CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP019740	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-6, complete sequence	0 crisprs	NA	0	0
NZ_CP019741	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-7	0 crisprs	NA	0	0
NZ_CP019736	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-2, complete sequence	0 crisprs	NA	0	1
NZ_CP019734	Lactobacillus brevis strain TMW 1.2108 chromosome, complete genome	2 crisprs	cas3,csa3,DEDDh,DinG,RT	4	3
NZ_CP019735	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-1, complete sequence	0 crisprs	NA	0	1
NZ_CP019742	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-8, complete sequence	0 crisprs	NA	0	0
NZ_CP019739	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-5, complete sequence	0 crisprs	NA	0	2
NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	0 crisprs	NA	0	0
NZ_CP019737	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-3, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

15691 : 61454

Staphylococcus_phage(30.0%)

transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085769532.1\|15691_17485_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	1.2e-94	36.0
WP_012695389.1\|17550_17874_+	hypothetical protein	NA	NA	NA	NA
WP_085769533.1\|17998_20116_+	hypothetical protein	NA	NA	NA	NA
WP_085769534.1\|20118_20439_+	hypothetical protein	NA	NA	NA	NA
WP_039107338.1\|20458_20908_+	hypothetical protein	NA	NA	NA	NA
WP_191982523.1\|20929_21748_+	class A sortase	NA	NA	NA	NA
WP_085769536.1\|21773_22703_+	hypothetical protein	NA	NA	NA	NA
WP_085769537.1\|22751_25133_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_085769538.1\|25307_25649_+	hypothetical protein	NA	NA	NA	NA
WP_085769539.1\|25880_26996_-	hypothetical protein	NA	NA	NA	NA
WP_085769540.1\|27579_28449_-	hypothetical protein	A0A2K8I312	Pseudomonas_phage	2.5e-05	26.2
WP_085769541.1\|28937_29666_+	hypothetical protein	NA	NA	NA	NA
WP_085769542.1\|29964_30774_+	HNH endonuclease	NA	NA	NA	NA
WP_094119004.1\|30946_31717_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_085769591.1\|32097_32445_+	hypothetical protein	NA	NA	NA	NA
WP_085769544.1\|33233_33917_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-61	52.0
WP_085769545.1\|34047_34908_+	hypothetical protein	NA	NA	NA	NA
WP_085769546.1\|35048_36047_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.6e-56	38.3
WP_085769547.1\|36246_36561_+	hypothetical protein	NA	NA	NA	NA
WP_085769548.1\|36560_36815_+	hypothetical protein	NA	NA	NA	NA
WP_085769549.1\|36824_37202_+	hypothetical protein	E3W8I0	Leuconostoc_phage	3.0e-08	30.7
WP_085769550.1\|37278_38055_-	FlxA-like family protein	NA	NA	NA	NA
WP_012695418.1\|38561_39587_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.7e-41	35.5
WP_085769551.1\|39835_41011_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.0e-26	29.2
WP_085769552.1\|41226_41784_+	hypothetical protein	NA	NA	NA	NA
WP_085769553.1\|41786_42803_+	DUF3324 domain-containing protein	NA	NA	NA	NA
WP_085769554.1\|42823_43054_+	hypothetical protein	NA	NA	NA	NA
WP_053906162.1\|44513_44792_-	hypothetical protein	NA	NA	NA	NA
WP_085769555.1\|44813_45041_-	hypothetical protein	NA	NA	NA	NA
WP_085769556.1\|45293_47354_+	MobA/MobL family protein	NA	NA	NA	NA
WP_085769557.1\|47537_48662_+	hypothetical protein	NA	NA	NA	NA
WP_085769592.1\|49081_49675_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_134787804.1\|51586_52373_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_042749385.1\|52873_54232_+	SLC45 family MFS transporter	NA	NA	NA	NA
WP_042749383.1\|54247_56506_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_054646974.1\|56562_57546_+	galactose mutarotase	NA	NA	NA	NA
WP_042749381.1\|57548_58220_+	beta-phosphoglucomutase	NA	NA	NA	NA
WP_042749380.1\|58353_59283_-\|transposase	IS30 family transposase	H7BW47	unidentified_phage	2.3e-25	34.4
WP_003555349.1\|59483_60221_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.4e-59	50.4
WP_085769005.1\|60230_61454_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	2.1e-106	51.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP019736

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7482 : 70883

Streptococcus_phage(15.38%)

holin,integrase,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021350004.1\|7482_8562_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	6.3e-67	40.6
WP_134787812.1\|8563_10852_-	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
WP_085769596.1\|10872_13407_+	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_191982524.1\|13453_15526_+\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_015638646.1\|15554_17342_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_157130471.1\|17365_17509_+	hypothetical protein	NA	NA	NA	NA
WP_085769598.1\|17652_20112_+	hypothetical protein	NA	NA	NA	NA
WP_085769599.1\|20242_20575_+	hypothetical protein	NA	NA	NA	NA
WP_085769600.1\|20571_21258_+	hypothetical protein	NA	NA	NA	NA
WP_085769601.1\|21269_23279_+	hypothetical protein	NA	NA	NA	NA
WP_085769602.1\|23278_24481_+	peptidoglycan DD-metalloendopeptidase family protein	E9LUJ4	Lactobacillus_phage	1.6e-10	37.1
WP_085769603.1\|24496_25108_+	hypothetical protein	NA	NA	NA	NA
WP_052256164.1\|25173_25557_-	hypothetical protein	E3W8I0	Leuconostoc_phage	9.3e-05	30.5
WP_085769604.1\|25559_25874_-	hypothetical protein	NA	NA	NA	NA
WP_039106879.1\|26470_26791_-	hypothetical protein	NA	NA	NA	NA
WP_085769605.1\|26812_27682_-	hypothetical protein	NA	NA	NA	NA
WP_039106883.1\|28122_28380_+	hypothetical protein	NA	NA	NA	NA
WP_039106885.1\|28679_29312_+	recombinase family protein	E5FFF9	Burkholderia_phage	2.4e-18	34.3
WP_085769606.1\|29382_29745_+	hypothetical protein	NA	NA	NA	NA
WP_014386897.1\|30004_30289_-	hypothetical protein	NA	NA	NA	NA
WP_080769722.1\|30272_31172_-	ParA family protein	A0A1X9I765	Streptococcus_phage	6.3e-20	28.3
WP_075168839.1\|31742_33266_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_075168776.1\|34083_35322_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.8e-39	29.0
WP_085763795.1\|35499_36429_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	3.0e-25	34.4
WP_014386900.1\|36533_37397_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_014386901.1\|37393_38344_-	glycosyltransferase family 8 protein	A0ZYL4	Archaeal_BJ1_virus	1.4e-09	23.5
WP_075168803.1\|38361_39138_-	acyl-phosphate glycerol 3-phosphate acyltransferase	NA	NA	NA	NA
WP_075168804.1\|39361_41113_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.8e-110	39.7
WP_075168805.1\|41384_42263_-	glycosyl transferase	NA	NA	NA	NA
WP_042751137.1\|42384_43626_-	cytosine deaminase	NA	NA	NA	NA
WP_085769608.1\|43763_44693_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-25	30.1
WP_042255044.1\|44841_45123_-	hypothetical protein	NA	NA	NA	NA
WP_042255042.1\|45109_46009_-	AAA family ATPase	A0A0K2FLP4	Brevibacillus_phage	4.2e-16	26.5
WP_085769609.1\|46625_48149_+	primase C-terminal domain-containing protein	NA	NA	NA	NA
WP_052256147.1\|48857_49823_+	DUF3102 domain-containing protein	A0A2H4JAH5	uncultured_Caudovirales_phage	1.9e-30	53.0
WP_039106779.1\|49860_50049_+	hypothetical protein	NA	NA	NA	NA
WP_085769610.1\|50045_50687_+	hypothetical protein	NA	NA	NA	NA
WP_085769611.1\|50686_50920_+	hypothetical protein	NA	NA	NA	NA
WP_085769612.1\|50922_51378_+	thioredoxin family protein	NA	NA	NA	NA
WP_085769613.1\|51374_52307_+	hypothetical protein	NA	NA	NA	NA
WP_039106763.1\|52631_52946_+	hypothetical protein	NA	NA	NA	NA
WP_039106760.1\|52961_53444_+	hypothetical protein	NA	NA	NA	NA
WP_039106758.1\|53458_54001_+	hypothetical protein	NA	NA	NA	NA
WP_085769614.1\|53993_55958_+	hypothetical protein	NA	NA	NA	NA
WP_047021467.1\|56208_56427_+	hypothetical protein	NA	NA	NA	NA
WP_167571607.1\|56419_58498_+	toprim domain-containing protein	NA	NA	NA	NA
WP_085769616.1\|58823_60920_+	type IA DNA topoisomerase	NA	NA	NA	NA
WP_085769617.1\|60934_61594_+	hypothetical protein	NA	NA	NA	NA
WP_085769618.1\|61611_63507_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	5.3e-85	33.9
WP_085769619.1\|63658_64117_+	hypothetical protein	NA	NA	NA	NA
WP_085769620.1\|64137_64968_+	class A sortase	NA	NA	NA	NA
WP_085769621.1\|64988_65936_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_085769622.1\|65984_68312_+	isopeptide-forming domain-containing fimbrial protein	NA	NA	NA	NA
WP_085769623.1\|68397_69525_-	hypothetical protein	NA	NA	NA	NA
WP_085769624.1\|69514_69727_-	hypothetical protein	NA	NA	NA	NA
WP_085769625.1\|69859_70216_+	hypothetical protein	NA	NA	NA	NA
WP_039106855.1\|70293_70629_+	hypothetical protein	NA	NA	NA	NA
WP_085769626.1\|70793_70883_+\|holin	putative holin-like toxin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP019734

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019734_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019734_1

138546-138699

Orphan

I-E,II-B

Consensus_repeat	Method
GTGTATTCCCCACATGTGTGGGGGTGATCCC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP019734_1

>merge|NZ_CP019734|1|138546-138699|CRISPRCasFinder
GTGTATTCCCCACATGTGTGGGGGTGATCCCAACTAACGCTTGCCCTAGATGGGATTCAGGGTGTATTCCCCACATGTGTGGGGGTGATCCCCAATCAAAAATGGCCGTCAATCCGTCTGTATCCGTATTCCCCACATATGTGAGGGTGAACGG

>NZ_CP019734|1|1|138546-138699|CRISPRCasFinder
GTGTATTCCCCACATGTGTGGGGGTGATCCC	AACTAACGCTTGCCCTAGATGGGATTCAGG
GTGTATTCCCCACATGTGTGGGGGTGATCCC	CAATCAAAAATGGCCGTCAATCCGTCTGTAT
CCGTATTCCCCACATATGTGAGGGTGAACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019734.1\|WP_085768579.1\|149262_150009_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380322
NZ_CP019734.1\|WP_134787752.1\|135043_135265_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019734.1\|WP_085768576.1\|146102_146717_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|225462
NZ_CP019734.1\|WP_085768568.1\|133530_134949_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372109
NZ_CP019734.1\|WP_085768574.1\|143341_144508_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP019734.1\|WP_085768570.1\|137389_138211_+\|AAC(3)-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|376807
NZ_CP019734.1\|WP_021741891.1\|142275_143091_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235640
NZ_CP019734.1\|WP_024525968.1\|130907_132350_-\|NADP-dependent-phosphogluconate-dehydrogenase	unknown	unknown	gnl\|CDD\|236453
NZ_CP019734.1\|WP_039106901.1\|129883_130090_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019734.1\|WP_024525964.1\|135442_136930_-\|glucose-6-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|235579
NZ_CP019734.1\|WP_085768573.1\|141193_142036_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381314
NZ_CP019734.1\|WP_085768577.1\|146819_148289_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP019734.1\|WP_024525970.1\|128664_128928_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019734.1\|WP_085768567.1\|133007_133445_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225064
NZ_CP019734.1\|WP_085768566.1\|132494_132923_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP019734.1\|WP_085768571.1\|139020_139596_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP019734.1\|WP_039106984.1\|129092_129359_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019734.1\|WP_085768578.1\|148453_149113_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP019734.1\|WP_085768572.1\|139664_141092_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143451
NZ_CP019734.1\|WP_085768575.1\|144665_146012_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340903

Protein	Function_ID	Function_description	E-value
NZ_CP019734.1\|WP_085768579.1\|149262_150009_-\|nitroreductase-family-protein	gnl\|CDD\|380322	cd02146, NfsA-like, nitroreductase similar to Escherichia coli NfsA. This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor.	8.10913e-79
NZ_CP019734.1\|WP_085768576.1\|146102_146717_-\|NAD(P)H-binding-protein	gnl\|CDD\|225462	COG2910, COG2910, Putative NADH-flavin reductase [General function prediction only].	7.21241e-53
NZ_CP019734.1\|WP_085768568.1\|133530_134949_-\|hypothetical-protein	gnl\|CDD\|372109	pfam12440, MAGE_N, Melanoma associated antigen family N terminal. This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. The family is found in association with pfam01454. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).	6.0634e-05
NZ_CP019734.1\|WP_085768574.1\|143341_144508_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.99198e-64
NZ_CP019734.1\|WP_085768570.1\|137389_138211_+\|AAC(3)-family-N-acetyltransferase	gnl\|CDD\|376807	pfam02522, Antibiotic_NAT, Aminoglycoside 3-N-acetyltransferase. This family consists of bacterial aminoglycoside 3-N-acetyltransferases EC:2.3.1.81, these catalyze the reaction: Acetyl-Co + a 2-deoxystreptamine antibiotic <=> CoA + N3'-acetyl-2-deoxystreptamine antibiotic. The enzyme can use a range of antibiotics with 2-deoxystreptamine rings as acceptor for its acetyltransferase activity, this inactivates and confers resistance to gentamicin, kanamycin, tobramycin, neomycin and apramycin amongst others.	5.93115e-83
NZ_CP019734.1\|WP_021741891.1\|142275_143091_+\|hypothetical-protein	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	0.00230747
NZ_CP019734.1\|WP_024525968.1\|130907_132350_-\|NADP-dependent-phosphogluconate-dehydrogenase	gnl\|CDD\|236453	PRK09287, PRK09287, NADP-dependent phosphogluconate dehydrogenase.	0
NZ_CP019734.1\|WP_085768567.1\|133007_133445_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225064	COG2153, ElaA, Predicted acyltransferase [General function prediction only].	1.3486e-34
NZ_CP019734.1\|WP_024525964.1\|135442_136930_-\|glucose-6-phosphate-dehydrogenase	gnl\|CDD\|235579	PRK05722, PRK05722, glucose-6-phosphate 1-dehydrogenase; Validated.	0
NZ_CP019734.1\|WP_085768573.1\|141193_142036_-\|aldo/keto-reductase	gnl\|CDD\|381314	cd19088, AKR_AKR13B1, AKR13B family of aldo-keto reductase (AKR). Xylella fastidiosa phenylacetaldehyde dehydrogenase is a founding member of aldo-keto reductase family 13 member B1 (AKR13B1). phenylacetaldehyde dehydrogenase (EC 1.2.1.39) catalyzes the NAD+-dependent oxidation of phenylactealdehyde to phenylacetic acid.	2.41198e-133
NZ_CP019734.1\|WP_085768577.1\|146819_148289_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.16606e-55
NZ_CP019734.1\|WP_085768575.1\|144665_146012_+\|MFS-transporter	gnl\|CDD\|340903	cd17345, MFS_GlpT, Glycerol-3-Phosphate Transporter of the Major Facilitator Superfamily of transporters. Glycerol-3-Phosphate Transporter (also called GlpT or G-3-P permease) is responsible for glycerol-3-phosphate uptake. It is part of the Organophosphate:Pi antiporter (OPA) family of integral membrane proteins responsible for the transport of specific organophosphates or sugar phosphates across biological membranes with the simultaneous translocation of inorganic phosphate into the opposite direction. The GlpT group belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.45493e-141
NZ_CP019734.1\|WP_085768566.1\|132494_132923_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	7.47695e-15
NZ_CP019734.1\|WP_085768571.1\|139020_139596_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.17173e-10
NZ_CP019734.1\|WP_085768572.1\|139664_141092_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143451	cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like. Coniferyl aldehyde dehydrogenase (CALDH, EC=1.2.1.68) of Pseudomonas sp. strain HR199 (CalB) which catalyzes the NAD+-dependent oxidation of coniferyl aldehyde to ferulic acid, and similar sequences, are present in this CD.	0
NZ_CP019734.1\|WP_085768578.1\|148453_149113_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.13393e-09

>NZ_CP019734.1|WP_085768570.1|137389_138211_+|AAC(3)-family-N-acetyltransferase
MTNWQEREITRVTTAIDLYDLFDRLGLRATDSCLVHTSLSAFGYIPGGEQTLVTALKTTLSQGNIVMPAQSADYTDPREWLYPPVRQDLQAKVMAGMPAYDRTLTPCHFIGLTPEYFRTLPDTQRSGHPTCSMTAWGRNAAQICATPTLDLPFGAQGPLQKLYDLNAKVVCLGTDFETATAIHLAESTIGRPVFEEQAPISVAGKPQWRSYQMVELEPYDDFNAMGAAFCQAHPEQVVQQPLGQHHQARAIGMRALVDFAREYYREKDRREMS
>NZ_CP019734.1|WP_024525964.1|135442_136930_-|glucose-6-phosphate-dehydrogenase
MATERTALFMFFGGTGDLAYRKLYPSLFNLYRKGNLRTHFAVIGTSRQSIDDDKFRAAVKKSLADSGNRADSKEASDFISHFYYQSHDVTDTAHYSVLKELAEKLDKKYKLQGNRIFYLSMAPQFFGTIAQDLKTQGLMSTDKDAFNRLVIEKPFGRDFDSAKQLNDALSKSFEEEQIFRIDHYLGKEMIQNIEALRFGNTLVESLWNNRYIDNIQVTLSEKLGVEERASYYDNSGALRDMVQNHIMQIVSLLAMEQPVAFTDTDIRAEKVKALRSLRVYNVADAATNFVRGQYGSVNDQPDYRHEDNVPVDSTTETFVAGKLLFDNYRWSGTPFYVRTGKMLADKFTRVDVVFKRPLVDIFAFPQSQNTPLAANVLTIFVEPHAGFSLQLNAKTNDTGFQTEPIKLDYIVGAEKSKDTPEPYERLIHDVLKGDGTNFSSWPEVSYAWKFVDQIRRVWDLQEPNFPNYTPHSMGPAAAEELIQRDHREWIYRLNN
>NZ_CP019734.1|WP_134787752.1|135043_135265_-|hypothetical-protein
MTFSPLNVPILLLSTSLLTLTLANVQPVTAHATATSVSLAEKTTTSTATAQLFTSPVNQPLTLTGRHVPALQR
>NZ_CP019734.1|WP_085768568.1|133530_134949_-|hypothetical-protein
MQENPDRFIKYDATTINLKHTLTLNFSDPDGNTIKGPLMFRMTQGNDFDAIASDLKDQYAAVIDGYVFNKTTVDNTTDPYNTQFNFSYDKAGGSSTDESHTSIPASSLPSLSTLTNEKIRLTSPSDYSLYDNDGEELTTGKTTVAGSSYYSATGLYLFHQKLTNADNVFYQISPDAFIKDDDTTALTSPITFKYETSDGQSIKTDSMLDTGLVTGDDLNNLIKELQTWQPTIDGYTYQGVSPTADTLTFKYTPTSASSSSDTSSPSSDSSQSSSSTSTDSTASSSQTSSSTSTDSTASSDTYNSVVTSASSTRPDKSIVPKGAAVTAIRKIGVYRDVQFTKQNRRHWYQRQPQTKRPQFVVTGYARTKAGTLRYQIRDVNHHSATDGQRGYITANSKFVMPTYYQTAPKRIKVISPHGVNAYRQINLTQKKRHYRVGTTITVKAIKSYHLTTRLVLSNGTYVTANKILVAKK
>NZ_CP019734.1|WP_085768567.1|133007_133445_+|GNAT-family-N-acetyltransferase
MEWQAKSFDELSREEFFDIAYERIRTFVIAQHRPYQEIDATDKVARHILGYQAGQLVAYARVFREAGHVTFGRVLTIPEQRGTGLGRQLMVQIEAKIRRNFAGEAISIEAQIDKQHFYEKFGYAAIGAVFDFNGTPHIRMDKAGL
>NZ_CP019734.1|WP_085768566.1|132494_132923_-|winged-helix-turn-helix-transcriptional-regulator
MPNAFRIIGLIARATAAMGNQLFQADDLNNNQFIFLMRIVETPGITQAELATQLHVDPSTCLRAVRKLIATQYVTRGTDAHDKKRRPLLATAKGQAMYPALEDYEQQILSVGTQGLSTGETALLEELLAKVARNVRDYQNQH
>NZ_CP019734.1|WP_024525968.1|130907_132350_-|NADP-dependent-phosphogluconate-dehydrogenase
MADQKANIGVVGMAVMGKNLALNIESRGYTVGIYNRSANKTEQVMKDHSEKKLVPSYTVEDFVKSLETPRRILLMVKAGKPTDAVIHELLPLLDKGDVLIDGGNTNFHDTMARNAELDKSGINFIGMGVSGGELGALQGPSLMPGGQKEAYDLVAPILEKIAAKAPQDGKPCVTYIGPNGAGHYVKMVHNGIEYGDEELIDESYNIMRNVAGISVDDMADIFKEWNKGELDSYLIEITADILTRKDDLGDDKNLPIVDAIKDRGNNKGTGKWSSEDALDVQVPQSVITESVYARYISMLKDERVKASKVLPAAEKQGKADIADKDKFVEEVRQALFFGKLMSYAQGFEQLRFASEANDWDLKFGELAQIWRGGCIIRAQFLQNITDAFDKDPKLSNLLFDDYFKDIAGKYQQSIRDVVAMAVQAGIPVPSLSAAITYYDSFRAEVLPANLLQAQRDYFGAHTYERNDREGNFHYSWYEEQ
>NZ_CP019734.1|WP_039106901.1|129883_130090_-|hypothetical-protein
MKKLFASYSKWFRGLAYLAGPIITIEIVSFLMFLADLLQLGCAVFYVIFFATFLIESLSHGIHDLKTK
>NZ_CP019734.1|WP_039106984.1|129092_129359_-|hypothetical-protein
MQKFEAQLSSLPPAEQRWQSGWLSSLISNLLITGAFVATYWWPVSPSVATTLSSLALLSWLIWFILWFGHLTHRLKISEDKFNKQKND
>NZ_CP019734.1|WP_024525970.1|128664_128928_+|hypothetical-protein
MTENVVLAPPEALELAKHLDEWAKWRQTHDRTTADMDWDQFIAKSREKAQWQAGLATEIDHWESLHAIQLALTDNLMGTAHGGHTRQ
>NZ_CP019734.1|WP_085768571.1|139020_139596_+|TetR/AcrR-family-transcriptional-regulator
MREKDTAKQTSIIDEVSNIILNEGIAAVSMSKIAKASGISSSTIYVYFTDKEDVLKQVYLAKKEMLATFLLKNIEATTDNPVIFTQQFMRALYEFGMQHYEALMIIEQFNSSPVRNNLQISQAESYRGFERLFEATSHAPQFVTDSAAVILGFAYAPIVLYVKARKTNQLAAQTISIEQVIDMCMHALLKE
>NZ_CP019734.1|WP_085768572.1|139664_141092_+|aldehyde-dehydrogenase-family-protein
MTTNVEMTKIFEDQRQQYNRAQPMSLATRLATLDQLERLLRENLNAFVEALQADFGQRDPLQIIGADLTGPLTTIAYTRKHLRKWMKPDKKRLGLMGLSGSREYIYNEPLGVVGIMSPFNAPIDLALDPAIEAIAAGNRVMVKISEYTPKAAALLQKLAKKYVSETTFAVITGEADVSAHFSALNWDKFVFTGGSETGKKILAAAAPNLIPVVLELGGKNPAVVLPDANQQLAAEKIARGRSGNSGQICLDVDYAMVPANQLTDYIHLIVEQLEQAFPTYSDNPEYSAIINDAAYKRITGMLAEAQQRGTQLLTINPNHDAVPDATKRLIPLTLAINPDPDLQIAKNEIFGPILSIFTYETLDEAIAFINTHEKSLAMYVFGKNKAQLDRVIRHTSSGGVDINELALHAGSHEMGFGGVGYSGMGRYKGGKVGFETFSNPKSIYKQGILAKYTTRFMVPIHSQRNEKRFKKMLGL
>NZ_CP019734.1|WP_085768573.1|141193_142036_-|aldo/keto-reductase
MEKTFTFDSDLTVNRLGYGTMQLTGDGVWGPVADPDNAVKVIETAIDHGVNFIDTADAYGPFYANLYLRDALKNRPDNHVMVATKVGNTRQGPDVWTPVGVPAYLRQQVEMNLFTLGLDHIDLLQLHRVDPNVPLADQIGVLKDMQDEGKIKQIGLSQVSVDQLKEATAIAPIVSVQNMYNLSNRQDEDVLDYADAHHIAFIPWFPLATGELIKDATLTNIAQKYNASPAQIALAWLLKRSDVILPIPGTKSSDHELQNIQAQDIDLSQADFDALKALAK
>NZ_CP019734.1|WP_021741891.1|142275_143091_+|hypothetical-protein
MKKFMVALTGLVTLATVGATVPATAVTTAHAATKSTYVSPSLKVNAIYTTSTKVAGTATKGSKITVKATKNAKTNLASGTASKTTGKYSIKLSKKLKKNANVYVYATNSKTKAYFYRIIRVQAASTKAATTKSTSTKKTTTKKTTTKKSTTSSKTSAASFSVKTPTGTWTSNTANKYSQKWVFSQKTGLNEYLYKNGKKVKTLVSYAKYSVSAKTPTFWKITYTPKGSKTKQTMYLRFTSAKKFKVVNSKNQVISTKAGVAPAAKWAFTKA
>NZ_CP019734.1|WP_085768574.1|143341_144508_+|MFS-transporter
MWKTKKEVSLVGILSATLLLNAAAACMWPLTTVYMHNQLHQTLALAGVALLGMSLCMIVGNWLGGWLFDNWSPFKSALVGTLCSFIPMLTLIVFHGWPIFGIMLLFIGLGDGIVMTVVNSFAANIKEISSRRVFNWLYIGMNLGVVVGTLMVGVLMDHGVQLVFMVASLSYAALLVIFVVDFRMDIQTKTHQHVKGPAKPAQLQLIWLIAAMVFCLYLSYSLWESVISVHMTNLGISFEKYSLLWTLNGLLIVFGQPLANRIGTYFKMSSQIAVGTLIFILSFLLLVFARDYTMFVVTMVILTVGEMTGFPGIPAWIDGLAGDNDKGKFQGIYNMAISFGRAVGPLYGGLIIEYGSYQLLFWSVTGLMLVALAAVMLRNHHNLTRVKK
>NZ_CP019734.1|WP_085768575.1|144665_146012_+|MFS-transporter
MFSFLKPAPDAKVKVPAEKVVGTYRLRQTGVLLSICIGYIGYYIIRLIFTTEQNDIMKAYGFTTADIGLVMSCFGIGYGISKLFMGALSDKSNPKWYLATGLFISAILNFGLGSTRNLYVMMLLMLVMSVAQGMGAAACQRTVQLWWGKKWRGTVYAVWSSAHNAGAFACVAVVQIATLMFTHSIAAVFYTASVVSIVIAIFIVLAGADRPATVGLPSIGEYTGDKVVLDDGQATRAELTDLSLWQIFVRYILTNKVVWAITLTSMSLYLVRYGIMSWIPSYLTQFKGFDPGTAKWLVGIFELAAVPGVILMGAISDLLKDRRAIVCIGCVIGLLICLTTYFFSTSHLAIIIVLLIMGSLIYAPLTLVGLMVNESVPKFAVGSSTGFMGFFQYIFGETLATALIGILVAKFGWIASNTVLYTAAGLALLLLCYIAIHEHHVAKIAAGE
>NZ_CP019734.1|WP_085768576.1|146102_146717_-|NAD(P)H-binding-protein
MKLAIIGATGKTGNAVLEVARTRKITVTAVVRNAAKLTEPVSVIEKDIFALTPADLQGFDVVICAFASSKKSDYPRVNQHLVEILTGTDTRLIVVGSGATLFTDETRQKTVGDELPLIMRNSSHKHLQARQILQASRLNWTYMAPPMNYVPDGNATGSYQVGHDVLLYDRHGDSTISYADMALALVDEVEHPQNERQLMTVAWK
>NZ_CP019734.1|WP_085768577.1|146819_148289_-|MFS-transporter
MTETRRRIITFGLLLANIMAGFEGTIISTAMPTIVADLHGLSLMNWGFTIYFLFNAIGTPIWGRVADIIGRKRSFLFGTAIFVIGSLLEGLATNMIWLIIARGIMGIGAGGMLAIPFIIFSEIYPVDQRASVFGFTAAFGGISAVCGPLLGGWIIDVLNWHWVFFINIPIGIISILIVYFAFREESKERHAKIDVWGSLSLSIVILAFLLGVQLIGQAHTPAIWAIAFLLVAIVFGFLFVRIERNTHDPLIPLHLFKNKDMLLWDLMAFVGMGFYISFSVYIPMWAQGILLTSALAGGATQIPTAGLWYSGSRFGSYLSKKRNHHLTAVLALSFALIGTLVLLALGMTPNYAFFIIVGALLGIALGMLLTTSQVGVSEAVTSNDLAVATTLNRLFNTLGQTIMTAIYGLVFNIVVNHQATKLGLPSAKISGLTNSAVTSDSKAQLLIMHHVLFAGIKSVLIVAFVLLLVALVLEIGNIHLTRIKKHSVQ
>NZ_CP019734.1|WP_085768578.1|148453_149113_+|TetR/AcrR-family-transcriptional-regulator
MATENERRQQMIRRITQTIVQNGFADLKMEKIAKLMGVSRTKMYQYYSSKTAIMTDVVARYLEFMATRSVPQSVDAKTSVTNFPQVILNLANLIASSSQKFRRDLAQADEELSEQFEESYASWCHQVRDFLANGVTNGAFNSSLQPELFLIQMEATVAALMQPRVLTQHKVVTQNVLREYLQMIITQVVAPKYRAQINLDAVEPDLEHLTLKYQQTLTK
>NZ_CP019734.1|WP_085768579.1|149262_150009_-|nitroreductase-family-protein
MNPTLTTLFNHRSIRQFTPEKLTTDEVATLITAAQHAATSTFSQQYSVISVTDSAKLAVLGDITGHHWLEKAGHYFVMVADQYRNQQLVPPTATTTTNLHSLDKLLAGVFDAAIATEAIVTAGESLNLGSTIMGSILNDAARVIDLLDLPKLTFPVLGLAIGHPTEHPEQKPRLPQDLMHFTNGYQALTADNARLAAYDQVIHDYYQQRGTHQRDETFSHHIVSEMSRDPQQRAGILQALQKQGFLTK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019734_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019734_2

1217609-1217943

Orphan

I-E,II-B

Consensus_repeat	Method
GTATTCCCCACGGGTGTGGGGGTGATCCT	CRISPRCasFinder
GTATTCCCCACGGGTGTGGGGGTGATCC	CRT

5 spacers

The CRISPR arrays of NZ_CP019734_2

>merge|NZ_CP019734|2|1217609-1217943|CRISPRCasFinder,CRT
GTATTCCCCACGGGTGTGGGGGTGATCCTAGGTTAAGCCAACGTTGCTACCAATATTGACAGTATTCCCCACGGGTGTGGGGGTGATCCTGTACCCCTCACAGACTAACGTGATTGCCGTTAGTATTCCCCACGGGTGTGGGGGTGATCCTTTGAAAAAGCCGAAATGTTGTCAATCAAATCAGTATTCCCCACGGGTGTGGGGGTGATCCCGACGGACAAATTCGTGGCCGTATGGGGATTCAAGTATTCTCCACGGGTGTGGGGGTGATCCCTGGTGTAGTTGGCCGAACCCGGGATCATACGGGTGTTCCCCACGAGTGTGGGGGTGATTCC

>NZ_CP019734|2|2|1217609-1217943|CRISPRCasFinder
GTATTCCCCACGGGTGTGGGGGTGATCCT	AGGTTAAGCCAACGTTGCTACCAATATTGACA
GTATTCCCCACGGGTGTGGGGGTGATCCT	GTACCCCTCACAGACTAACGTGATTGCCGTTA
GTATTCCCCACGGGTGTGGGGGTGATCCT	TTGAAAAAGCCGAAATGTTGTCAATCAAATCA
GTATTCCCCACGGGTGTGGGGGTGATCCC	GACGGACAAATTCGTGGCCGTATGGGGATTCAA
GTATTCTCCACGGGTGTGGGGGTGATCCC	TGGTGTAGTTGGCCGAACCCGGGATCATACGG
GTGTTCCCCACGAGTGTGGGGGTGATTCC

>NZ_CP019734|2|1|1217609-1217942|CRT
GTATTCCCCACGGGTGTGGGGGTGATCC	TAGGTTAAGCCAACGTTGCTACCAATATTGACA
GTATTCCCCACGGGTGTGGGGGTGATCC	TGTACCCCTCACAGACTAACGTGATTGCCGTTA
GTATTCCCCACGGGTGTGGGGGTGATCC	TTTGAAAAAGCCGAAATGTTGTCAATCAAATCA
GTATTCCCCACGGGTGTGGGGGTGATCC	CGACGGACAAATTCGTGGCCGTATGGGGATTCAA
GTATTCTCCACGGGTGTGGGGGTGATCC	CTGGTGTAGTTGGCCGAACCCGGGATCATACGG
GTGTTCCCCACGAGTGTGGGGGTGATTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019734.1\|WP_085769500.1\|1218556_1219564_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP019734.1\|WP_085768959.1\|1220436_1220922_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP019734.1\|WP_039104720.1\|1211213_1211699_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP019734.1\|WP_085768958.1\|1219697_1220348_+\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP019734.1\|WP_039104717.1\|1213227_1213833_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP019734.1\|WP_039104718.1\|1211807_1213241_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP019734.1\|WP_085768961.1\|1223594_1224017_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|378454
NZ_CP019734.1\|WP_167571572.1\|1214944_1215397_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133380
NZ_CP019734.1\|WP_085768956.1\|1215518_1216958_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP019734.1\|WP_085768962.1\|1224095_1225358_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181958
NZ_CP019734.1\|WP_085768957.1\|1218081_1218435_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP019734.1\|WP_024525308.1\|1214336_1214783_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
NZ_CP019734.1\|WP_085768960.1\|1222844_1223390_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP019734.1\|WP_085768964.1\|1226170_1226995_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP019734.1\|WP_085768963.1\|1225489_1226086_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP019734.1\|WP_011667631.1\|1221284_1222751_+\|catalase	unknown	unknown	gnl\|CDD\|365942
NZ_CP019734.1\|WP_039104721.1\|1210719_1211124_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP019734.1\|WP_085768954.1\|1209874_1210711_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|181334
NZ_CP019734.1\|WP_039104716.1\|1213893_1214340_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP019734.1\|WP_021742599.1\|1217087_1217399_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|374224

Protein	Function_ID	Function_description	E-value
NZ_CP019734.1\|WP_085769500.1\|1218556_1219564_+\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	4.94822e-162
NZ_CP019734.1\|WP_085768959.1\|1220436_1220922_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	6.00958e-12
NZ_CP019734.1\|WP_039104720.1\|1211213_1211699_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	8.72488e-09
NZ_CP019734.1\|WP_085768958.1\|1219697_1220348_+\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	7.56829e-45
NZ_CP019734.1\|WP_039104717.1\|1213227_1213833_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	1.19425e-26
NZ_CP019734.1\|WP_039104718.1\|1211807_1213241_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	5.13412e-47
NZ_CP019734.1\|WP_085768961.1\|1223594_1224017_-\|SRPBCC-family-protein	gnl\|CDD\|378454	pfam10604, Polyketide_cyc2, Polyketide cyclase / dehydrase and lipid transport. This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis. It also includes other proteins of the START superfamily.	0.00156273
NZ_CP019734.1\|WP_167571572.1\|1214944_1215397_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	4.38131e-19
NZ_CP019734.1\|WP_085768956.1\|1215518_1216958_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12069e-89
NZ_CP019734.1\|WP_085768962.1\|1224095_1225358_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|181958	PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed.	3.85122e-59
NZ_CP019734.1\|WP_085768957.1\|1218081_1218435_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.27914e-40
NZ_CP019734.1\|WP_024525308.1\|1214336_1214783_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	3.7729e-19
NZ_CP019734.1\|WP_085768960.1\|1222844_1223390_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.44535e-25
NZ_CP019734.1\|WP_085768964.1\|1226170_1226995_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.84758e-10
NZ_CP019734.1\|WP_085768963.1\|1225489_1226086_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.57049e-05
NZ_CP019734.1\|WP_011667631.1\|1221284_1222751_+\|catalase	gnl\|CDD\|365942	pfam00199, Catalase, Catalase.	0
NZ_CP019734.1\|WP_039104721.1\|1210719_1211124_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.81732e-44
NZ_CP019734.1\|WP_085768954.1\|1209874_1210711_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|181334	PRK08263, PRK08263, short chain dehydrogenase; Provisional.	7.80098e-86
NZ_CP019734.1\|WP_039104716.1\|1213893_1214340_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	2.23902e-27
NZ_CP019734.1\|WP_021742599.1\|1217087_1217399_+\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	1.83833e-05

>NZ_CP019734.1|WP_021742599.1|1217087_1217399_+|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MTKANIVTYPAVFHDNEAGGYIVTFPDIEEAMTSGQTLGESLVNATTVLGQTLHHHPMVLPTATTITELMHQYPMAFIQFVAVDLDQVIEHAVPTDQADLQLT
>NZ_CP019734.1|WP_085768956.1|1215518_1216958_+|multidrug-efflux-MFS-transporter
MTTDITGKPYNRAMMVTILLIGTFLNVLNQTVLATAFPDLMKAFSINATTVQWLTTGFLLVNGIMIPLSAWLSTQFNSKWLWISAMTIFAGGTILCWAAPSFAMLLSGRLIQAVGVGVAMPLLQTIMFSIFPPEQRGSAMGLVGIAVGVGPAIGPTLAGFVVDNGSWRNIFGIMIPIAFVIILLSFFFMRPVIENRRTHLDVLSLILSSIGFGSVLYGFSTVGQNGWTDSTVITALAVGVIFVAVFAVRQLTISEPFLELRVFAKGQFTVATILGAIANTAMTGAELVLPMYLQIVRGQSALISGLTLLPGAIVIALMNPITGRIVDRIGGRELSIIGLACLTLGTLPLCFLQSDTALWWIILVYAVRMLGVSMVLMPITTVGMNALDRSLIAHGTAVNNTVKQIFSSIGTALVVSIMANVTKGNMPNARLYIKQPTLLHHLIMNANLDGYTAAFIVTAAMSFLGFLMAFLVKRSTKKA
>NZ_CP019734.1|WP_167571572.1|1214944_1215397_-|MerR-family-transcriptional-regulator
MTVTDNFSNWLNLIQQVSQPEGITLGTSDLVKATGVPASQLRYWVEQGYIKPIDVPNERSRKFSYRVVFRVRAIKYFLNHGYTLSAAMDNVNQFRNLDIQLQRILTDHLTDLQLHEDGQIDISLGTVQDGQELLGLTIKDGSSQFWTKKV
>NZ_CP019734.1|WP_024525308.1|1214336_1214783_-|LytTR-family-transcriptional-regulator
MHVTFNLKASFIPPFITINAPAETPELQHLAANISQLTNSQLIAGISPRGTRELVPVNQIIRIHTDAKHVVMETKATTYTLPQRIYQLKQLLPSDLFLQLSSGELVNRQHIRHFSLTPSGLYQVLLSTGATTFVSRRCMQQIRKEFLK
>NZ_CP019734.1|WP_039104716.1|1213893_1214340_-|DUF3021-domain-containing-protein
MKRLGILTSGAFLGLSIGFLCALFFSLTNHATTFMPSSPDFVAHFSSNTMATLAAAGLWAAIGLLFGLTSLIFFNEHWSIARQTIWHFGLSYLGFTPLAILAGWFPLNVTWLLLYTLIFIGIYLVIWTYSMLRARKTVQHLNDTLSHH
>NZ_CP019734.1|WP_039104717.1|1213227_1213833_+|NAD(P)H-dependent-oxidoreductase
MMQINLVLGSSREKSLGRRVFNYLKNQQNDFEQQSAVHLNFLAVGDYQLPFFYEDVAPMNNQDRHLPAQQQAWLDDMEQASGYIFITPEYNHSFPAVLKNGLDYLAFQTAKKPALIMSYSDNARAGQFGGVDLTPVLTRLGMTVLPPLVGIGNVQKNFNEAGEFLENAPSKDFYHQKLQQTVEKIAFYSRLFADNPFTPQS
>NZ_CP019734.1|WP_039104718.1|1211807_1213241_+|MFS-transporter
MKTQAIRWWVLACIGIMTFMDDLDASIVNVALPVINRALAINMGVAELIVSVYLITICVFLLPFGRLGDTFGKVRVFKWGMWLFVLGSLGCGLSPNIISLLLCRLIQGLGAAMTMSTNNGIITESFPINERGRALGWIGSFVALGMIAGPGIGGLLLSFLPWESIFWINVPIGLLLMGLGHAVLTTETGSDDRPVFDWLGSGLVGIGISGFFGYLYAGQQLGYGQPLLVGLLAVAIIATMVFILYEIKCQQPLLDLKIFRKTDFTVGVGTALLVFVANNFYMVLTPFYLENAKVIGASVAGLIMMILPVVQVLMAPIAGRIADNQGPFKLCLTGLLIILSAQIGFVLINQQTPLTLVGGLIGLLGLGNALFQSPNNALIMGAVEQTQLGVAGSVNALSRNIGMVLGNALATSLLFVIMSALTRSKVTNFDGHFKRAFITGQSWVYLLGSLLVLLAIGLVSFNTWKNKKMEALSDDAN
>NZ_CP019734.1|WP_039104720.1|1211213_1211699_-|MarR-family-transcriptional-regulator
MISSANAKNLMACISQLLTQDTTVDQEKKWMLSQVATDTALTATIKALRTADFHTIATISTLTPAYLKSLPEKTGLSQPTISRMMTRLSHHDLVEKYRTVTNSKDILVRLTPKGTQIAEIHAQLDQRILNNVAQVLEPYSQTEVTTTIQILQEIAKIDVNR
>NZ_CP019734.1|WP_039104721.1|1210719_1211124_-|MerR-family-transcriptional-regulator
MEYTMSDVCQKFNLSEYTLRYYDKINLIPGVYRNEQNRRVFTEDAVGWLQFVIALRSTGMPIADVKKYIALTTTTDDSTIQARLTMLQKQAAKVDSQIADMHKQRQIIADKINHYQQVMKTAPDPTKKSYQRWV
>NZ_CP019734.1|WP_085768954.1|1209874_1210711_+|SDR-family-NAD(P)-dependent-oxidoreductase
MTKTWFVTGSSRGLGRAIVENSLSNGDNVVATAKNTASLADLAAEYGEHIYPLSLDVTDVDAVDAAIQMAIQHFGTIDVLVNNAGFADMDSVEEMPLATFKAQMDTDFYGTLYTIRAVLPTMREAKAGRIINISSIGGRIGGAGLSAYQSAKFAVNGLSEVLVHEVQSFGIQVTTVEPGGMRTEWGGDSMKAASSDLYKDSVGQAISMIHDQWHHAGDRYVSEPDKVAAAIHTLSEMPQAPVHLLIGKDAEQAAQQNAETLAKNDMANRSLTESTGNR
>NZ_CP019734.1|WP_085768957.1|1218081_1218435_-|MerR-family-transcriptional-regulator
MKIETVAQRYHISTSAIRYYEQQGLIGPINRINGIRDFNTTDLERMDFILCVKQCGMTIKQMKQFIATYEQGDSTLRERLAILQAQLSASEEQRTTLTRSINHLKQKIGDIRIHLAE
>NZ_CP019734.1|WP_085769500.1|1218556_1219564_+|aldo/keto-reductase
MQYTKLGHTEIMASKICVGAMSFGQPGTMHDWTLDYPASERVIGHALSLGINFFDTANGYSAGTSETYLGRALKAQRVARDQVVLASKVYFNPGRLSAKAIHHEIDGTLKRLGTDYLDLYIIHRFDYDTPIEETMAALNELVTAGKVRAIGASAMYGYQFNNMQQVAKDRGWAQFQTMENHYNLLYREDERELIPICQQQGVSLMPYSPLAAGHLSHSAWQVDTLRSQTDRVAMGKYDRTETEDKRIVARVAELAHKYQVSMTQIALAWQWAKGVAAPIVGSTKTSHLDEAVAALSVKLITADIDYLEDLYRPHPIVGALDHNPAAGTILIDQKK
>NZ_CP019734.1|WP_085768958.1|1219697_1220348_+|nitroreductase
MDVLEAIKDRHATRAFDDKAIDDQNLTAIVTDAQRTPSWGNSQPWEVYIATGKSLEQIKSRYAAAAQAGVTEAADLAKAHRGDFSTMANQNMGHWVGTFRPIIESDPTTYWDSRENLYRAPAIAYLVLGQNPNSWSIYDLGAFSQTLSLAATARGVQSLSSYELVKYPDILRQELAIPTDRTIAMGIALGYEKPDKVLNQFRTDRVATQQILHIQH
>NZ_CP019734.1|WP_085768959.1|1220436_1220922_+|GNAT-family-N-acetyltransferase
MKITDATLADLPEILRIEQLGFTAEEAGTAEQYQDRLARLAGTFLVAKEKHKLVGFVVGAATQEPYVADWMFEHTPTSLPTGGHQLIYTIAIDPAYRGHGLGSRLLVALQERAQNAHRETLSLTSLERNVPFYLKNGFENHGVANSTHAGEVWFNLVKPLY
>NZ_CP019734.1|WP_011667631.1|1221284_1222751_+|catalase
MREDLKNSAGQPWGDNEHSLTAGQRGPVLIQDYNLLEKLAHFNRERIPERVVHAKGAGAEGTFRLTKDMHQYTKAKIFTEMGKSVPMRIRFSQVAGEMGSADTVRDVRGFALRFYTDDGNYDIVGNNTPVFFVNDPLKFPDFIHSQKRDPRTHERSQDMQWDFWAHSPESVHQVTILMSDRGIPASYRKMHGYGSHTFKWVNEAGEVFWVKYHFRTAQGIQNLSNDVAQRLAGENPDYLQADLYHAIEAGDFPTWKVCVQVIPEQAGLDYPADIFDVTQVVSQKDYPLIEIGEFTLNKNPDNYFEGVEEAAFSPANLVPGIEPSPDKLLQGRLFAYKDAARYRLGVNYEQLPANRPLNHPNNYERDGFMQTDNHGDQVNYEPNSQGGPQEDPAGRLTPYTVSGKAGNYAYQTDYGRAAGKLYRLLPADERQRLIETIVMNLGQVKSHDVKRLETAQFYEADHDYGLAVAKGLGLKLDEIKDYPFDTTH
>NZ_CP019734.1|WP_085768960.1|1222844_1223390_-|GNAT-family-N-acetyltransferase
MENLHLTDHLALVAPVSPLAADLYALIAADRANLSRWLPWANTMHEVADEAAFLTYAQGQIAAHQLWLAIITVNGKPAGMIDLHDKKDGHADVGYWLGCPYRGHGYISQSLQALEKLAFNDWQLNKLQILTVPDNIASQAVAKSNHYHRDARLPKHIPTLAGDYQDAIIFSKLRQDWLAQI
>NZ_CP019734.1|WP_085768961.1|1223594_1224017_-|SRPBCC-family-protein
MTDQKLFTNTVLIPADATRVHATLTNPQNLLKWVPEITAVDPETNVFVITRTRAAINQHEVLTVTSNATTVTYTSREGRLPYQLVFTIVGQASQTLLQETLFVPRNTGLPLTLLSPIAKQALKQNLEMLAILLRRPAMPD
>NZ_CP019734.1|WP_085768962.1|1224095_1225358_-|FAD-dependent-oxidoreductase
MKLLVVGSSHGGRAAITAALAQDATIEIDLIEAGPVTTVYPTQVKVHANTRAIQLLATQHQLLISHAGQKQRLSYDKLILAPGAQATIPAVLSTTSQNVLPMRTRAQINHLKAAATDATIHHVIVIGGGYIGVGAADLFSQHGKQVTLIEHGPQLLGSYLDNDFLMPIQQALQQQGVTVHVNELVTGLTGAPDVTGVTTNQTTLSADWVVVATGTTPNTDWLKGTLDCLPNGLIKTDAYLQTSATDVFAVGDAIAVTYLPQHQSRSIALASNAQRQGELAALNLQTPVLPYTGVFGTSQWQAGHLQFGVTGLTDTAAQRANISHTSVTLTQDQRQSPNPAIPTKHVQLRLTYDPQSKQLLGAQVLADGNIDELINLLALALQAQQTLADLAVADFYMSPGKNDLPHLINAAAMTAYRQEK
>NZ_CP019734.1|WP_085768963.1|1225489_1226086_+|TetR/AcrR-family-transcriptional-regulator
MGTRRRGDELETAIYQVTYQLLATNNGTALTFSQVAKAAHTSRTVLYRYWESPFDLVLATLTHYRQQDPQSMQLEHIDQGSLRADLIYVGTSFAQAATTGVSQHFRQLFSLAIDEQDQRQLAKILSLSTTANLTLMQQVVENARRRHELLRTPPQTTLLAMFNQIRYVTMIGGTIPGEIEITRLVDDLILPAMQQLGR
>NZ_CP019734.1|WP_085768964.1|1226170_1226995_-|helix-turn-helix-transcriptional-regulator
MPSQLGITLKQVRLQQHLSQATVATGICAQSMLSAIENGKYTPNATLLMRLCQRLKISLDQLSLAENFTISDLEQINDRLAKLCNHHRYTDLREFLLTDAVQARLTTDVQLAAYYYYLGITDFQLGHLTDAQQQFQLALASAPAQHRTTLSRLCRMSLALIHASRQQSNASEEAMTQAVTQLKTAPYEANLNSLFYLAAVSHLKLNHLTAATQWLKRGISFATDHDSHYMLANDYHLLAVIASRSEQIDQQRTAQATEHVLTTLFHESIYDRLD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019734_1	1.1\|138577\|30\|NZ_CP019734\|CRISPRCasFinder	138577-138606	30	MN830254	Lactobacillus phage JNU_P2, complete genome	35524-35553	0	1.0
NZ_CP019734_1	1.1\|138577\|30\|NZ_CP019734\|CRISPRCasFinder	138577-138606	30	MN830255	Lactobacillus phage JNU_P4, complete genome	22047-22076	0	1.0
NZ_CP019734_2	2.1\|1217638\|32\|NZ_CP019734\|CRISPRCasFinder	1217638-1217669	32	MK448407	Streptococcus satellite phage Javan295, complete genome	297-328	8	0.75
NZ_CP019734_2	2.6\|1217637\|33\|NZ_CP019734\|CRT	1217637-1217669	33	MK448407	Streptococcus satellite phage Javan295, complete genome	296-328	8	0.758
NZ_CP019734_1	1.2\|138638\|31\|NZ_CP019734\|CRISPRCasFinder	138638-138668	31	MN856022	Bacteriophage sp. isolate 138, complete genome	4935-4965	10	0.677

1. spacer 1.1|138577|30|NZ_CP019734|CRISPRCasFinder matches to MN830254 (Lactobacillus phage JNU_P2, complete genome) position: , mismatch: 0, identity: 1.0

aactaacgcttgccctagatgggattcagg	CRISPR spacer
aactaacgcttgccctagatgggattcagg	Protospacer
******************************

2. spacer 1.1|138577|30|NZ_CP019734|CRISPRCasFinder matches to MN830255 (Lactobacillus phage JNU_P4, complete genome) position: , mismatch: 0, identity: 1.0

aactaacgcttgccctagatgggattcagg	CRISPR spacer
aactaacgcttgccctagatgggattcagg	Protospacer
******************************

3. spacer 2.1|1217638|32|NZ_CP019734|CRISPRCasFinder matches to MK448407 (Streptococcus satellite phage Javan295, complete genome) position: , mismatch: 8, identity: 0.75

aggttaagccaacgttgctaccaatattgaca	CRISPR spacer
aggttaagccaatgtttctaccattttctgct	Protospacer
************.*** ****** * *. .*

4. spacer 2.6|1217637|33|NZ_CP019734|CRT matches to MK448407 (Streptococcus satellite phage Javan295, complete genome) position: , mismatch: 8, identity: 0.758

taggttaagccaacgttgctaccaatattgaca	CRISPR spacer
taggttaagccaatgtttctaccattttctgct	Protospacer
*************.*** ****** * *. .*

5. spacer 1.2|138638|31|NZ_CP019734|CRISPRCasFinder matches to MN856022 (Bacteriophage sp. isolate 138, complete genome) position: , mismatch: 10, identity: 0.677

caatcaaaaatggccgtcaatccgtctgtat	CRISPR spacer
ggcatcaaaacggccgtcgatccgtctgtgc	Protospacer
 .  . ****.*******.**********..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

881449 : 919540

Lactobacillus_phage(91.89%)

plate,tail,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085768824.1\|881449_881821_-	helix-turn-helix transcriptional regulator	Q6SEA1	Lactobacillus_prophage	2.7e-09	53.3
WP_155275713.1\|882225_882375_+	hypothetical protein	NA	NA	NA	NA
WP_085768826.1\|882952_883330_-	DUF2513 domain-containing protein	A0A1Q1PVT8	Staphylococcus_phage	1.9e-18	42.1
WP_085768827.1\|883531_883729_-	hypothetical protein	NA	NA	NA	NA
WP_157130456.1\|883883_884054_+	hypothetical protein	NA	NA	NA	NA
WP_085768828.1\|884110_884617_+	hypothetical protein	D6PST4	Lactobacillus_phage	2.5e-18	35.7
WP_085768829.1\|884622_884934_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_156646391.1\|884936_885095_+	hypothetical protein	D6PST6	Lactobacillus_phage	7.4e-17	76.9
WP_157130457.1\|885204_885381_+	hypothetical protein	NA	NA	NA	NA
WP_085768830.1\|885368_885968_+	host-nuclease inhibitor Gam family protein	NA	NA	NA	NA
WP_085768831.1\|885954_886710_+	AAA family ATPase	D2KRE2	Lactobacillus_phage	1.3e-18	28.6
WP_085768832.1\|886712_887306_+	DUF669 domain-containing protein	NA	NA	NA	NA
WP_085768833.1\|887398_888295_+	DUF4373 domain-containing protein	D6PSU3	Lactobacillus_phage	3.4e-106	73.8
WP_085768834.1\|888291_889053_+	phage antirepressor KilAC domain-containing protein	Q38330	Lactococcus_phage	1.9e-62	49.1
WP_085768835.1\|889065_889488_+	RusA family crossover junction endodeoxyribonuclease	D6PSU4	Lactobacillus_phage	3.1e-38	57.0
WP_085768836.1\|889475_889739_+	hypothetical protein	NA	NA	NA	NA
WP_085768837.1\|889908_890088_+	hypothetical protein	NA	NA	NA	NA
WP_085768838.1\|890139_890487_+	hypothetical protein	NA	NA	NA	NA
WP_085768839.1\|890598_891075_-	hypothetical protein	NA	NA	NA	NA
WP_085769496.1\|891375_891813_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	4.2e-78	99.3
WP_085768840.1\|892084_892294_+	hypothetical protein	NA	NA	NA	NA
WP_085768841.1\|892283_892661_+	hypothetical protein	NA	NA	NA	NA
WP_085768842.1\|893158_893605_-	universal stress protein	NA	NA	NA	NA
WP_085768843.1\|893892_894252_-	hypothetical protein	NA	NA	NA	NA
WP_085768844.1\|894389_894584_+	hypothetical protein	D6PSW6	Lactobacillus_phage	7.1e-30	93.8
WP_085768845.1\|894567_894801_+	hypothetical protein	D6PSW7	Lactobacillus_phage	2.3e-35	92.2
WP_085768846.1\|894859_895579_+	TerS	D6PSW8	Lactobacillus_phage	8.1e-111	96.6
WP_085768847.1\|895595_896933_+\|terminase	terminase	D6PSX1	Lactobacillus_phage	7.4e-166	98.2
WP_085768848.1\|896949_898311_+	DUF1073 domain-containing protein	D6PSX2	Lactobacillus_phage	8.9e-260	98.5
WP_085768849.1\|898313_899141_+\|capsid	minor capsid protein	D6PSX3	Lactobacillus_phage	1.2e-126	93.0
WP_167571569.1\|899163_899433_+	LysM peptidoglycan-binding domain-containing protein	D6PSX4	Lactobacillus_phage	7.9e-19	88.8
WP_085768851.1\|899444_900548_+	DUF2213 domain-containing protein	D6PSX5	Lactobacillus_phage	5.9e-161	91.0
WP_085768852.1\|900562_901027_+	hypothetical protein	D6PSX6	Lactobacillus_phage	2.4e-76	98.1
WP_042254688.1\|901041_901920_+	encapsulin	D6PSX7	Lactobacillus_phage	1.6e-161	99.3
WP_085768853.1\|901930_902293_+	hypothetical protein	D6PSX8	Lactobacillus_phage	8.1e-59	99.2
WP_085768854.1\|902304_902631_+	DUF4054 domain-containing protein	D6PSX9	Lactobacillus_phage	5.6e-51	93.5
WP_085768855.1\|902627_903230_+	hypothetical protein	D6PSY0	Lactobacillus_phage	3.5e-107	97.5
WP_085768856.1\|903229_903604_+	hypothetical protein	D6PSY1	Lactobacillus_phage	7.8e-65	95.2
WP_085763035.1\|903596_904067_+	hypothetical protein	D6PSY2	Lactobacillus_phage	4.2e-60	94.9
WP_085768857.1\|904079_905117_+	DUF3383 family protein	D6PSY3	Lactobacillus_phage	6.4e-141	94.0
WP_042750524.1\|905131_905530_+	hypothetical protein	D6PSY4	Lactobacillus_phage	1.2e-71	98.5
WP_085768858.1\|905601_905976_+	hypothetical protein	D6PSY5	Lactobacillus_phage	1.4e-61	90.3
WP_157128262.1\|905986_906157_+	hypothetical protein	D6PSY6	Lactobacillus_phage	9.7e-23	94.4
WP_085768859.1\|906171_911937_+\|tail	phage tail tape measure protein	D6PSY9	Lactobacillus_phage	2.0e-159	94.5
WP_085768860.1\|911936_912584_+	LysM peptidoglycan-binding domain-containing protein	D6PSZ4	Lactobacillus_phage	3.4e-108	92.6
WP_167571570.1\|912595_912988_+	hypothetical protein	D6PSZ5	Lactobacillus_phage	2.3e-67	96.9
WP_191982514.1\|912944_914219_+	hypothetical protein	D6PSZ6	Lactobacillus_phage	6.7e-209	91.5
WP_085768863.1\|914218_914563_+	hypothetical protein	D6PSZ7	Lactobacillus_phage	2.1e-56	96.5
WP_085768864.1\|914565_914964_+	DUF2634 domain-containing protein	D6PSZ8	Lactobacillus_phage	2.2e-49	78.6
WP_085768865.1\|914950_916129_+\|plate	baseplate J/gp47 family protein	D6PSZ9	Lactobacillus_phage	4.6e-180	80.6
WP_085768866.1\|916118_916778_+	hypothetical protein	D6PT00	Lactobacillus_phage	4.3e-74	83.6
WP_085768867.1\|916780_918349_+	hypothetical protein	NA	NA	NA	NA
WP_085768868.1\|918361_918790_+	hypothetical protein	NA	NA	NA	NA
WP_134787769.1\|918801_918969_+	XkdX family protein	NA	NA	NA	NA
WP_043022776.1\|919186_919540_+	hypothetical protein	D6PSR9	Lactobacillus_phage	3.8e-37	68.1

DBSCAN-SWA_2

1367806 : 1377063

Staphylococcus_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021741848.1\|1367806_1368658_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	5.8e-15	33.6
WP_085769039.1\|1368826_1369468_+	hemolysin III family protein	NA	NA	NA	NA
WP_085769040.1\|1369647_1370139_-	dihydrofolate reductase	A0A0N9S8H6	Staphylococcus_phage	5.7e-23	37.2
WP_085769041.1\|1370155_1371106_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.0e-117	62.1
WP_021741845.1\|1371117_1373010_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.2e-49	29.5
WP_085769042.1\|1373038_1374232_-\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	7.1e-35	39.7
WP_042254316.1\|1374407_1375304_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.6e-52	38.8
WP_085769043.1\|1375422_1376682_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011667553.1\|1376787_1377063_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.1e-26	68.5

DBSCAN-SWA_3

1615247 : 1682842

Oenococcus_phage(35.14%)

tRNA,transposase,terminase,tail,capsid,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085769124.1\|1615247_1616939_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	3.8e-74	31.6
WP_011668217.1\|1617410_1617632_-	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_011668218.1\|1617965_1619225_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	1.8e-17	40.0
WP_085769125.1\|1619285_1619819_+	dihydrofolate reductase	NA	NA	NA	NA
WP_021742195.1\|1619885_1620227_+	DUF1516 family protein	NA	NA	NA	NA
WP_085769126.1\|1620290_1622342_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_085769127.1\|1622493_1624218_-	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
WP_085769128.1\|1624240_1626265_-	transketolase	NA	NA	NA	NA
WP_085769129.1\|1626306_1627674_-	PTS ascorbate transporter subunit IIC	NA	NA	NA	NA
WP_021742200.1\|1627706_1628006_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_085769130.1\|1628005_1628455_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_021742202.1\|1628634_1629348_-	amino acid racemase	NA	NA	NA	NA
WP_085769131.1\|1629354_1630611_-	carboxylate--amine ligase	NA	NA	NA	NA
WP_039107568.1\|1630745_1632629_-	asparagine synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
WP_085769132.1\|1632772_1633501_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_085769133.1\|1633609_1635019_+	C69 family dipeptidase	NA	NA	NA	NA
WP_011668226.1\|1635088_1635325_+	hypothetical protein	NA	NA	NA	NA
WP_085769134.1\|1635462_1637265_-	cell surface protein	NA	NA	NA	NA
WP_003555349.1\|1637377_1638115_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.4e-59	50.4
WP_085769005.1\|1638124_1639348_-\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	2.1e-106	51.5
WP_157130461.1\|1639757_1640528_-	hypothetical protein	NA	NA	NA	NA
WP_085769136.1\|1640470_1641961_-	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
WP_021742209.1\|1642417_1642669_-	hypothetical protein	NA	NA	NA	NA
WP_085769137.1\|1643406_1645917_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.2e-139	32.5
WP_134787778.1\|1646481_1647015_-	hypothetical protein	NA	NA	NA	NA
WP_085769139.1\|1647396_1647666_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	1.1e-25	70.2
WP_085769140.1\|1647665_1648490_-	autolysin	L0P6H6	Lactobacillus_phage	6.8e-13	30.2
WP_085769141.1\|1648482_1648911_-	hypothetical protein	NA	NA	NA	NA
WP_134787779.1\|1648971_1649148_-	XkdX family protein	NA	NA	NA	NA
WP_085769142.1\|1649147_1649507_-	hypothetical protein	NA	NA	NA	NA
WP_085769143.1\|1649520_1651473_-	hypothetical protein	Q6SE73	Lactobacillus_prophage	8.0e-20	35.6
WP_167571577.1\|1651497_1651920_-	DUF1617 family protein	NA	NA	NA	NA
WP_085769145.1\|1651947_1654323_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	3.4e-89	40.8
WP_085769509.1\|1654340_1654670_-	hypothetical protein	V9QIZ3	Oenococcus_phage	1.8e-25	48.6
WP_085769146.1\|1654719_1660263_-	hypothetical protein	V5URV5	Oenococcus_phage	1.7e-102	32.5
WP_085769510.1\|1660275_1660560_-	hypothetical protein	V5US89	Oenococcus_phage	3.3e-15	47.3
WP_085769147.1\|1660646_1661057_-	hypothetical protein	V9QJA0	Oenococcus_phage	1.3e-28	50.8
WP_167571578.1\|1661120_1661369_-	Ig-like domain-containing protein	U5PW26	Acinetobacter_phage	8.3e-07	55.6
WP_085769149.1\|1661382_1661907_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	7.1e-40	59.3
WP_085769150.1\|1661925_1662300_-	hypothetical protein	Q6SE74	Lactobacillus_prophage	3.7e-22	44.2
WP_085769151.1\|1662280_1662838_-	hypothetical protein	V5USK0	Oenococcus_phage	3.0e-52	57.1
WP_085769152.1\|1662830_1663175_-	hypothetical protein	V5US85	Oenococcus_phage	3.1e-20	43.6
WP_134787800.1\|1663171_1663477_-	hypothetical protein	V5UQW8	Oenococcus_phage	3.2e-16	53.2
WP_085769154.1\|1663502_1664564_-\|capsid	major capsid protein	V9QKJ3	Oenococcus_phage	4.7e-115	59.4
WP_085769156.1\|1664992_1665649_-	DUF4355 domain-containing protein	V5URU4	Oenococcus_phage	1.1e-13	50.0
WP_134787780.1\|1665812_1665995_-	hypothetical protein	NA	NA	NA	NA
WP_167571579.1\|1665991_1667206_-\|capsid	minor capsid protein	V9QKG7	Oenococcus_phage	1.1e-104	48.5
WP_167571580.1\|1667198_1667522_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_085769160.1\|1667499_1668927_-\|portal	phage portal protein	V5USP8	Oenococcus_phage	2.8e-123	49.1
WP_085769161.1\|1668946_1670314_-\|terminase	PBSX family phage terminase large subunit	U3PBE8	Lactobacillus_phage	4.4e-150	58.7
WP_085769162.1\|1670297_1671014_-\|terminase	terminase	V5URT8	Oenococcus_phage	1.4e-09	38.1
WP_047021361.1\|1672106_1672523_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	4.3e-32	47.5
WP_085769163.1\|1672664_1672880_-	hypothetical protein	NA	NA	NA	NA
WP_157130462.1\|1672888_1673056_-	hypothetical protein	NA	NA	NA	NA
WP_191982521.1\|1673192_1673474_-	DUF1642 domain-containing protein	A0A2P0ZLB8	Lactobacillus_phage	1.2e-22	56.5
WP_085769165.1\|1673690_1674410_-	SAM-dependent DNA methyltransferase	A0A097BYG1	Leuconostoc_phage	8.1e-127	94.5
WP_085769166.1\|1674406_1674790_-	hypothetical protein	A0A2P0ZKS9	Lactobacillus_phage	6.2e-25	48.9
WP_085769169.1\|1675145_1675556_-	hypothetical protein	D6PSU8	Lactobacillus_phage	1.3e-28	74.4
WP_085769170.1\|1675726_1676497_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	5.3e-68	52.5
WP_085769171.1\|1676498_1677260_-	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	4.7e-32	45.8
WP_085769172.1\|1677228_1677948_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.9e-96	71.4
WP_085769173.1\|1677962_1678481_-	DUF669 domain-containing protein	Q6J1V7	Lactobacillus_phage	2.7e-23	38.8
WP_085769174.1\|1678480_1679278_-	AAA family ATPase	A8YQL5	Lactobacillus_phage	2.3e-74	58.3
WP_085769175.1\|1679292_1679799_-	hypothetical protein	NA	NA	NA	NA
WP_085769176.1\|1679801_1680080_-	hypothetical protein	NA	NA	NA	NA
WP_085769177.1\|1680186_1680390_-	hypothetical protein	NA	NA	NA	NA
WP_157130463.1\|1680379_1680544_-	hypothetical protein	NA	NA	NA	NA
WP_085769178.1\|1680603_1680867_-	hypothetical protein	NA	NA	NA	NA
WP_085769179.1\|1680926_1681211_+	hypothetical protein	A0A1W6JPU7	Staphylococcus_phage	3.9e-16	45.7
WP_167571560.1\|1681207_1681351_-	hypothetical protein	NA	NA	NA	NA
WP_085769180.1\|1681408_1682074_+	hypothetical protein	NA	NA	NA	NA
WP_085769181.1\|1682131_1682842_-	phage antirepressor KilAC domain-containing protein	E9LUT0	Lactobacillus_phage	1.6e-119	89.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP019739

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7508

Lactobacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085769684.1\|0_771_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.4e-68	52.5
WP_085769685.1\|772_1528_-	hypothetical protein	A0A0U4JX08	Bacillus_phage	6.0e-40	42.7
WP_085769686.1\|1499_2216_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.9e-96	71.4
WP_085769687.1\|2230_2662_-	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	1.2e-45	63.4
WP_085769688.1\|2654_3398_-	ERF family protein	A0A0S2MYH3	Enterococcus_phage	3.9e-15	29.1
WP_085769689.1\|3400_3943_-	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	6.9e-30	40.7
WP_085769690.1\|3942_4167_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085769691.1\|4157_4427_-	hypothetical protein	NA	NA	NA	NA
WP_157130475.1\|4523_4688_-	hypothetical protein	NA	NA	NA	NA
WP_085769692.1\|4745_4931_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	2.6e-05	49.1
WP_085769693.1\|5217_5439_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.1e-17	60.6
WP_191982526.1\|5435_5642_-	hypothetical protein	NA	NA	NA	NA
WP_085769695.1\|5651_6407_-	hypothetical protein	A0A2H4J436	uncultured_Caudovirales_phage	5.6e-30	44.1
WP_085769696.1\|6394_6655_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_085769697.1\|6809_7508_+	LexA family transcriptional regulator	A0A1J0MFC5	Staphylococcus_phage	4.3e-32	36.0

DBSCAN-SWA_2

35160 : 43087

Lactobacillus_phage(50.0%)

terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085769727.1\|35160_36951_-\|portal	phage portal protein	C9E2I8	Enterococcus_phage	3.5e-46	28.3
WP_085769728.1\|36904_37249_-	hypothetical protein	NA	NA	NA	NA
WP_085769729.1\|37421_38732_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	5.1e-111	51.5
WP_085769730.1\|38728_39310_-\|terminase	terminase small subunit	A0A1P8VVN7	Streptococcus_phage	8.5e-10	39.2
WP_085769731.1\|39807_40008_-	hypothetical protein	NA	NA	NA	NA
WP_085769732.1\|40620_41037_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	4.3e-32	47.5
WP_085769733.1\|41194_41395_-	hypothetical protein	NA	NA	NA	NA
WP_085769734.1\|41421_41613_-	hypothetical protein	D6PSV7	Lactobacillus_phage	2.5e-27	93.5
WP_085769735.1\|41593_42097_-	DUF1642 domain-containing protein	A0A2K9VC51	Lactobacillus_phage	4.6e-28	44.8
WP_085769736.1\|42089_42512_-	hypothetical protein	Q9XJF2	Lactococcus_phage	1.6e-26	46.4
WP_085769738.1\|42667_43087_-	hypothetical protein	D6PSU8	Lactobacillus_phage	2.0e-29	74.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019735

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP019736

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP019734

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP019739

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection