003636296.1\|2312_3104_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224113
NZ_CP017358.1\|WP_035168790.1\|10902_11238_+\|CagC-family-type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|374896
NZ_CP017358.1\|WP_010620892.1\|6157_6343_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017358.1\|WP_014940856.1\|7009_7288_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017358.1\|WP_085764843.1\|9953_10247_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017358.1\|WP_010011603.1\|3175_3415_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP017358.1\|WP_085764848.1\|1593_2178_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.55619e-44
NZ_CP017358.1\|WP_003646549.1\|64_568_+\|IS5-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	9.67335e-20
NZ_CP017358.1\|WP_003636296.1\|2312_3104_+\|AAA-family-ATPase	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	1.90607e-27
NZ_CP017358.1\|WP_035168790.1\|10902_11238_+\|CagC-family-type-IV-secretion-system-protein	gnl\|CDD\|374896	pfam16943, T4SS_CagC, Cag pathogenicity island, type IV secretory system. T4SS_CagC is a family of putative pathogenicity island, type IV, conjugal DNA-protein transfer, secretory system proteins from Gram-negative bacteria.	4.9854e-41
NZ_CP017358.1\|WP_010014831.1\|5829_6111_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	6.2967e-11
NZ_CP017358.1\|WP_085764844.1\|7789_9847_+\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	1.25231e-101
NZ_CP017358.1\|WP_085764846.1\|6339_7020_+\|zeta-toxin-family-protein	gnl\|CDD\|226648	COG4185, COG4185, Uncharacterized protein conserved in bacteria [Function unknown].	9.99558e-39
NZ_CP017358.1\|WP_014216295.1\|11258_11621_+\|hypothetical-protein	gnl\|CDD\|274860	TIGR03928, T7_EssCb_Firm, type VII secretion protein EssC, C-terminal domain. This model describes the C-terminal domain, or longer subunit, of the Firmicutes type VII secretion protein EssC. This protein (homologous to EccC in Actinobacteria) and the WXG100 target proteins are the only homologous parts of type VII secretion between Firmicutes and Actinobacteria. [Protein fate, Protein and peptide secretion and trafficking].	0.00203

>NZ_CP017358.1|WP_010011603.1|3175_3415_+|hypothetical-protein
MAFDPENKNIKKALQKNETEQPTDTKDKLVIPVFKDEEERTKNYTFSLQPSARKRLDGLAKEHNFKSASKFLNELIKNM
>NZ_CP017358.1|WP_003636296.1|2312_3104_+|AAA-family-ATPase
MEIITFSAIKGGVGKTTLAFNYGEWLAKNGKHVLFIDLDHQSNLTQTYNIYDNQDTVGNIFLDRGKVKIHEISAYISIIAGDMHLDDIERTIENKTNKNMFLYMWLSDNYERLNLGKFEYIILDCHPDFSTATKNAVIISNAILSPITPSEHGYNAKFNLEERINELRKEAIDYSTRKSYVTTKLFFIANMIKHNTRSSRELLKALKGDPSVLATVPEKELFNRSTLDKKSLSKMAEDHKTYIDQHEFFDSMDKTFNEITEKL
>NZ_CP017358.1|WP_085764848.1|1593_2178_+|recombinase-family-protein
MAKIGYARVSSKEQHLDRQLAALRGVDKLFTDKLSGANTNRPELQKMLAYIREGDIVLVTELDRLGRNNQDLTKIMNTIQNKGATLDVLNLPSMTGIADPNLRRLMTNLIIELYKYQAESERKRIIERQQQGIALAKQQGKYHGRKPQYAKDDPRLQHAFKLYQAGMSDIDVSRNTGIKRTTFIRYRKKLNIKR
>NZ_CP017358.1|WP_085764849.1|909_1551_+|hypothetical-protein
MTTRPQFNRNMSSRTFADFYWYKEELQSICHQYGLPAYGTKAELTKYIVAFLNGKAAAEIKPVRQLKRKTASKLTAESITLDTKLLDSGFSLNQAARTFFANYFGVEYFNFRKVMGIKMREVEKDGDVSATVADLVKVLKDPRLISFDNEEEKTYQWNSFVKAFRRDSISKKYHEPMKVAAIIWQILKKSDHPKVYTRKLVIENAELIKEFRK
>NZ_CP017358.1|WP_003646549.1|64_568_+|IS5-family-transposase
MAQKRSVYTSFIILDAQSVKNTDPAESSGYDGGKKVSGIKRHLAVDINGLPMAVHVTTANVSERDGANALLALNKSQFDLVQRVMADGGYTGNNFAQSVQAMINAEVIIAKQSDLRHGQVTPQRWVIERSFSWLGKYRRLWRNCERKLNTSKMMISLAFLRILLKRF
>NZ_CP017358.1|WP_010014831.1|5829_6111_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVQIDKELADNTEAVLSQLGLNPTTAINMFYKRIVADAALPFKPALSEAERANLSLLKATKETPVTEFKDAKEVADWLNDPDED
>NZ_CP017358.1|WP_010620892.1|6157_6343_+|hypothetical-protein
MKDTITINDFFEIAKETDLKDLLDKSLHEPDPEKRKVYDALYTYFLDKRQDEVIKRKDFVR
>NZ_CP017358.1|WP_085764846.1|6339_7020_+|zeta-toxin-family-protein
MIDKPQYIIVAGINGAGKSTLYDTFPILFDKTKRINADELLRQMGGDWHKDSDNLKAMKEEIKQLHYALDHQQSIHVETTLAGRGKAQLNLIDKAHKNGFEVTLLYVALRDENLAIQRVNERVQKGGHGVPVATIKKRYQQSKHNLPLVAFKSDKVMIYDNSEKFTSVYAREKGQVFKNDLRHFPWINQNITYPEKVQKQLQNFANQNPEVKPKNDPENKNDRPSY
>NZ_CP017358.1|WP_014940856.1|7009_7288_-|hypothetical-protein
MSNQYEKLVEQQARLKQKIEREDFKLRQSKYYENRQSRKARSRRLIQKGALLEKYFQANNLSVEQTEELLKTFADYVNAHKPNKLKNDQPNN
>NZ_CP017358.1|WP_187337993.1|7310_7538_-|hypothetical-protein
MIGGIVMSQSNLEKQEAKLKALNQKIKDEKNNIEQRLGKQIISQANLDYANLSDDQIKLLAKQFSEFLKVKSVDH
>NZ_CP017358.1|WP_085764844.1|7789_9847_+|MobA/MobL-family-protein
MAIFHMSFSNISAGKGRSAIASAAYRSGEKLFDDKEGRHYFYARSVMPESFILTPKNSPEWASDREQLWNEVEKKDRKSNSRYAKEFNVALPVELSESEQKELLTKYVQENFVDEGMVADVAIHRDHPDNPHAHVMLTNRPFNPDGTWGQKTKTEYILDSHGNKTKTPAGNVRNRKIWLVDWDKKEKITEWRHNWAVSVNQVLEAKNLPDRISEKSYEEQGIDEVATQHEGINSQKEKRQEFNQNVKQQRQAKAEAKNVNEKIHNERRMQTLQRHYSFDEKRLVAQLSNRLKTFVSLENLDEKQRMLFNWKNSAMIKQAVGEDVTKQLVTITQQEKSLSEANQLLDKVVNRTVSKLYPDVDFEQITMAEKRELVKETDSEQRVFTGDELKDRLAMIRTNIINQQVLTFTKRPFASWLMLEKQEQRAKETISDILANKGYRLADIKRTKGTLLSDFDEKQQAVLKKNIKELSAVNEIKQVVDTQYNNVLSKTFPDMSLDQVKMTEKERLYTAVVYYNPELKSLEKRDLDQLRNNPPVQFTTQEHAQGLAYLSGQVKSDEIQNANLLRVLKNRGTQQLFIGEAGQDKKISAKQLEQAKQAVKQHNQKNDDFRKENMPDYRAVNYNENTPANYMNKLLSDTLMSLLYENGQDHELNRQKKAQKELEYELDKKKRQHQKHSRHSGTIHR
>NZ_CP017358.1|WP_085764843.1|9953_10247_+|hypothetical-protein
MKNSNEWHTLAEASRILGKNDRYVSNWIKRHDDFPKPMLMDISGKKIIHDKGIQWISEHTKKEGVLKSKVSAIEDKFLKLTVLGKHPNIPFYMCMSG
>NZ_CP017358.1|WP_085764861.1|10286_10901_+|hypothetical-protein
MKIENWQDVDEHLVVDNDKAIIVKDSKLLDNPEALKTEMQRSGKPVREVRSKLVQKSVKSRVKTDPLKISGWFDRKHESDNAQKAEKLVSNKPTHQYKQIKNEMTFFGESFLEGFLGFYGLEVDNALGRYEHNLHVLETQELGSSEKEYYLAQVKSGELKQVTKNLPNREIAEEELNKFYQREPEETQAEQIQLRTSEDDRKEE
>NZ_CP017358.1|WP_035168790.1|10902_11238_+|CagC-family-type-IV-secretion-system-protein
MKFSKVKALATTGATAIYLGLMNAQVVLAAGGGEVKSKLTQAGKTIQGILTGLVVLVGICVALFIIIKRMPDADDPREKSEVYHAVGRVAGLVALAAAIIWILPWVYSLFT
>NZ_CP017358.1|WP_014216295.1|11258_11621_+|hypothetical-protein
MKKGKEFIFPENVDKDYGIWKDYTLKDFGYAALAGLVGLIFIAIPPYGLILVLIKIVIVVLAMTIVMAILTIRPVAARKNIKVRDNFKLKRRYANGQKLFYLKPKKRGELNAFEEEQNRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	22508-22591	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4776-4859	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	5770-5853	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	26504-26587	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	6891-6974	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	20910-20993	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	5879-5962	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	5880-5963	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NC_014386	Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence	1748-1831	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP019583	Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence	4584-4667	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NC_006529	Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence	4742-4825	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	3330-3413	24	0.714
NZ_CP017358_1	1.1\|4776\|84\|NZ_CP017358\|CRISPRCasFinder	4776-4859	84	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	4831-4914	25	0.702

1. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

2. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

3. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

4. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

5. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

6. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

7. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

8. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

9. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NC_014386 (Lactobacillus helveticus R0052 plasmid pIR52-1, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

10. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP019583 (Lactobacillus helveticus strain LH5 plasmid pCBTLH5_2, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

11. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NC_006529 (Lactobacillus salivarius UCC118 plasmid pSF118-20, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

12. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 24, identity: 0.714

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	Protospacer
************************************************************

13. spacer 1.1|4776|84|NZ_CP017358|CRISPRCasFinder matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 25, identity: 0.702

cttcgcgggagaccgttgaaacccttgctacgagcgaaagtctaaaaaatagaccttcgc	CRISPR spacer
cttcgcgggagaccgttgaaacccttgctacaagcgaaagtctaaaaaatagaccttcgc	Protospacer
*******************************.****************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

18115 : 58526

Streptococcus_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012695418.1\|18115_19141_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.7e-41	35.5
WP_012695419.1\|19340_19739_-	hypothetical protein	NA	NA	NA	NA
WP_042751061.1\|19735_20596_-	ParA family protein	F0PIG8	Enterococcus_phage	2.7e-36	35.1
WP_085768500.1\|21413_22934_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_012695422.1\|23696_24689_+	hypothetical protein	A0A2H4JAH5	uncultured_Caudovirales_phage	6.9e-36	46.9
WP_042751055.1\|24878_25166_+	hypothetical protein	NA	NA	NA	NA
WP_042751053.1\|25162_25357_+	hypothetical protein	NA	NA	NA	NA
WP_042751051.1\|25356_25785_+	thioredoxin family protein	NA	NA	NA	NA
WP_012695424.1\|25777_26701_+	hypothetical protein	NA	NA	NA	NA
WP_012695425.1\|26925_27222_+	hypothetical protein	NA	NA	NA	NA
WP_039107367.1\|27232_27688_+	hypothetical protein	NA	NA	NA	NA
WP_039107365.1\|27707_28193_+	hypothetical protein	NA	NA	NA	NA
WP_012695426.1\|28182_30168_+	hypothetical protein	NA	NA	NA	NA
WP_042751048.1\|30222_30447_+	hypothetical protein	NA	NA	NA	NA
WP_187337992.1\|30430_32137_+	toprim domain-containing protein	NA	NA	NA	NA
WP_012695428.1\|32294_33596_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	4.6e-80	38.1
WP_085764790.1\|33588_33783_+	hypothetical protein	NA	NA	NA	NA
WP_012695429.1\|33906_34302_+	hypothetical protein	NA	NA	NA	NA
WP_012695430.1\|34351_34534_+	type II toxin-antitoxin system HicA family toxin	D6R431	Bacillus_phage	3.2e-16	58.3
WP_012695431.1\|34563_34962_+	type II toxin-antitoxin system HicB family antitoxin	A0A0K2CYJ8	Paenibacillus_phage	4.6e-23	47.0
WP_012695432.1\|35117_36353_+	hypothetical protein	NA	NA	NA	NA
WP_085764789.1\|36463_38581_+	hypothetical protein	A0A1X9I6W8	Streptococcus_phage	4.6e-29	25.8
WP_012695387.1\|38582_39365_+	hypothetical protein	NA	NA	NA	NA
WP_085764788.1\|39385_41179_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	2.9e-93	35.9
WP_012695389.1\|41244_41568_+	hypothetical protein	NA	NA	NA	NA
WP_085764787.1\|41692_43810_+	hypothetical protein	NA	NA	NA	NA
WP_085764786.1\|43812_44133_+	hypothetical protein	NA	NA	NA	NA
WP_042751037.1\|44152_44602_+	hypothetical protein	NA	NA	NA	NA
WP_176552752.1\|44623_45442_+	class A sortase	NA	NA	NA	NA
WP_012695392.1\|45467_46361_+	hypothetical protein	NA	NA	NA	NA
WP_012695393.1\|46409_48761_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_042751027.1\|49224_50151_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.3e-23	27.9
WP_012695396.1\|50446_51130_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.3e-61	51.6
WP_012695397.1\|51368_52070_+	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_085764784.1\|52073_52574_+	hypothetical protein	NA	NA	NA	NA
WP_012695398.1\|52627_53062_+	hypothetical protein	NA	NA	NA	NA
WP_012695399.1\|54241_55225_+	hypothetical protein	NA	NA	NA	NA
WP_012695400.1\|55540_56158_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.1e-18	36.5
WP_139592727.1\|56427_56721_-	SLATT domain-containing protein	NA	NA	NA	NA
WP_157113110.1\|56699_57484_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_012695406.1\|57596_58526_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-25	30.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP017356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13098

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764804.1\|577_1996_-	conjugal transfer protein	NA	NA	NA	NA
WP_085764805.1\|1988_4007_-	DUF87 domain-containing protein	NA	NA	NA	NA
WP_085764806.1\|4018_4678_-	conjugal transfer protein	NA	NA	NA	NA
WP_014216295.1\|4646_5009_-	hypothetical protein	NA	NA	NA	NA
WP_085764807.1\|5029_5365_-	CagC family type IV secretion system protein	NA	NA	NA	NA
WP_085764808.1\|5366_5972_-	hypothetical protein	NA	NA	NA	NA
WP_057138751.1\|6007_6319_-	hypothetical protein	NA	NA	NA	NA
WP_085764809.1\|6402_8463_-	MobA/MobL family protein	NA	NA	NA	NA
WP_021816943.1\|8733_8943_+	hypothetical protein	NA	NA	NA	NA
WP_085764810.1\|8962_9247_+	hypothetical protein	NA	NA	NA	NA
WP_033609827.1\|9262_10153_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	9.2e-48	41.1
WP_056988825.1\|10887_11565_+	hypothetical protein	NA	NA	NA	NA
WP_016511700.1\|11635_11875_+	hypothetical protein	NA	NA	NA	NA
WP_085764811.1\|12168_13098_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	5.2e-25	34.1

DBSCAN-SWA_2

17125 : 19265

Enterococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013356270.1\|17125_17986_+	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-43	40.2
WP_048481076.1\|17987_18287_+	hypothetical protein	NA	NA	NA	NA
WP_085764813.1\|18335_19265_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	5.2e-25	34.1

DBSCAN-SWA_3

30759 : 34367

Vibrio_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764817.1\|30759_31347_-	recombinase family protein	M4QQC6	Vibrio_phage	2.3e-18	41.1
WP_076640220.1\|31458_31752_-	hypothetical protein	NA	NA	NA	NA
WP_016378676.1\|32722_32827_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_057800958.1\|33065_34367_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	1.6e-80	40.4

DBSCAN-SWA_4

37904 : 42572

Planktothrix_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057800962.1\|37904_38549_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-20	34.5
WP_021353390.1\|38726_38816_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_076640217.1\|38971_40096_-	hypothetical protein	NA	NA	NA	NA
WP_014564417.1\|40099_40315_-	hypothetical protein	NA	NA	NA	NA
WP_085764818.1\|40436_42572_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	8.6e-108	46.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017354

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017358

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017355

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP017356

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection