CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP019942	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
NZ_CP019940	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed3, complete sequence	1 crisprs	NA	1	0
NZ_CP019938	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP019941	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0
NZ_CP019937	Ketogulonicigenium robustum strain SPU_B003, complete genome	0 crisprs	csa3,DEDDh,WYL	0	4
NZ_CP019939	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence	1 crisprs	RT	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

414917 : 423306

Synechococcus_phage(33.33%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085785439.1\|414917_417194_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A292GI44	Xanthomonas_phage	4.4e-09	31.6
WP_085785440.1\|417201_417555_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_085785441.1\|417969_418569_+	NYN domain-containing protein	NA	NA	NA	NA
WP_085785442.1\|418650_419601_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_085785443.1\|419602_420079_+	ribonuclease HI	J9Q745	Salmonella_phage	1.8e-37	56.2
WP_085785444.1\|420139_421024_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	6.9e-11	37.3
WP_085785445.1\|421020_421392_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_085785446.1\|421388_422288_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.0e-06	36.9
WP_085787193.1\|422287_422779_-	peptide deformylase	K4JRM9	Caulobacter_phage	2.0e-12	36.6
WP_157115600.1\|422778_423306_-	peptide deformylase	E3SLL2	Synechococcus_phage	4.2e-24	46.2

DBSCAN-SWA_2

877201 : 912034

Paracoccus_phage(33.33%)

tail,head,integrase,capsid,protease,portal

attL 869787:869802|attR 908006:908021

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
869787:869802	attL	NA	NA	NA	NA
WP_085785821.1\|877201_878599_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_085785822.1\|879740_880364_-	peptidase M50	NA	NA	NA	NA
WP_085785823.1\|880360_881167_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_085785824.1\|881168_881981_-	ABC transporter permease	NA	NA	NA	NA
WP_085785825.1\|881977_882901_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.9e-14	28.0
WP_085785826.1\|883260_885345_+	PQQ-binding-like beta-propeller repeat protein	W5S519	Pithovirus	5.8e-08	19.8
WP_085785827.1\|885404_886244_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_085785828.1\|886416_886614_+	hypothetical protein	NA	NA	NA	NA
WP_085785829.1\|886610_887195_-	hypothetical protein	NA	NA	NA	NA
WP_085785830.1\|887258_887438_+	DUF3553 domain-containing protein	NA	NA	NA	NA
WP_085787249.1\|887645_888977_+	trigger factor	NA	NA	NA	NA
WP_085785831.1\|889058_891020_-	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase	NA	NA	NA	NA
WP_085785832.1\|891299_891650_+	hypothetical protein	NA	NA	NA	NA
WP_085785833.1\|891729_892305_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_014537607.1\|892317_892545_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_085785834.1\|892570_892957_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_085785835.1\|893099_893417_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_085785836.1\|893577_894513_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_085785837.1\|894523_895261_+	3-oxoacyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
WP_013383938.1\|895477_895711_+	acyl carrier protein	A0A2I7RIC8	Vibrio_phage	9.6e-05	40.3
WP_085785838.1\|896005_897265_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_085785839.1\|897264_898404_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_085785840.1\|898594_898933_+	hypothetical protein	NA	NA	NA	NA
WP_085785841.1\|898880_900215_+	DNA-packaging protein	A0A0K1LMR9	Caulobacter_phage	9.9e-70	38.3
WP_085785842.1\|900304_901486_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	2.9e-57	37.0
WP_085787250.1\|901472_901691_+	hypothetical protein	NA	NA	NA	NA
WP_085785843.1\|901703_902225_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.2e-31	55.5
WP_085785844.1\|902237_903380_+\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	1.1e-66	38.8
WP_085785845.1\|903450_903993_+	hypothetical protein	NA	NA	NA	NA
WP_085785846.1\|903989_904322_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_085785847.1\|904318_904708_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_085785848.1\|904719_905136_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_085785849.1\|905132_905462_+	gene transfer agent family protein	NA	NA	NA	NA
WP_085785850.1\|905461_905662_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_085785851.1\|905654_906272_+\|tail	phage tail tape measure protein	A0A1B2AQ26	Escherichia_phage	1.1e-07	45.1
WP_085785852.1\|906280_906913_+	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	2.8e-54	49.8
WP_085785853.1\|906909_907755_+	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	1.3e-46	39.9
WP_085785854.1\|907751_908177_+	hypothetical protein	A0A1V0DYB6	Dinoroseobacter_phage	1.8e-17	36.7
908006:908021	attR	NA	NA	NA	NA
WP_085785855.1\|908179_912034_+	host specificity protein	A0A0B5A7K5	Paracoccus_phage	3.0e-212	37.7

DBSCAN-SWA_3

1032818 : 1040892

environmental_halophage(12.5%)

integrase

attL 1031566:1031579|attR 1036227:1036240

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1031566:1031579	attL	NA	NA	NA	NA
WP_085785954.1\|1032818_1034036_+	cysteine desulfurase	Q2XUY6	environmental_halophage	2.1e-79	37.4
WP_085785955.1\|1034201_1035272_-\|integrase	tyrosine-type recombinase/integrase	I3UM24	Rhodobacter_phage	5.7e-60	44.3
WP_085785956.1\|1035250_1035466_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085785957.1\|1035465_1035828_-	hypothetical protein	NA	NA	NA	NA
WP_085785958.1\|1036021_1036723_-	hypothetical protein	NA	NA	NA	NA
1036227:1036240	attR	NA	NA	NA	NA
WP_085785959.1\|1036722_1037130_-	HNH endonuclease	A7XFH9	Enterobacteria_phage	1.1e-19	39.8
WP_085785960.1\|1037129_1037549_-	hypothetical protein	NA	NA	NA	NA
WP_085785961.1\|1037545_1037905_-	hypothetical protein	NA	NA	NA	NA
WP_085785962.1\|1037916_1038309_-	hypothetical protein	A0A2I7RSL2	Vibrio_phage	3.5e-07	36.0
WP_085785963.1\|1038490_1038874_-	hypothetical protein	A0A076GCY8	Sinorhizobium_phage	3.0e-11	37.9
WP_085785964.1\|1038876_1039089_-	hypothetical protein	NA	NA	NA	NA
WP_085785965.1\|1039088_1039547_-	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	7.3e-49	65.8
WP_085785966.1\|1039546_1040239_-	hypothetical protein	A0A088F866	Sulfitobacter_phage	2.1e-47	65.2
WP_085785967.1\|1040250_1040892_-	ERF family protein	A0A1W6DXX6	Salmonella_phage	1.3e-19	38.7

DBSCAN-SWA_4

1169695 : 1176803

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085786092.1\|1169695_1171516_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	3.1e-42	28.1
WP_157115636.1\|1171592_1172696_-	LysM peptidoglycan-binding domain-containing protein	A0A0A7RVP5	Clostridium_phage	2.0e-07	44.2
WP_085786094.1\|1172839_1173400_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	2.3e-12	29.9
WP_085787280.1\|1173383_1174280_-	EamA family transporter RarD	NA	NA	NA	NA
WP_085786095.1\|1174337_1174937_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	6.7e-34	40.9
WP_085786096.1\|1175052_1176087_-	PAS domain-containing protein	W8CYF6	Bacillus_phage	6.6e-29	33.1
WP_157115637.1\|1176134_1176803_-	guanylate kinase	A0A143DIC6	Abalone_herpesvirus	1.7e-17	33.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP019939

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019939_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019939_1

19499-19669

Orphan

Consensus_repeat	Method
GATGGTGTGTGAAATGACGATAG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP019939_1

>merge|NZ_CP019939|1|19499-19669|CRISPRCasFinder
CCTGGTGTGTGAAATGACGAAAGATGGTGTGTGAAATGACGAAAGATGGTGTGTGAAATGACGATAGCGGCTCGAGTTATCCACAGCCTCCTTGGGTGTGTGAAATGACGAGCCTTGACGAGTGGTGTGTGAAATGACGATAGTCTTGTACGGTGTGTGAAATGACGAATT

>NZ_CP019939|1|1|19499-19669|CRISPRCasFinder
CCTGGTGTGTGAAATGACGAAAG	ATGGTGTGTGAAATGACGAAA
GATGGTGTGTGAAATGACGATAG	CGGCTCGAGTTATCCACAGCCTCC
TTGGGTGTGTGAAATGACGAGCC	TTGACGAGTGGTGTGTGAAATGACGATAGTCTTG
TACGGTGTGTGAAATGACGAATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019939.1\|WP_085787604.1\|11384_13055_+\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|225100
NZ_CP019939.1\|WP_157115760.1\|17494_18004_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019939.1\|WP_157115759.1\|4312_4594_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019939.1\|WP_085787603.1\|7891_8467_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019939.1\|WP_085787599.1\|3707_3998_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225495
NZ_CP019939.1\|WP_085787606.1\|16009_16654_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP019939.1\|WP_085787609.1\|8523_11385_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350769
NZ_CP019939.1\|WP_085787608.1\|18015_19254_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377859
NZ_CP019939.1\|WP_085787601.1\|5772_7101_+\|hypothetical-protein	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|238828
NZ_CP019939.1\|WP_085787605.1\|13058_15920_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368155

Protein	Function_ID	Function_description	E-value
NZ_CP019939.1\|WP_085787604.1\|11384_13055_+\|site-specific-DNA-methyltransferase	gnl\|CDD\|225100	COG2189, COG2189, Adenine specific DNA methylase Mod [DNA replication, recombination, and repair].	3.92479e-44
NZ_CP019939.1\|WP_085787599.1\|3707_3998_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	3.36848e-14
NZ_CP019939.1\|WP_085787606.1\|16009_16654_-\|transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.00375551
NZ_CP019939.1\|WP_085787609.1\|8523_11385_+\|hypothetical-protein	gnl\|CDD\|350769	cd18011, DEXDc_RapA, DEXH-box helicase domain of RapA. In bacteria, RapA is an RNA polymerase (RNAP)-associated SWI2/SNF2 (switch/sucrose non-fermentable) protein that mediates RNAP recycling during transcription. The ATPase activity of RapA is stimulated by its interaction with RNAP and inhibited by its N-terminal domain. The conformational changes of RapA and its interaction with RNAP are essential for RNAP recycling. RapA is part of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	3.12172e-50
NZ_CP019939.1\|WP_085787608.1\|18015_19254_+\|hypothetical-protein	gnl\|CDD\|377859	pfam07514, TraI_2, Putative helicase. Some members of this family have been annotated as helicases.	1.9354e-13
NZ_CP019939.1\|WP_085787601.1\|5772_7101_+\|hypothetical-protein	gnl\|CDD\|238828	cd01651, RT_G2_intron, RT_G2_intron: Reverse transcriptases (RTs) with group II intron origin. RT transcribes DNA using RNA as template. Proteins in this subfamily are found in bacterial and mitochondrial group II introns. Their most probable ancestor was a retrotransposable element with both gag-like and pol-like genes. This subfamily of proteins appears to have captured the RT sequences from transposable elements, which lack long terminal repeats (LTRs).	7.33222e-28
NZ_CP019939.1\|WP_085787605.1\|13058_15920_+\|hypothetical-protein	gnl\|CDD\|368155	pfam04851, ResIII, Type III restriction enzyme, res subunit.	5.49074e-19

>NZ_CP019939.1|WP_085787608.1|18015_19254_+|hypothetical-protein
MFYDDRIILSYGRYLRNAQFRILHPHVTFGSYEQLIKEQLKKLPFLSHKETLLVRQMLRGGHDYMLCLPASSTHHHRTAGGLFYHSLETAGLAVDFFNSEFSKAVPSEAGDLAAFIAGFVHDLGKVRTMFKVYPANVQLQDLGFGEIEQPETDLPSWDPMAQSLWEWSQSFESPVTHLSLRYNQRPVIGHDTARGNGYWRQVVSDCLLESVSKRDEAYAEQLEGYLEGRLHRSPFVSAVKKADRRSVERDVNPLHRMEPKRSDLHAVRRFMEFAALSSWNNQYSMFIMADIWLGDQDLAIRVPLFRSRWRHMQTFREYLYGEDRYGAAYVDNGTPDIFYGILENHGVLRRVLPGMPDFSPIPSTYKPAPAFNATVVFADGDPAGGGREDLCYFPGGINIACEGLPVVRVILE
>NZ_CP019939.1|WP_157115760.1|17494_18004_+|hypothetical-protein
MSEEHPQESCSHEVRFHDFDSDWEPELLRSIPAMGYDLEGWARYWQDRAVEALKAYRKMDAGAEALNLGIVVRIREDTLGPRIYWVKFQGKARYRMGGDKFTPTEQIRMSGKYKYSDRIFARFPDAIRRELLLCEANFAWIRYRTDRLAQLRNLCRAHTGTYQLRANID
>NZ_CP019939.1|WP_085787606.1|16009_16654_-|transcriptional-regulator
MMRTRKIGYHGSVRVARGTKTAKSKNADPIVAECLKLIREDSGYERDEFAELLGVQHKTYRNYEGCIYPLPLKVVKTIREKLGYDLADPDLTSDAIITKIAEQRHDVAAAPDLAATEQVAKGVSCPQRIRTCLQAFRQELIGVQSKRKHDIRDAVFVGAAALFAFCLVVLRTEPQNIRLESIYTLMLSVSFLVAASIVPFQAIHMIQAAYRSRR
>NZ_CP019939.1|WP_085787605.1|13058_15920_+|hypothetical-protein
MQTTDPKRAVLQINQRLSLRKPQAEALRRLDDIVDLVGPAKEADIDMARAAVREVYGDLADATFEEFERDFPSVCFALATGVGKTRLMGAFISYLYMIGKSRNFFVLAPNLTIYEKLLSDFQPSSPKYVFRGIEVFAHNAPLIVNAENYEEGRGVRGTDLFGQEGAIINIFNVSKINSEARGGNAPRIKRLQEYIGESYFSYLSELDDLVLLMDEAHRYRGSAGARAIAELKPILGLEVTATPKTVGARSQPFKNVVYRYDLPDAMEDGYVKEPAVGTRANFNPKTVDEDTLERIKLEDGIHYHEHVKVALETYARQNDVKVVRPFMLVVTQDTTHARQVNEFVQSDEFFGGRYKGRVAEIHSKLTGEESDENAQRLLNIEKAGDTDIVIHVNKLKEGWDVSNLFTIVPLRASASDILTEQTLGRGLRLPYGKRTGVEVVDTLTVIAHERFNELIEKAKEENGVTRKLKQVTIGEGGDVPPSKPVSVSAPSILDQMLAQAEAKTEPTVVVADDEKASDAPVQLVAKPTSAAPTQAPFSFSTPEELKVARTVLSVVIPQLSKEVSSIRDLNDPKVIERIAEAAIAAQKPEEGFLPSITKEKAVAVAQELCKNFVERTLAIPALTITPQQQVSFGFKRFDLDMKSWNFQPLSNELMIQALRTEKTSRISSEDKGDTANRLENYIVARLIDYPEIDYDAHAAILYDLAGQAVTQTRNRFADDDEQTRSVVRGHAKAMAESIFSQIKQNMWREHTNYRVSLTSAFGELRPQTFDTAGTSFIRDFKTPPDQKQEIRKYIFTGFVKGCYQYAKFDSNPERKLAIILEKDSSVRLWMKPGPNQFKIFDNHGAPYQPDFVVETDTGKLIIEVKRQSEMTATEVLRKADAASLWCHIATQAGAKSGEKPWHYLLVPESDVEENFTVSGLEAMHTRAPDTDLLSRYIFDEPSVSGEKKSALCV
>NZ_CP019939.1|WP_085787604.1|11384_13055_+|site-specific-DNA-methyltransferase
MAAKTKLELTWIGKNNRPRLEPRILIEEPEFSHHASTRREGDIFDNMLIHGDNLLALKALETDPAVRGKVKCIFIDPPYNTGSAFEHYDDGLEHSLWLTMMRDRLEILRNLLSEDGSIWMTIDDNEVHYLKVMCDEIFGRSNFFGSIIWQHSVQGKNDAKTVSLHHNYVLAYRKTEAFSRNLLPRKPEHNKNYNNPDKDPKGPWRAGDVRSPNYRENLMFDVTTPSGKIIPPPEKGWRWSKETFASKVETGEITFLNEDTRVLRKIYLCDQEGRVPESIWFGEEAGTTREATNDLRTLLGLGDATFATPKPEKLLERIIQIGTQPGDLVIDSFAGSGTTGAVAHKMGRRWIMVELGDHAKTHVAPRLQKVINGTDKGGVTEATNWRGGGGYRFFRLAPSLLQKDVWGNWVISKDYNAEMLAEAMCKHFNYVYAPSTEAYWMHGQASENAFIYVTTASLTIEQLRAISDEVGEDRSLLICCMAYEAQGESLSNLTLKKIPRVVLDRCEWGQDDYSLKINALPMAEDEPDDIEDTPAPKKSAKAKAADTPDLFGAEEN
>NZ_CP019939.1|WP_085787609.1|8523_11385_+|hypothetical-protein
MLFQFSEYQSKFFAHHLTSEGIQEEDALTQSLSAAKVDLNPHQVDAATFALRSPLSKGVLLADEVGLGKTIEAALVISQRWWERERNILLIVPASLRKQWATELREKFSLPSFILDAKRVKDLENEGTPHPVGRGEGIIIVSYEYAARIADTLRRTPWSLVVFDEAHKLRNVYKAAENSRASVLRKALAGRQKLLLTATPLQNNLMELYGLISIIDETYFGSEQAFRSEFGGREGLTSQALLAKRLEPICKRTLRRQVQRAGLINYTNRLPKTFDFTPGRLETDLYEKVSEYLQDPSTIALGQNGRHLVTLMLRKILGSSSFAVMQTLDKMIRRLEAKRVVGADTLDDLDGFSDEAEDWREADSGSEADAIEDDTEDAERVDPAQLEAEIKRLTQYRDLAASISDNAKGKALLDCLPNVLDEIVSKGGQRKAVIFTESVRTQTYLRDLLEQSGFEGQTVVLNGSNSDADSKALYKAWLDKHGDTNVVSGSKTADMKAAIVDAFRNDRTILIATESGAEGINLQFCSLLINYDLPWNPQRVEQRIGRCHRYGQKIDVTVINFLNRKNHAEARIHQLLEQKFKLFEGVFGSSDEVLGVIESGVDIERRILDIVQSCRTTDQIDAAFDRLQEEFSVEIDEAKKNVRDQLLAEMDDKVIERLLGRKDAVHSAIGDFKRALLGVARAELPEARFHDDHAQRFDYGGETWSSEWPEADERGWRFFRLGDEGLADQLVQKAKSRDLVPAMLRLDYSAYQGNMGDVAQLRGQSGWMRVARVRLKTPAKVYDELVFAAFSDGGTAIDPETASRMLYVPATTEGLGADTLPESDLTQTLNARQTAIIGMAQDRLSSFLNEEEERLDAWREDAKVSFDQQIKALNKEATEKKKLARATIGLEEKVTLQREAKALQRQVDDLQHQLYTRLREIDAERERMLDDIADQLNLTPEMTTLFTVRWTLA
>NZ_CP019939.1|WP_085787603.1|7891_8467_+|hypothetical-protein
MPVVRLNDPTFVDLKCISTWMGTETPSETIMLLVREKMAALDLERDIEISIDPTSEISSFMEFKSTPGLSFTKVLSAEVDHKKIDKPNWAAILLGAVSSLKAKGLSGDHLAEAIQIPTKTACYEEEGFRYYPDLGISIQGQSAQEAWKEVSRIADKHGIAVQVTFQWRDNEKAQYPGQKGVLRAGRSSRRP
>NZ_CP019939.1|WP_085787601.1|5772_7101_+|hypothetical-protein
MPGFYLPSENEFDPSTDDFVLPAISKERKYKHFDLPLVDRELSFDFSVEDKPHRFLPLLGFTDVNRRYVRNKDGAREVKVKERPIRFASHEDAAYLQAYAGHLNRMYERALWRDGTSDSVLAYRRGGGTNIHHAKALFDEIKSRGDCTVFAMDISGFFDCLDHTLLRDEIADLIGETRLEGHHASVWKNVTRYSWVETEDLDKLLGRKRNGHGRICSPSDFSDHVRGRKDGLIRKHDQTFGIPQGTPVSGLYANIYLRTFDREMIAWCSRAGGSYRRYSDDIAVTLPLGAKVHHVVAVVEKMLADFCLSMSIDKTDTADFKDGLLASATPIQYLGFTFDGQKTKIRPSSLDAYRGKMRRGIHAKMIAAKAKNVPSFEVFKRESLARYTHLGKRRNFLRYAYKAADIMGCPEIKDQVSRHVTWFNRAWEREAIRVFGGLVTTT
>NZ_CP019939.1|WP_157115759.1|4312_4594_+|hypothetical-protein
MFKMIGSFLNLNWWGTPDHTVQSFSTIPTSGAHTMDELSTLDISGGTFGGIHSINPASGLPTVAGDGTPDIAGNSWGTLDMDHSSGGGQWGQF
>NZ_CP019939.1|WP_085787599.1|3707_3998_+|helix-turn-helix-domain-containing-protein
MSAFDSIMQGLEEARAFSTGQKAGAAVHEISLPEIDVARIRAQTGLSQTEFARSIGVAKGTLLNWEQKRRMPQGPAQVLLALIERKPSLVQDLLSG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP019939	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence	19522-19542	0	1.0
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP010686	Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence	23463-23483	0	1.0
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP010686	Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence	23485-23505	0	1.0
NZ_CP019939_1	1.2\|19566\|24\|NZ_CP019939\|CRISPRCasFinder	19566-19589	24	NZ_CP019939	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence	19566-19589	0	1.0
NZ_CP019939_1	1.3\|19613\|34\|NZ_CP019939\|CRISPRCasFinder	19613-19646	34	NZ_CP019939	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence	19613-19646	0	1.0
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP019939	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence	19500-19520	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP019939	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence	19544-19564	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP010686	Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence	23507-23527	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP010686	Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence	23611-23631	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP054605	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed6, complete sequence	9196-9216	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP045396	Roseovarius sp. THAF27 plasmid pTHAF27_c, complete sequence	14000-14020	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP021433	Yoonia vestfoldensis strain SMR4r plasmid pSMR4r-2, complete sequence	25408-25428	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP020476	Roseovarius mucosus strain SMR3 plasmid pSMR3-2, complete sequence	26178-26198	1	0.952
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP010686	Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence	23441-23461	2	0.905
NZ_CP019939_1	1.1\|19522\|21\|NZ_CP019939\|CRISPRCasFinder	19522-19542	21	NZ_CP054605	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed6, complete sequence	9321-9341	2	0.905
NZ_CP019939_1	1.3\|19613\|34\|NZ_CP019939\|CRISPRCasFinder	19613-19646	34	NZ_CP010686	Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence	23576-23609	4	0.882
NZ_CP019939_1	1.3\|19613\|34\|NZ_CP019939\|CRISPRCasFinder	19613-19646	34	NZ_CP054605	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed6, complete sequence	9218-9251	6	0.824

1. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP019939 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgaaa	Protospacer
*********************

2. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP010686 (Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence) position: , mismatch: 0, identity: 1.0

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgaaa	Protospacer
*********************

3. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP010686 (Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence) position: , mismatch: 0, identity: 1.0

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgaaa	Protospacer
*********************

4. spacer 1.2|19566|24|NZ_CP019939|CRISPRCasFinder matches to NZ_CP019939 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cggctcgagttatccacagcctcc	CRISPR spacer
cggctcgagttatccacagcctcc	Protospacer
************************

5. spacer 1.3|19613|34|NZ_CP019939|CRISPRCasFinder matches to NZ_CP019939 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttgacgagtggtgtgtgaaatgacgatagtcttg	CRISPR spacer
ttgacgagtggtgtgtgaaatgacgatagtcttg	Protospacer
**********************************

6. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP019939 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
ctggtgtgtgaaatgacgaaa	Protospacer
 ********************

7. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP019939 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgata	Protospacer
******************* *

8. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP010686 (Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgaat	Protospacer
********************

9. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP010686 (Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgaat	Protospacer
********************

10. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP054605 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed6, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatgacgaat	Protospacer
********************

11. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP045396 (Roseovarius sp. THAF27 plasmid pTHAF27_c, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaatcacgaaa	Protospacer
************** ******

12. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP021433 (Yoonia vestfoldensis strain SMR4r plasmid pSMR4r-2, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaattacgaaa	Protospacer
************** ******

13. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP020476 (Roseovarius mucosus strain SMR3 plasmid pSMR3-2, complete sequence) position: , mismatch: 1, identity: 0.952

atggtgtgtgaaatgacgaaa	CRISPR spacer
atggtgtgtgaaattacgaaa	Protospacer
************** ******

14. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP010686 (Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence) position: , mismatch: 2, identity: 0.905

atggtgtgtgaaatgacgaaa	CRISPR spacer
tcggtgtgtgaaatgacgaaa	Protospacer
 .*******************

15. spacer 1.1|19522|21|NZ_CP019939|CRISPRCasFinder matches to NZ_CP054605 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed6, complete sequence) position: , mismatch: 2, identity: 0.905

atggtgtgtgaaatgacgaaa	CRISPR spacer
ttggtgtgtgaaatgacgaat	Protospacer
 *******************

16. spacer 1.3|19613|34|NZ_CP019939|CRISPRCasFinder matches to NZ_CP010686 (Phaeobacter piscinae strain P14 plasmid pP14_e, complete sequence) position: , mismatch: 4, identity: 0.882

ttgacgagtggtgtgtgaaatgacgatagtcttg	CRISPR spacer
ttgacgagtggtgtgtgaaatgacgatagtagct	Protospacer
******************************  .

17. spacer 1.3|19613|34|NZ_CP019939|CRISPRCasFinder matches to NZ_CP054605 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.824

ttgacgagtggtgtgtgaaatgacgatagtcttg	CRISPR spacer
ttgacgatcggtgtgtgaaatgacgatagtgagt	Protospacer
******* .*********************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP019940

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019940_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019940_1

6755-6845

Orphan

Consensus_repeat	Method
CTTAGGCCATTTATGTCCAAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019940_1

>merge|NZ_CP019940|1|6755-6845|CRISPRCasFinder
CTTAGGCCATTTATGTCCAAGAATGTGACAGCCAGCCGAGCGGAGGTAGAGGACTCTGGTGTCCTATGCTTAGGCCATTTATGTCCAAAAA

>NZ_CP019940|1|1|6755-6845|CRISPRCasFinder
CTTAGGCCATTTATGTCCAAGAA	TGTGACAGCCAGCCGAGCGGAGGTAGAGGACTCTGGTGTCCTATG
CTTAGGCCATTTATGTCCAAAAA

Protein	Function_ID	Function_description	E-value
NZ_CP019940.1\|WP_085787612.1\|2654_3233_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379883	pfam16859, TetR_C_11, Bacterial transcriptional repressor C-terminal. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. Another target protein is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	3.23483e-15
NZ_CP019940.1\|WP_085787611.1\|1320_2538_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.39597e-83
NZ_CP019940.1\|WP_085787617.1\|6066_6363_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|162974	TIGR02683, Uncharacterized_protein_HI_1419, putative addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.	1.98335e-54
NZ_CP019940.1\|WP_157115761.1\|452_851_+\|hypothetical-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00225456
NZ_CP019940.1\|WP_085787613.1\|3522_4779_-\|hypothetical-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	4.66489e-77
NZ_CP019940.1\|WP_085787616.1\|5766_6063_-\|putative-addiction-module-antidote-protein	gnl\|CDD\|188241	TIGR02684, conserved_hypothetical_protein, probable addiction module antidote protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the downstream member of a gene pair. It is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, are located often with prophage regions, but also both in integrated plasmid regions and in housekeeping gene regions. Analysis suggests that the gene pair may serve as an addiction module. [Mobile and extrachromosomal element functions, Other].	4.82537e-37

>NZ_CP019940.1|WP_085787617.1|6066_6363_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MIELIRSGTFDTWLSGLRDRRAVARITARLDRLAAGNPGDVEPVGEGVSELRINYGPGYRVYFIQRGPVLVILLCGGDKSTQSKDIKQAKVLAAEWKG
>NZ_CP019940.1|WP_085787616.1|5766_6063_-|putative-addiction-module-antidote-protein
MPEEKFARYDSADYLKTEEDIAAYLEAVMEDGGDDPAYVARALGVVARARNMTALAREVGMSRVGLNKALSGDGNPTLSTVMKVAKALGLKVSIQPGA
>NZ_CP019940.1|WP_085787615.1|5195_5762_+|hypothetical-protein
MSGSTDPFLVLVDDIGALRRQIENLQRTSLDRDEAEHLNATIAQSLDNMAQTGKRLEQRLEGQLQLATAKTHRDAIEAAQGAARAAIRESHAEILQTARSLSQAAGEARREAWRWFGGFWVWLASIGAAGALVGALAVFWLQGRADAKAFGQYPSIYCTTAGGAFADQRDGSRYCIFMISPPTQPDGE
>NZ_CP019940.1|WP_085787614.1|4932_5199_+|hypothetical-protein
MARTIDQQIADAQAKLARLKTRQKASDTRRKIIVGAIVTTEALKDPKISKWLASTLRKNATRDVDQKEIAGLLADLDARAQSAGAGEA
>NZ_CP019940.1|WP_085787613.1|3522_4779_-|hypothetical-protein
MAIYHLRATMISRSSGRSATAAAAYRVGERIEDHRTGLTFDYRARGGVDHVETLAPANAPAWVQDREALWNAVEAAETRKNSQVAREIRVALPAELDHGQRVELVREFCQREFVARGMVADIALHAPGRTGDDRNHHAHILLTTREIGPEGFGAKNRDWNAVEMLEGWREAWARDSNRALERCGHEERIDHRTLEAQRIEAQERASAAHDRGDEAEALRQTVRAVELDRDPLPQLSAGAWQMKERGIEVGAVRVWREVKAQAAEVARVAEVLAGQVRDWIGRAVDRLGPLTQEGAAQGLAYAGAADRDGREGRQDLAARLREAWEARQSRTASDAIAAPGQTPEPESSRSLAERLREAAQGIDRGTLAEAAARLQESREAEERQRVQEAERLKEQERQQERLREREARDHDRDGGLTH
>NZ_CP019940.1|WP_085787612.1|2654_3233_+|TetR/AcrR-family-transcriptional-regulator
MQEVRSGPGRPKDPVVAEAIRKAALRLVRERGYRNVSIGAIAQAAGVARQTLYNRWHAKADLILDAVFEETGRRADDQLPLETGDASRDRLERLLIGVFNHLRADGDTLRALIAAAQEDSEFREAFRERFVAPRETIVTDILAEALRRGELSREADPDTLSTMIHGAFWYRLLNGRELDHELARSIARSVFP
>NZ_CP019940.1|WP_085787611.1|1320_2538_-|multidrug-effflux-MFS-transporter
MLDRPLIPARAGALIAVLALLSIFPPLATDMYLSAIGILAEDLNTSHAATELSLSLFFLGLCLGQLIVGPLTDGYGRKRPLLIGVFIFTVTSIALPLVDNIVVFNALRFLQAIGACVGMVVSRAIVADLYSGQKAAKVMTLLVMLMTIGPVIAPTLGSLLLEAFGWRSIFVTMVLVGLPALILSKLVVPETLSPERRVAQPFRSATRNGLRLVRQPAYLAPVLVAGLVQGGMFAFITGSSGVFQGFFGMSALNYGLIFALIAAALFVFAQINSRLLDRFTPRDMLNRGLPFYGLAALAAVLASATGSVWMFIIPLWIAIGMVGLLSANATSLAMAAATEAAGTGSALLGAVQFGMAFTISTCVALAGTDSPFPMAMGLFLPALAAVALWAALRSRANAGAESKMQ
>NZ_CP019940.1|WP_157115761.1|452_851_+|hypothetical-protein
MKKVDKLSIREAVKHFDVSRPTLQKALKSGKISGVQDGQGTWTIDPSEMARVYQPRQDEVVKDGGQEHENLSAKNTPLHGQVEVLKERLADAEKRVAIAEALAEERGKHIEDLRRMLPAPEAGQPRRRWWPW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP019940_1	1.1\|6778\|45\|NZ_CP019940\|CRISPRCasFinder	6778-6822	45	NZ_CP019940	Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed3, complete sequence	6778-6822	0	1.0

1. spacer 1.1|6778|45|NZ_CP019940|CRISPRCasFinder matches to NZ_CP019940 (Ketogulonicigenium robustum strain SPU_B003 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

tgtgacagccagccgagcggaggtagaggactctggtgtcctatg	CRISPR spacer
tgtgacagccagccgagcggaggtagaggactctggtgtcctatg	Protospacer
*********************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019937

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP019939

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP019940

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection