CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP017377	Lactiplantibacillus plantarum strain TMW 1.708 plasmid pL1708-3	0 crisprs	NA	0
NZ_CP017376	Lactiplantibacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence	0 crisprs	NA	4
NZ_CP017374	Lactiplantibacillus plantarum strain TMW 1.708 chromosome, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	6
NZ_CP017375	Lactiplantibacillus plantarum strain TMW 1.708 plasmid pL1708-1, complete sequence	0 crisprs	NA	1
NZ_CP017378	Lactiplantibacillus plantarum strain TMW 1.708 plasmid pL1708-4	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 15684

Streptococcus_phage(28.57%)

integrase,transposase,holin,bacteriocin

attL 271:282|attR 4684:4695

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
271:282	attL	NA	NA	NA	NA
WP_157493147.1\|520_757_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	7.2e-08	50.0
WP_085776378.1\|957_1545_+\|integrase	site-specific integrase	H0USV4	Bacillus_phage	2.4e-20	34.6
WP_085776379.1\|1614_1974_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_085776380.1\|4100_4439_+	helix-turn-helix transcriptional regulator	A0A0A7RUJ5	Clostridium_phage	9.6e-06	42.4
WP_085776381.1\|4551_4920_+	DUF488 family protein	NA	NA	NA	NA
4684:4695	attR	NA	NA	NA	NA
WP_085776382.1\|5175_6096_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	3.5e-50	36.8
WP_016378676.1\|6293_6398_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_085776383.1\|6637_7939_+	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	1.6e-80	40.6
WP_085776384.1\|7931_8252_+	acetyl-CoA carboxylase	NA	NA	NA	NA
WP_076636306.1\|8244_8610_+	hypothetical protein	NA	NA	NA	NA
WP_076636307.1\|8793_10173_+	MFS transporter	NA	NA	NA	NA
WP_024971834.1\|10179_10842_+	phosphohydrolase	A0A1D6Y7U0	Golden_Marseillevirus	3.1e-08	27.1
WP_085776385.1\|10831_11986_+	S-adenosyl-L-homocysteine hydrolase	NA	NA	NA	NA
WP_085776386.1\|12085_13210_-	hypothetical protein	NA	NA	NA	NA
WP_003713050.1\|13212_13428_-	hypothetical protein	NA	NA	NA	NA
WP_085776387.1\|13548_15684_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	5.0e-108	46.6

DBSCAN-SWA_2

20566 : 21721

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085776394.1\|20566_21721_-	C40 family peptidase	A0A1X9I9Q1	Staphylococcus_phage	1.3e-14	38.8

DBSCAN-SWA_3

33434 : 38998

Clostridioides_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015474752.1\|33434_34220_-	ParA family protein	A0A1V0DZZ0	Clostridioides_phage	8.0e-19	34.0
WP_002831210.1\|35486_36821_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	5.9e-30	27.4
WP_085776401.1\|37256_37505_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_085776402.1\|38410_38998_-	recombinase family protein	M4QQC6	Vibrio_phage	1.3e-18	42.4

DBSCAN-SWA_4

44047 : 45223

Staphylococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085776406.1\|44047_45223_-\|transposase	IS256-like element IS1310 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017374

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017374_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017374_1

1794915-1795216

Orphan

Consensus_repeat	Method
GCTTGGCTAAACGCATTATCAGCTGTACTTTGAGCCTTAGCAGTAGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP017374_1

>merge|NZ_CP017374|1|1794915-1795216|CRISPRCasFinder
GCTTGGCTAAACGCATTATCAGCTGTACTTTGAGCCTTAGCAGTAGCTGTAGAGTTGTTGCTTATCCCAGCACTAGCTTGGCTACCAACTGCCTGAGCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGCATTAGACTGGACGGCTATTTCTGAATTGGCGTAGTTGTAATTGCTATCTGCGGCTGATTTAGCGGCATTCGCTGTAGACTGTGCAATTAAAGCAGCGCTATCAGCATTTCCTGCTTGGCTAGCCGCATTATCAGCCGTATTTTGAGCATTGATAATCTT

>NZ_CP017374|1|1|1794915-1795216|CRISPRCasFinder
GCTTGGCTAAACGCATTATCAGCTGTACTTTGAGCCTTAGCAGTAGC	TGTAGAGTTGTTGCTTATCCCAGCACTAGCTTGGCTACCAACTGCCTGA
GCTTGGCTAAACGCATTGTCAGCTGTACTTTGAGCCTTAGCAGTAGC	ATTAGACTGGACGGCTATTTCTGAATTGGCGTAGTTGTAATTGCTATCTGCGGCTGATTTAGCGGCATTCGCTGTAGACTGTGCAATTAAAGCAGCGCTATCAGCATTTCCT
GCTTGGCTAGCCGCATTATCAGCCGTATTTTGAGCATTGATAATCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017374.1\|WP_085776080.1\|1782702_1783887_-\|LCP-family-protein	unknown	unknown	gnl\|CDD\|224235
NZ_CP017374.1\|WP_044430948.1\|1783867_1784659_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP017374.1\|WP_063722569.1\|1805481_1806120_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|309671
NZ_CP017374.1\|WP_016058344.1\|1789346_1789877_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227833
NZ_CP017374.1\|WP_085776081.1\|1786897_1788109_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP017374.1\|WP_046810958.1\|1784677_1786420_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|227319
NZ_CP017374.1\|WP_016058334.1\|1804896_1805280_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017374.1\|WP_085776084.1\|1797713_1799483_-\|phage-tail-family-protein	unknown	unknown	gnl\|CDD\|368574
NZ_CP017374.1\|WP_063722568.1\|1806120_1806504_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017374.1\|WP_085776083.1\|1795280_1797650_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|273743
NZ_CP017374.1\|WP_016058340.1\|1792251_1792506_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017374.1\|WP_003644510.1\|1789889_1790153_-\|hemolysin-XhlA-family-protein	unknown	unknown	gnl\|CDD\|371241
NZ_CP017374.1\|WP_085776085.1\|1799554_1804696_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|381605
NZ_CP017374.1\|WP_016058335.1\|1804708_1804900_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017374.1\|WP_016058341.1\|1792086_1792248_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017374.1\|WP_016058330.1\|1806930_1807293_-\|phage-head-closure-protein	unknown	unknown	gnl\|CDD\|273692
NZ_CP017374.1\|WP_044430944.1\|1781978_1782551_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379233
NZ_CP017374.1\|WP_063722567.1\|1806500_1806941_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017374.1\|WP_044430957.1\|1790152_1791325_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119377
NZ_CP017374.1\|WP_016058329.1\|1807276_1807615_-\|phage-gp6-like-head-tail-connector-protein	unknown	unknown	gnl\|CDD\|153446

Protein	Function_ID	Function_description	E-value
NZ_CP017374.1\|WP_085776080.1\|1782702_1783887_-\|LCP-family-protein	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	6.84015e-43
NZ_CP017374.1\|WP_044430948.1\|1783867_1784659_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	2.55361e-97
NZ_CP017374.1\|WP_016058344.1\|1789346_1789877_-\|hypothetical-protein	gnl\|CDD\|227833	COG5546, COG5546, Small integral membrane protein [Function unknown].	0.000173645
NZ_CP017374.1\|WP_085776081.1\|1786897_1788109_-\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	8.10909e-74
NZ_CP017374.1\|WP_046810958.1\|1784677_1786420_-\|ABC-transporter-permease-subunit	gnl\|CDD\|227319	COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism].	3.90685e-91
NZ_CP017374.1\|WP_085776083.1\|1795280_1797650_-\|phage-tail-protein	gnl\|CDD\|273743	TIGR01665, structural_protein, phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions].	4.75257e-13
NZ_CP017374.1\|WP_063722569.1\|1805481_1806120_-\|phage-tail-protein	gnl\|CDD\|309671	pfam04630, Phage_TTP_1, Phage tail tube protein. This is a family of phage tail tube proteins from Myoviridae.	2.75406e-69
NZ_CP017374.1\|WP_044430957.1\|1790152_1791325_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119377	cd06415, GH25_Cpl1-like, Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.	7.15942e-64
NZ_CP017374.1\|WP_085776084.1\|1797713_1799483_-\|phage-tail-family-protein	gnl\|CDD\|368574	pfam05709, Sipho_tail, Phage tail protein. This family consists of several Siphovirus and other phage tail component proteins as well as some bacterial proteins of unknown function.	8.00741e-08
NZ_CP017374.1\|WP_003644510.1\|1789889_1790153_-\|hemolysin-XhlA-family-protein	gnl\|CDD\|371241	pfam10779, XhlA, Haemolysin XhlA. XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes. This family has had DUF1267, pfam06895, merged into it.	4.53032e-09
NZ_CP017374.1\|WP_016058329.1\|1807276_1807615_-\|phage-gp6-like-head-tail-connector-protein	gnl\|CDD\|153446	cd08054, gp6, Head-Tail Connector Protein gp6 of Bacteriophage HK97 and similar proteins. The bacteriophage HK97 gp6 protein is critical in the assembly of the connector, a specialized structure that serves as an interface for head and tail attachment, as well as a point at which DNA exits the head during infection by the bacteriophage. It forms a dodecameric ring structure that comprises the middle ring of the connector, located between the portal protein (attached to the head) and the gp7 ring (attached to the tail). It is a component of the mature phage and the absence of HK97 gp6 results in defective head-tail joining and the absence of mature phage particles. Although the crystal structure of HK97 gp6 shows an unexpected 13-mer ring, the biological form present in the mature phage is believed to be a dodecamer.	1.24587e-20
NZ_CP017374.1\|WP_016058330.1\|1806930_1807293_-\|phage-head-closure-protein	gnl\|CDD\|273692	TIGR01563, hypothetical_protein_AGR_C_1752, phage head-tail adaptor, putative, SPP1 family. This family describes a small protein of about 100 amino acids found in bacteriophage and in bacterial prophage regions. Examples include gp9 of phage HK022 and gp16 of phage SPP1. This minor structural protein is suggested to be a head-tail adaptor protein (although the source of this annotation was not traced during construction of this model). [Mobile and extrachromosomal element functions, Prophage functions].	8.05503e-09
NZ_CP017374.1\|WP_085776085.1\|1799554_1804696_-\|phage-tail-protein	gnl\|CDD\|381605	cd13402, LT_TF-like, lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.	3.5393e-46
NZ_CP017374.1\|WP_044430944.1\|1781978_1782551_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379233	pfam13518, HTH_28, Helix-turn-helix domain. This helix-turn-helix domain is often found in transposases and is likely to be DNA-binding.	0.00017223

>NZ_CP017374.1|WP_016058340.1|1792251_1792506_-|hypothetical-protein
MDSILITNYKPDYTNNIMTISVQINTLGISSQVSITMDEFNTAIAGGAGGIDSVKLKVLNTLIDSLTALKPVTTTTTTTTTQEA
>NZ_CP017374.1|WP_016058341.1|1792086_1792248_-|hypothetical-protein
MNIDAQALINKMTSNYAQAIAVKDQQLAMAQVQIDQLNAKLAEKEAPKDGEDA
>NZ_CP017374.1|WP_044430957.1|1790152_1791325_-|LysM-peptidoglycan-binding-domain-containing-protein
MNKHKLKALILMMGAIFMAFLMVNVTSQASTSREQGVDWSKYNGNSGTFGYSTDKFVFSQAGGFYGGTNIPQTTYASQVKSAQQAGKRVHTYLWDGVGGNMTNAKAMMAYYLPRIRTPKGSIVALDYEDGASNSVTANTNVILAQMALIKAAGYTPVLYSGKAYLNAHVNTSAIVKAYGNCLWLAEYPDYLVRTSPDYNYFPSMDGVAIFQFTSMYKSGGLDGNVDLTGITKSGYTTASKKQAQTNVKQAQAAKKANFKVVKYNQRGVFYPNRTLAVRYTDSDKVSQVATYYKGESVTYNAVIIEHDYVWARYTRSNGLYAFIKLGVTNGHDYGKRVTGQLVSHTYYTVKSGDSWWTIAQRNGLSMTTLASQNGKSIYTTIYPGQRLVVR
>NZ_CP017374.1|WP_003644510.1|1789889_1790153_-|hemolysin-XhlA-family-protein
MAQYDDTTKLLMDIQKDVAATKTKVENIEEKLNQVDDIGDKADKALAKSIEASHQIDRVTTIQNWLIGVLVSGVLVTLVIYIAEKFL
>NZ_CP017374.1|WP_016058344.1|1789346_1789877_-|hypothetical-protein
MTKFLNVIQATLKANYKKPAYWAQIIGSVLIIGLAVATVFFGVKIDANAVVLVITAVGAILAFVGVITDNSILEDTGNTIKTKSSTLAYTEQTVVEALAEAQAKIEAANSAAASQAEAQASQAVVAAYSQAASAAAVGDTATASSAATLASSLAANLDTNAQPNAETTSESASQAS
>NZ_CP017374.1|WP_085776081.1|1786897_1788109_-|FtsW/RodA/SpoVE-family-cell-cycle-protein
MSNRELGRWQQHKHIGDYGWGIILCVIILCCVGMWAVYYACLHDLKVIDTVRTTMMQCLWYLVGALIATTMLHLSENQLMQWAPIGYSIGMLLLILLLVFYSREYYVQTGAKSWFAIGTLTFQPVEVMKPLYILMMGRLIVQDQQWGPHNNFNADWRLTRRLVIYTFPIIVALKIINDFGTTLVFLTIFIGMLIVSPCRFSFLWRVLLVAGSIGVVLILLATSSTGQSLLSHIGFKLYQFDRINTWLNPSNGVSDQSYQLWQSMRAVGVGGLTGNGITYNAVYVPVRESDMIFSVVGETTGFIGCSVLLIVYMYLFYLIFRSAFASRRRFYVYVSTGVAVMLAFHMFENIGMTIGLLPLTGIPLPFVSQGGSAIIGDFMGVGLVLATQYPNARSIFSVPRIFH
>NZ_CP017374.1|WP_046810958.1|1784677_1786420_-|ABC-transporter-permease-subunit
MTSLKRGIKVRSVVGTMMCLGLSIGILLMIGWCIAKMNLPLSRLPTQGYLDTTGGKDYLTMSHLVAAALRTTTRLFIGMGCSILFSLIFGVLAARYRSARYVILPIVNLLESVPLLGFLTFTTAWFMGLFPNNVLGVETVAIFGVFTAQAWNIMLALYQSLRVTPEDLITVAKQFGCNSWQRFWRLEFLYATPSILWNIVISQSAAWFALVACEQATIMVPKNETLVLPGIGSYIQIALDTANFGAVINAVIALIICVLLVNVFIFQPLIKGTAHYKYGTSTDSQLPQQSQVYDLMVMAKVPLLVKRFHRHIRYWWLYGAPKQWQKLGFSRIIRILKKYTVYWRIAWWLVIGVGLYRLGVLLIKYLDWINLSVLFKWTFLTTSRVLIAVLLSALIFIPLAVWVASNARRLKLIQPVGQVLGSIPADIYVPIVAVMITLTGTTQHWWVIPLIMTGTQWYFFFNIIAGYLAIPSDIKDVVNVFHLSGWHWWTHFLIPSLFPALITAIINAAGAAWNADIAAELISWGTHQYAVTGLGAYIAQNINNKPAEATGVLIICVIVGLCVVLIWQPLYRFAERRFHY
>NZ_CP017374.1|WP_044430948.1|1783867_1784659_-|ABC-transporter-ATP-binding-protein
MKKAVLLDVDHVSKSFILSKQRQSELILEAVSLQVQTHQFISIIGSSGVGKSTLLRMIAGIIQPSYGVITFDGNLVTAPNRRMSMVFQNFALFPWLTVRQNIMFGLESQLNSDCQYVDTQIDNLINLIGLKGLENAYPYELSGGMKQRVGFARALAVEPELLLLDEPFSALDVLTGQRLGQDLITLWERRKFKMQAIVLITHNISEAVRLSDVIYVLGGKPAQIMNTYQIKTPRNQRTEQQIWVKTMAITDQFKRDMNEMRGD
>NZ_CP017374.1|WP_085776080.1|1782702_1783887_-|LCP-family-protein
MKCGGTEFMRRRQLPKWQRKRLIVLVTSCITFMLVAFTIQGIRLFDMLHSFHESRVIKSHHNLTQQPVSTFLLMGLDNSGKRKLSTTRTDGMMVVIVNHKTKTMTLCSLLRDTFVKIHSQQYHGYQRIESAYTYGGDAAAVATVEHYLNLPIDYYLTVNWDGFIRAIDDVGPVEVNVDRDFIGQDYWGKPEKFKAGLQSMSGARALAYARERHIDNDQHRGFRQQAVFYAMVKRLNQEGLSSKGAKVVGDLKDQMRTNLTDHDMLTLFKSRETFKRYQVKRLTFQWRTFDVAGRSMVEVYPDSCEQVSRQLQAAAGLRPDLPSQAFTTNGHYRYASDESVESKADEAKADTHYGQSHVYVGHAGNTTIGKLPTAVPLKNGFRVSDRTETMYTVH
>NZ_CP017374.1|WP_044430944.1|1781978_1782551_-|helix-turn-helix-domain-containing-protein
MVTEKLAIILGLEKTNLTKSTYFKACGIARSTFIKWQNFYMQDGLKGLKEQHNWTQYSSEIKRQAISVYLNDESSLWDIQIRFGLRSTRRLEDWINELLVHIMSRKTTFEERIRIVEYITVSEHAYSRAAKHFNVSYQQVRFWVFKTHANGYIALKDQLGRTKPIEEMTEVERLRLKKRQLKTQIKEQEV
>NZ_CP017374.1|WP_085776083.1|1795280_1797650_-|phage-tail-protein
MALNNQYLILDSNLKRIGTLTVDGATKFSNDSVKIQLADADTTSTSYDDDVNIGTQDNFNGTINLNAQSKKFDHQGSLDVLQGQPDSDKVVAGNNLAYYDALSGHWYVMRIYSVEESNTAATKHVTTANFTNLCLYTLAHHYPVAITASDSSIQTAFNQCFNATGWTLDYQTTNVMTPTITIDGKTKASTLVQTLIQAYNVEIDPYVEIDSQGNITKKVCVITDKLNTDVVYNEAVFGKNMTSIKRTTVSTPVTKLIAYGDNGNTMSEVNDGKPYIVDDAANQKYNPDWQSGLYYEAVITANSIEDPSGIKAWAEEMLQLYNHPRTYYEVSVTSKFNPPLGATIRFKDELIKPALNASGRVIQRTISFSNPYGNTVGFGEYVTVPVATPAWMQGYQSAINSAIEKAREDASSVKPVALTPDGNNFTDTAQTKRLILQAWEGNTNISAYIDNKGFIWHRYNTDGTLDTSFNQTGYLVQAAYNSVGTLHGTIETRYIQDEPEIKLKTSAIRSLGSFSPDDSTLGITEAAQYMCPLSNGQYITSRAINQSTTGDTMFVLHDTNFKPISKMIVSHGGHGSSFSIEEVSGAIYIWSATKPNLNVNEYAVSRIPYLANVTLGNDDDRITRFCTVDRYIRVSVDFKHGYVLCGYVNGKHDVLRLDEVKQGNYDVLYSFDVANYGFDESKQTYQSQGIDFPYVYFHSGDYNMKDPRMVYAVNVVHGGQEFASNYLLDMNLGLTDDVIEPETCNIIYSQTNQPELLVTFNCKYQGDSLERVFVIPIKERLPMNTISND
>NZ_CP017374.1|WP_085776084.1|1797713_1799483_-|phage-tail-family-protein
MSVLNKNDFEYAGLNSRDDLQAIMGAVTLPSAPAMAEQATDIPGMYGNQFNGMDYTSRTISIPITIIARGSQDKYKQIMHNLSGLLLSDDPSDNGKEYPLVFGFEPKVTYWGHITAISDPQFINQGAWDATLTITFVQSDPRATLPQVETPLKNGLNTITVDGTARTEPVIQVIPKRDLKYIGFSLNGGQFGLGPESPGDQATAVQPYTKVVDDPLGTMAMWTNDANAISNMKTGETYTYQGHSEIKTATNVMRPAVTSAGYDFGTIPTTGEDRWYGPAYRYTGMTNSLTDWRVRTGIHQFKYSGTHNGRAMGRVEVLLLDPSGNTIGRFGMRDMAYGAKPMARLQICEPGSTLEYGDRYTDLYYGSGPAGSFTNKPDQKIKIKTGTTTKTVTKYGRSRGKVTKKTIKETVDTYTTVVNKEEDSALAGAWLVLDITKRGQVFTWSITQYSTKTGRPFLDPNIHMLVHGTYVDTQNKYQTALGGIGSVFLKHPITEDNYKIAYRNPFMSMTDLQIWQVNKVDTTKPTYIAGAGEEIVMDCESDTVTVNGKLVSPVWSTDFPKLKPGVNGLSMIGDLDDAQMALKYLPRIL
>NZ_CP017374.1|WP_085776085.1|1799554_1804696_-|phage-tail-protein
MATEKIQGYEFAINMDDGGMTRTLREIKNEAKLLKSGMQANFAEIRSGEGIMAAYAGKVKDAGRAIEAQRLVIERLKSEQNGLDQTTQKGREAYVKYENQINAAKRSIASLEGQQERAQKSLDLQKSGVLQLKEATEISAKVTDSYVAKLKAEGHEFEANKVKASGLHQSYNELNKQLEAEQSRLNKIASASGNSSKEFKEQQIRVNELGTKIAQTRVKMKELDEQLSKKPQSGLTSVISQLNRVNEHADKANHLFGKILGAHLVASGITSAFQSITSHIHEAISAGMEYEKEQQKMTATWLTLTGAVGKSNAMVKTINDLSVKTGQAVDVVNELEQGFYHLHSNKKESDELTKSMLNMSDAVGLDKQQIQTVTQDMVNGLSRGKANAGMLNQISQYFPMFREQLAKYESGLKKTGDTAASTGKGAAKAVSAYNKKMTLMFEGMHYGTNNSLSDLETYRQKGIVSAQQFTVFSKQIASGHKVTNAEIKQAIKVNSQYAAQQETNAQKTHKSSKVTVADLSEMAKEGKISAKDIENTFNQLGSGKYDKAADNMLHTMVGMERTIKARVPALIGDIEKPILTAQNPIYGAVSKWVSDKRTDKEFNKVGVAAEKGISTITKAFAKAFDVKSAPKAMNDAMDNLAKGVTKASDSIAKNAPEIVNFFKTVKNLGGLGFETLIESLKITNAILKPLLSMVGGHTETIAKFGAAWWLTSKAVKETSSVLSTFKKISDTVSWAEKVLGIKQETKALEEQNAVLKTNAELSTASEENIGTGYRRVKGRKAGNTGADLSSISVEAENTEKIAKSSKWSLLGGTIGTRIINGAGLAMTAWDAGSSIAKAVSSGKASDKYKATGKTAGTLIGGGIGAALGSVIPGAGTAAGAMLGASIGDGVGGTKTANTIVKRISDALKGKSIEAPKIKTESTKRSLSDLGKAYSSYYSKKQKQDLNDVNVLHKAGMLTDAEYKKQLASIKKNDSETNRFEKMSASDRNAIAKYYAQQKASIISKWNARERKTSSSWDAKIASDERQFGANSIIVQKDMSKKKAAIQAEENKKSAALDKLRIKSATETTAQEARLHTTLTGKIKSAANKQNDILRNLAKSKGKITREQANDAISQSNKEYKKTVSLANQEYKDRVSAAEKQHNKVIKAAERQASEAISQAKSQYSKTVDAAKNQYSGNSKYAEKQRAAIISKAKDQKQKSIDNALEQENKTEQHADRQYKHTTDDADKQRSQVVKHAKDQNSSVVDQAKSQSKGVLGHAVKQANGSMKAADKQGSGIHSIWKNITSFFSNLVKGFGIKPINVGAYPSGYTPVTMGAYASGGIVDTARALVGEGGVEAKIDRDNGKVSFLGMNGAEVVNVKPGDQILNAGDTAKLFNGGLGHTLPGYAKGTVDIASFLKKIKSGATSIFDSVSDKAMDALSKITHPLKTLKSMALKTFDPTKTPGVGSIGHDLGKGLVDRALKGFAKAISDLADNFGGAGGSVGNPAGSSVSRWKPYVVRALKANGFGATASQVSAWMRVIARESNGNPRAINLWDSNAKKGIPSMGLVQTIRPTFEAYKFSGHGQIYNGYDDLLAGINYMKHIYGKGDSAFARVSGPEGYANGGFGNKAGVYKLFEGNLPEAIVPMDLSKRSRAYQIMQQIMAKFGAQDGANVINTGNDQIDSDEAFKQRVIASLDALVTGQGDVKAVVANSDVVNAVKSNTKKTSQYSQMMGY
>NZ_CP017374.1|WP_016058335.1|1804708_1804900_-|hypothetical-protein
MIWQLDNFIQDIDYIANQLISQGILPSDFYQSSFSEMQTALNAKSRKDRVQDPLELARQIGAL
>NZ_CP017374.1|WP_016058334.1|1804896_1805280_-|hypothetical-protein
MAKSVKFDGKKIGTGTQYTLIDSGQNVEKMAEAYKKFIKTTEETEDSITGVVELTPKLAKVVAETTCDLLELNASQKKRVMSMEFSVSDEYDFFNDCLKQFLGVELPSVGNSSDQEEEEDPKLPKPE
>NZ_CP017374.1|WP_063722569.1|1805481_1806120_-|phage-tail-protein
MATLGLNMLYTGIKADDGSTIIDADKGLSAAGVYPIDTSKANGNLGTKTANITGLSGTVSKITGNNEVVDVSNPPSAPSVAIDSNEINFIVKQKLLGRVSDGKGGYSDTDKPVEAGLIIESRSPIFRTAIYYCFGRGIFNEAGQNIQTNTDTAETRDDDNLTFTALNYDGFGGQPYKVYAESDPKFDKQAMFDAVFPGQTFYKNASNGTSGQ
>NZ_CP017374.1|WP_063722568.1|1806120_1806504_-|hypothetical-protein
MTPVAFIKSIIVTNINEIPELAVEHIHSFFIPINDTSTDEPIAVISGLPERSQDYGNGIPFQSTKQVQIQLYYPKDYLGDMDAIESGLKQVLLTNDIRCYSDAGQTLTPDSESITNTLKFNYIKEAI
>NZ_CP017374.1|WP_063722567.1|1806500_1806941_-|hypothetical-protein
MANEIKHADSFEHILDTMAEGFGREEKLKANAAGADQFIKIMKPKIPVGKLRKVHGHAEKAHLRDSLIAVDHPNGSVNVGFTAKGEKGYIARFQNDGWDVVDRNGSKHSHVSGKHFWETTQREAKGQVGKAVVEQLKTAMDKKVGK
>NZ_CP017374.1|WP_016058330.1|1806930_1807293_-|phage-head-closure-protein
MTKAINPTRMNFRLEFGTQAATGKVNPNTGNPITDFVPQFSLYAGEWSLSFQQRLALNGDTSQQNAVYFVRHNLKITTGMQLRRNHQDVYQIDDVAYDDGLPPDGFDLITCHKVVIGRGE
>NZ_CP017374.1|WP_016058329.1|1807276_1807615_-|phage-gp6-like-head-tail-connector-protein
MAADLKTLKSSLRIDGNDDDELLTGYLSAATSYIKQAIGDENGVTGFYEMEGVNDLFETAVYALAGSYWTYRTSITAIAVNPVDLVVDSIIGQLRGLYSQKQYEAGTNDESN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

317829 : 366121

Bacillus_virus(25.0%)

protease,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|317829_318393_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_072532993.1\|318586_319255_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|319412_320918_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_013355173.1\|321182_321551_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|321663_322173_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_013355174.1\|322203_323400_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|323509_323980_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641935.1\|323998_324454_+	hypothetical protein	NA	NA	NA	NA
WP_085775807.1\|324557_325130_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_025015650.1\|325295_326216_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_085775808.1\|326352_327252_+	oxidoreductase	NA	NA	NA	NA
WP_027822144.1\|329744_330191_-	ribonuclease H	NA	NA	NA	NA
WP_085775809.1\|330428_331955_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015825109.1\|331955_332927_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_024971425.1\|333004_334336_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_085775810.1\|334801_336319_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|336333_338163_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003641945.1\|338177_338900_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_085775811.1\|339486_343182_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_085775812.1\|343183_344968_+	hypothetical protein	NA	NA	NA	NA
WP_003646448.1\|344973_345207_+	hypothetical protein	NA	NA	NA	NA
WP_108725669.1\|345587_345704_+	hypothetical protein	NA	NA	NA	NA
WP_085775813.1\|345827_346745_+	hypothetical protein	NA	NA	NA	NA
WP_085775814.1\|346788_347052_+	hypothetical protein	NA	NA	NA	NA
WP_003646456.1\|347443_347689_+	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|348263_348683_+	hypothetical protein	NA	NA	NA	NA
WP_003646458.1\|348974_349439_+	hypothetical protein	NA	NA	NA	NA
WP_003643794.1\|349717_350335_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|350338_351493_-	MFS transporter	NA	NA	NA	NA
WP_003643796.1\|351496_352288_-	HAD family hydrolase	NA	NA	NA	NA
WP_003643797.1\|352358_353231_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_003641966.1\|353390_354206_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_027821507.1\|354731_356108_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_085775815.1\|356152_357337_+	cation:proton antiporter	NA	NA	NA	NA
WP_004271307.1\|357743_358667_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015825123.1\|359571_360345_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003643811.1\|360443_360602_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003641985.1\|360626_360797_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_085775816.1\|361063_363214_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	5.2e-44	27.7
WP_062688861.1\|363229_364606_+	HlyD family secretion protein	NA	NA	NA	NA
WP_027821499.1\|365452_366121_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

507133 : 544363

Lactobacillus_phage(100.0%)

protease,terminase,capsid,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021730264.1\|507133_507802_-	GIY-YIG nuclease family protein	A0A2P0ZL92	Lactobacillus_phage	5.9e-124	98.6
WP_033609226.1\|507915_508347_-	universal stress protein	A0A2P0ZL98	Lactobacillus_phage	4.7e-74	97.9
WP_033609225.1\|508446_508704_-	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.8e-41	98.8
WP_003643874.1\|508828_509005_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	2.4e-24	100.0
WP_021357772.1\|509216_509840_-	hypothetical protein	NA	NA	NA	NA
WP_003643876.1\|509932_510364_-	hypothetical protein	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
WP_174375344.1\|510373_510760_-	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	2.6e-63	93.5
WP_021730262.1\|511068_511278_+	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	5.9e-30	97.1
WP_021730261.1\|511281_511482_+	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	1.5e-30	98.5
WP_021357721.1\|511484_511757_+	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	1.2e-43	100.0
WP_021730260.1\|511895_512345_+	hypothetical protein	A0A2P0ZLA2	Lactobacillus_phage	6.2e-77	98.0
WP_021730259.1\|512331_512508_+	hypothetical protein	A0A2P0ZLB1	Lactobacillus_phage	5.7e-26	96.6
WP_021730258.1\|512500_512686_+	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	6.8e-30	98.4
WP_021730257.1\|512657_512828_+	hypothetical protein	A0A2P0ZLA6	Lactobacillus_phage	5.5e-26	98.2
WP_021730255.1\|512930_513410_+	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	1.9e-79	93.1
WP_085775831.1\|513409_514786_+	DEAD/DEAH box helicase family protein	A0A2P0ZLA5	Lactobacillus_phage	8.8e-231	94.1
WP_021730253.1\|514782_515499_+	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	3.0e-113	98.1
WP_021730252.1\|515501_516101_+	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	2.0e-91	97.0
WP_021730251.1\|516171_516966_+	bifunctional DNA primase/polymerase	A0A2P0ZLB0	Lactobacillus_phage	6.0e-123	85.3
WP_085775832.1\|516962_518228_+	helicase	A0A2P0ZLC4	Lactobacillus_phage	4.2e-227	93.3
WP_085775833.1\|518480_518822_+	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	4.7e-61	98.2
WP_085775834.1\|518992_519304_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	3.0e-46	88.3
WP_123808850.1\|519307_519466_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	3.0e-18	92.3
WP_085775835.1\|519468_519948_+	adenine methyltransferase	A0A2P0ZL79	Lactobacillus_phage	2.1e-78	93.8
WP_085775836.1\|520086_520395_+	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	3.3e-45	89.1
WP_021730274.1\|520406_520820_+	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	5.7e-69	97.1
WP_131505612.1\|520871_521573_+	hypothetical protein	NA	NA	NA	NA
WP_033609230.1\|521787_522195_+	hypothetical protein	NA	NA	NA	NA
WP_021730272.1\|522260_522476_+	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	8.8e-29	84.5
WP_033609229.1\|522459_522798_+	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	7.3e-62	96.4
WP_033609228.1\|522797_523040_+	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	5.1e-33	85.0
WP_021730270.1\|523057_523300_+	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	3.1e-38	96.2
WP_021730269.1\|523409_523697_+\|terminase	P27 family phage terminase small subunit	A0A2P0ZLC8	Lactobacillus_phage	2.2e-43	96.8
WP_021730268.1\|523693_525373_+\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	98.8
WP_021730267.1\|525391_526534_+\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	6.9e-213	97.4
WP_021730266.1\|526520_527243_+\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	9.7e-96	75.4
WP_021731060.1\|527264_528437_+\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	1.7e-110	54.8
WP_015380185.1\|528575_528881_+	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	6.6e-46	94.1
WP_085775837.1\|528861_529251_+	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	2.2e-62	87.6
WP_021357103.1\|529247_529655_+	HK97 gp10 family phage protein	A0A2P0ZLD7	Lactobacillus_phage	1.0e-65	93.3
WP_003643909.1\|529651_530074_+	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	7.4e-72	98.6
WP_021731062.1\|530088_530700_+\|tail	major tail protein	A0A2P0ZLF5	Lactobacillus_phage	9.6e-105	96.1
WP_021731063.1\|530793_531108_+	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	2.4e-51	96.2
WP_085775838.1\|531371_535916_+\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	90.2
WP_021730112.1\|535919_536741_+\|tail	phage tail family protein	A0A2P0ZLE2	Lactobacillus_phage	1.2e-150	96.3
WP_187338058.1\|538086_541605_+	hypothetical protein	A0A2P0ZLE1	Lactobacillus_phage	1.1e-83	46.2
WP_085775839.1\|541622_542114_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	2.3e-48	63.1
WP_021730685.1\|542115_542562_+	hypothetical protein	A0A2P0ZLE9	Lactobacillus_phage	3.5e-56	77.1
WP_033609296.1\|542566_542950_+	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	1.9e-66	96.9
WP_021730687.1\|542952_543147_+	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	1.0e-23	96.9
WP_015380198.1\|543146_543431_+	hypothetical protein	A0A2P0ZLE8	Lactobacillus_phage	2.0e-41	96.8
WP_021730688.1\|543430_544363_+	prophage Lp2 protein 56, lysin	A0A2P0ZLG2	Lactobacillus_phage	1.1e-171	93.5

DBSCAN-SWA_3

1250943 : 1262688

Lactobacillus_phage(77.78%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085775976.1\|1250943_1252635_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.6e-93	41.5
WP_085775977.1\|1252851_1254081_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.3e-214	97.2
WP_033608586.1\|1254171_1255143_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	5.9e-181	98.5
WP_027822909.1\|1255328_1256276_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
WP_003643097.1\|1256618_1257233_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_061876166.1\|1257235_1259674_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_085775978.1\|1259761_1260322_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	5.9e-101	99.5
WP_085775979.1\|1260392_1260833_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.8e-76	97.9
WP_015380221.1\|1260928_1261066_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645220.1\|1261692_1262688_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_4

1744322 : 1831742

Lactobacillus_phage(79.25%)

protease,head,capsid,terminase,portal,tRNA,integrase,tail

attL 1769905:1769922|attR 1838604:1838621

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072533795.1\|1744322_1745246_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003640717.1\|1745730_1746252_-	shikimate kinase	NA	NA	NA	NA
WP_085776076.1\|1746254_1747352_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_044430868.1\|1747354_1748653_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003644492.1\|1748666_1749194_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_013355607.1\|1749202_1750372_-	chorismate synthase	NA	NA	NA	NA
WP_061871736.1\|1750364_1751819_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1752467_1752821_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_085776077.1\|1752843_1755420_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_013355610.1\|1755434_1755740_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003640726.1\|1755729_1756029_-	YlxR family protein	NA	NA	NA	NA
WP_085776078.1\|1756073_1757291_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1757311_1757788_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1758083_1762397_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1762890_1764600_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640733.1\|1764639_1765917_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1765954_1766740_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640735.1\|1766755_1767535_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640736.1\|1767654_1768218_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1768219_1768942_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1769142_1770021_-	elongation factor Ts	NA	NA	NA	NA
1769905:1769922	attL	NA	NA	NA	NA
WP_003640739.1\|1770123_1770927_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1771151_1771874_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1772162_1773161_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1773245_1773551_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_085776079.1\|1773534_1774293_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645630.1\|1774404_1775040_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640745.1\|1775096_1775333_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1775430_1775670_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1775821_1776454_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_157262971.1\|1776542_1776635_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_003644502.1\|1777008_1777638_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1777687_1778857_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1778892_1779285_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|1779448_1779841_+	hypothetical protein	NA	NA	NA	NA
WP_003644504.1\|1780285_1781227_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_044430944.1\|1781978_1782551_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085776080.1\|1782702_1783887_-	LCP family protein	NA	NA	NA	NA
WP_044430948.1\|1783867_1784659_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.0e-31	37.3
WP_046810958.1\|1784677_1786420_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_085776081.1\|1786897_1788109_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_016058344.1\|1789346_1789877_-	hypothetical protein	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
WP_003644510.1\|1789889_1790153_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_044430957.1\|1790152_1791325_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.5e-204	95.1
WP_016058341.1\|1792086_1792248_-	hypothetical protein	E9LUR6	Lactobacillus_phage	1.2e-19	100.0
WP_016058340.1\|1792251_1792506_-	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
WP_085776082.1\|1792498_1795264_-	hypothetical protein	A0A2P0ZL34	Lactobacillus_phage	3.5e-194	50.1
WP_085776083.1\|1795280_1797650_-\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	95.7
WP_085776084.1\|1797713_1799483_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	96.1
WP_085776085.1\|1799554_1804696_-\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	84.3
WP_016058335.1\|1804708_1804900_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_016058334.1\|1804896_1805280_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
WP_063722569.1\|1805481_1806120_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	1.1e-116	99.5
WP_063722568.1\|1806120_1806504_-	hypothetical protein	E9LUQ7	Lactobacillus_phage	9.4e-66	98.4
WP_063722567.1\|1806500_1806941_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	5.0e-79	99.3
WP_016058330.1\|1806930_1807293_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	5.2e-66	100.0
WP_016058329.1\|1807276_1807615_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_064972053.1\|1807687_1808920_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	2.4e-203	88.9
WP_064972052.1\|1808919_1809675_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.8e-124	93.2
WP_085776086.1\|1809652_1810846_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.3e-226	99.7
WP_085776087.1\|1810848_1811043_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	4.8e-26	96.9
WP_085776088.1\|1811032_1812931_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	94.1
WP_085776089.1\|1812940_1813396_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	6.1e-80	97.4
WP_085776090.1\|1813592_1814063_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.0e-78	91.0
WP_085776091.1\|1814225_1814816_-	hypothetical protein	NA	NA	NA	NA
WP_085776092.1\|1814883_1815822_-	hypothetical protein	NA	NA	NA	NA
WP_054519274.1\|1816086_1816524_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	2.1e-29	45.8
WP_085776093.1\|1816602_1816842_-	DUF3850 domain-containing protein	J9QD24	Clostridium_phage	1.4e-11	47.4
WP_085776094.1\|1816852_1817098_-	hypothetical protein	A0A2K9VCC8	Lactobacillus_phage	4.3e-32	72.8
WP_085776095.1\|1817094_1817592_-	DUF1642 domain-containing protein	A0A2K9VCG9	Lactobacillus_phage	8.3e-30	41.8
WP_085776097.1\|1817769_1818225_-	adenine methyltransferase	A0A2P0ZL79	Lactobacillus_phage	1.2e-80	94.5
WP_187338038.1\|1818217_1818394_-	hypothetical protein	E9LUP2	Lactobacillus_phage	1.7e-22	89.7
WP_085776098.1\|1818461_1818953_-	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	3.0e-88	94.3
WP_063722553.1\|1819037_1819346_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.2e-47	93.1
WP_046038735.1\|1819481_1820267_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	4.1e-132	91.2
WP_063487061.1\|1820266_1821064_-	hypothetical protein	Q9AZA0	Lactobacillus_prophage	5.5e-52	68.3
WP_085776099.1\|1821113_1821806_-	hypothetical protein	E9LUU3	Lactobacillus_phage	6.1e-132	98.7
WP_016058364.1\|1821852_1822512_-	DUF669 domain-containing protein	E9LUU2	Lactobacillus_phage	5.5e-98	100.0
WP_016058363.1\|1822513_1823176_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	4.2e-122	100.0
WP_127064441.1\|1823184_1823715_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	3.6e-92	99.4
WP_016058361.1\|1823717_1823864_-	hypothetical protein	E9LUT9	Lactobacillus_phage	4.3e-19	100.0
WP_085776100.1\|1823912_1824137_-	hypothetical protein	E9LUT8	Lactobacillus_phage	3.4e-31	90.5
WP_085776101.1\|1824148_1824349_-	hypothetical protein	E9LUT7	Lactobacillus_phage	7.6e-27	89.4
WP_064578150.1\|1824351_1824600_-	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_064972036.1\|1824741_1825002_-	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|1825059_1825386_+	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_064972035.1\|1825501_1825711_-	hypothetical protein	NA	NA	NA	NA
WP_063487054.1\|1825722_1826430_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	2.8e-63	58.6
WP_063485655.1\|1826445_1826694_-	helix-turn-helix transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	4.0e-17	61.4
WP_154816209.1\|1826879_1827536_+	helix-turn-helix domain-containing protein	D7RWL5	Brochothrix_phage	3.5e-52	45.1
WP_064972033.1\|1827665_1828541_+	hypothetical protein	NA	NA	NA	NA
WP_064972032.1\|1829723_1830362_-	hypothetical protein	NA	NA	NA	NA
WP_053338955.1\|1830578_1831742_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
1838604:1838621	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2117158 : 2127916

Lactobacillus_phage(40.0%)

head,capsid,terminase,portal,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004271307.1\|2117158_2118082_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_003644667.1\|2118340_2119192_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_003642774.1\|2119506_2119713_-	hypothetical protein	NA	NA	NA	NA
WP_063487358.1\|2120132_2120438_-	hypothetical protein	NA	NA	NA	NA
WP_178138091.1\|2120520_2120892_-	hypothetical protein	NA	NA	NA	NA
WP_063487356.1\|2121049_2121319_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_101831631.1\|2121435_2122977_-\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	3.3e-45	26.0
WP_085764570.1\|2122973_2124074_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.2e-49	34.9
WP_062690051.1\|2125929_2126403_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_085776145.1\|2127177_2127585_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	5.4e-19	44.7
WP_072535850.1\|2127577_2127916_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	7.1e-09	35.6

DBSCAN-SWA_6

2342751 : 2351262

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085776173.1\|2342751_2343330_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	5.7e-22	33.9
WP_003645866.1\|2343322_2344348_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_003642591.1\|2344344_2345799_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_085776174.1\|2345783_2348003_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-143	39.1
WP_011101895.1\|2347995_2348676_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|2348675_2348930_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|2348931_2349663_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642586.1\|2349665_2350796_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003645861.1\|2350779_2351262_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP017375

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

21577 : 27966

unidentified_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085776374.1\|21577_22507_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.0e-25	34.4
WP_016511950.1\|22524_22737_-	tyrosine recombinase	A0A1S5SEW4	Streptococcus_phage	5.4e-07	45.6
WP_003577309.1\|22780_24619_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.6e-68	28.9
WP_085776375.1\|24811_25735_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.6e-31	31.6
WP_003580213.1\|25902_26598_+	response regulator transcription factor	W8CYM9	Bacillus_phage	8.3e-36	36.7
WP_071665527.1\|26607_27966_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-17	27.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017376

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017374

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP017375

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection