CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP021032	Rhizobium sp. NXC14 plasmid pRspNXC14b, complete sequence	0 crisprs	csa3,DEDDh	0
NZ_CP021031	Rhizobium sp. NXC14 plasmid pRspNXC14a, complete sequence	0 crisprs	NA	1
NZ_CP021030	Rhizobium sp. NXC14 chromosome, complete genome	2 crisprs	WYL,cas3,csa3,DEDDh,DinG	4
NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	0 crisprs	csa3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021030_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021030_1

964974-965068

Orphan

Consensus_repeat	Method
CTACTACCGGCCCGGCTATCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021030_1

>merge|NZ_CP021030|1|964974-965068|CRISPRCasFinder
CTACTACCGGCCCGGCTATCGCCCCGGCGCCTACTACCGCCCCGGCTGGTATGGCGGCTATCGCGGCTATTCCTACTACCGCCCCGGCTATCGCC

>NZ_CP021030|1|1|964974-965068|CRISPRCasFinder
CTACTACCGGCCCGGCTATCGCC	CCGGCGCCTACTACCGCCCCGGCTGGTATGGCGGCTATCGCGGCTATTC
CTACTACCGCCCCGGCTATCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021030.1\|WP_085779978.1\|973605_974352_-\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP021030.1\|WP_085777174.1\|967282_969061_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP021030.1\|WP_085777169.1\|959913_961350_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP021030.1\|WP_085777179.1\|974616_976560_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP021030.1\|WP_085777171.1\|962426_963035_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021030.1\|WP_085779975.1\|954394_955354_+\|4-hydroxybenzoate-octaprenyltransferase	unknown	unknown	gnl\|CDD\|183808
NZ_CP021030.1\|WP_085777175.1\|969090_969843_+\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|168351
NZ_CP021030.1\|WP_085777170.1\|961383_962358_-\|threonylcarbamoyl-AMP-synthase	unknown	unknown	gnl\|CDD\|223088
NZ_CP021030.1\|WP_085777167.1\|955447_956014_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021030.1\|WP_085777177.1\|971861_972311_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP021030.1\|WP_085777173.1\|966082_967078_-\|transporter	unknown	unknown	gnl\|CDD\|213368
NZ_CP021030.1\|WP_004680452.1\|970957_971776_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|235725
NZ_CP021030.1\|WP_085779974.1\|951425_952007_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP021030.1\|WP_085777176.1\|969872_970877_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293841
NZ_CP021030.1\|WP_085777166.1\|953425_954238_+\|MipA/OmpV-family-protein	unknown	unknown	gnl\|CDD\|226236
NZ_CP021030.1\|WP_085777178.1\|972358_973609_-\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|225174
NZ_CP021030.1\|WP_085779976.1\|963438_964683_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|226985
NZ_CP021030.1\|WP_085779977.1\|965381_965645_-\|DUF982-domain-containing-protein	unknown	unknown	gnl\|CDD\|368772
NZ_CP021030.1\|WP_085777168.1\|956315_959651_+\|DUF1217-domain-containing-protein	unknown	unknown	gnl\|CDD\|369062
NZ_CP021030.1\|WP_085777165.1\|952257_953208_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773

Protein	Function_ID	Function_description	E-value
NZ_CP021030.1\|WP_085779978.1\|973605_974352_-\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	4.24706e-115
NZ_CP021030.1\|WP_004680452.1\|970957_971776_-\|oxidoreductase	gnl\|CDD\|235725	PRK06179, PRK06179, short chain dehydrogenase; Provisional.	1.57791e-159
NZ_CP021030.1\|WP_085777169.1\|959913_961350_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	6.93644e-127
NZ_CP021030.1\|WP_085777179.1\|974616_976560_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.17367e-67
NZ_CP021030.1\|WP_085777174.1\|967282_969061_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	1.1179e-149
NZ_CP021030.1\|WP_085779975.1\|954394_955354_+\|4-hydroxybenzoate-octaprenyltransferase	gnl\|CDD\|183808	PRK12878, ubiA, 4-hydroxybenzoate octaprenyltransferase.	0
NZ_CP021030.1\|WP_085777175.1\|969090_969843_+\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	5.52874e-157
NZ_CP021030.1\|WP_085777170.1\|961383_962358_-\|threonylcarbamoyl-AMP-synthase	gnl\|CDD\|223088	COG0009, SUA5, Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis].	1.13426e-76
NZ_CP021030.1\|WP_085777177.1\|971861_972311_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	4.58308e-32
NZ_CP021030.1\|WP_085777173.1\|966082_967078_-\|transporter	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	2.64843e-112
NZ_CP021030.1\|WP_085777178.1\|972358_973609_-\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	2.06453e-117
NZ_CP021030.1\|WP_085779974.1\|951425_952007_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	2.6087e-58
NZ_CP021030.1\|WP_085777176.1\|969872_970877_-\|hypothetical-protein	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.99272e-73
NZ_CP021030.1\|WP_085777166.1\|953425_954238_+\|MipA/OmpV-family-protein	gnl\|CDD\|226236	COG3713, OmpV, Outer membrane protein V [Cell envelope biogenesis, outer membrane].	4.39032e-63
NZ_CP021030.1\|WP_085779976.1\|963438_964683_+\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|226985	COG4638, HcaE, Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only].	5.81709e-114
NZ_CP021030.1\|WP_085779977.1\|965381_965645_-\|DUF982-domain-containing-protein	gnl\|CDD\|368772	pfam06169, DUF982, Protein of unknown function (DUF982). This family consists of several hypothetical proteins from Rhizobium meliloti, Rhizobium loti and Agrobacterium tumefaciens. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.	6.35723e-23
NZ_CP021030.1\|WP_085777168.1\|956315_959651_+\|DUF1217-domain-containing-protein	gnl\|CDD\|369062	pfam06748, DUF1217, Protein of unknown function (DUF1217). This family represents a conserved region that is found within bacterial proteins, most of which are hypothetical. Some members contain multiple copies.	5.33355e-56
NZ_CP021030.1\|WP_085777165.1\|952257_953208_+\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	6.35009e-19

>NZ_CP021030.1|WP_085779976.1|963438_964683_+|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MDIRSNVLRQLKNRREGFSLEQPFYTDEDYFKLDMEMIYYRDWLFMGHDCELPKPGAYFTVQIGTYPVVIVRGRDNVIRAFHNSCRHRGSRVCTKEHGSSVRLVCPYHQWTYDLDGKLAFARHMGDDFDKTGFNLKPVHCESVAGYIFICLADVAPDFKPVRDTIEPYMAPHRIGETKVAFQSTIIEKGNWKLVWENNRECYHCAANHPELCRTYPEAPSVTGTDGGADDPEIAGHWARCEAAGLPSKFQISPDGQFRTARMPLIEDAESYTMSGKPAVQRRISDDISINRIGTMLLFHYPTTWNHLLGDHAISFRVLPLSANETAVTTKWLVHKDAVEGVDYNLEELTHVWTETNDQDRRIVEENAFGIHSPAYEPGPYSAVHEGGVMQFLEWYSNFMVNRLQGETAKISAVA
>NZ_CP021030.1|WP_085777171.1|962426_963035_-|hypothetical-protein
MARLRYFDAKEVIRPQERPLVAAHSEFLRTGRIPRDRRHWLAEERRYLTHDEVAAKTGRKLQAAGEKTHQHINGFHHSIQFPKMIFHRTLEDSPHLGYCHVTAARTKFARYEEVSWAFYIANFYSEIGDNDNFFERIDVGYSRMYFAVAIKPGEESSEKMTIDRSVRGNGLLFRTHDPQAAIRNILLLGARNEQLREIIRQL
>NZ_CP021030.1|WP_085777170.1|961383_962358_-|threonylcarbamoyl-AMP-synthase
MARIIDIRADRQAALEAACAALSQGFAVAMPTETVYGLAADATNPAAITRIYETKGRPRFNPLICHMADLDMAEHHAEFDPVSRALAEAFWPGPLTLVLPLKAESPIHALATAGLDSVGVRVPKGFAGTLIGAFGRPLAAPSANTSGAISATSAAHVEADLGARIPLILDAGPSAVGVESTIVKAEGGRLRLLRPGGLAAREIERVAGQPLLRAKKASAAIEAPGMLASHYAPGASVRLNATKVEPGEALIAFGGAAVEGAHTARVVLDLSPRGDLAEAAANLFDYMKRADASGVSSIAFSPIPDDGLGEAINDRLQRAAAPRD
>NZ_CP021030.1|WP_085777169.1|959913_961350_-|FAD-binding-oxidoreductase
MSSPGISADLLDRFAAIVGEKYALRGEADLAPHLIENRGLYHGSSPLLLKPGSVEEVSEIMKLATETKTAIVPQTGNTGLVGGQTPRTGQADIILSLERMTRIRDVDPVANVLVADGGAILADVQKAAEANGRLFPLSLGSEGSCRIGGNLSTNAGGTAVLAYGNMRQLCLGLEVVLPTGEIWDGLRRLKKDNTGYDLRDLFIGAEGTLGIITGAVLKLFPQPLGHQVAFAGLNSVEDALALFNLAASLCGTSLTGFELMPRFGVEITTRHIDGVRDPLDAAYPWYVLIDISTSDSAETAERMMNGVLEQGFETGLVQDAAIAASVAQQKAIWHMRESMSDAQKPEGGSIKHDVSVPVSKIPHFMAEAEKVVMAAMPGARICAFGHMGDGNIHYNISQPIGADKAAFIARWREMNHIVHGLVLAHGGSISAEHGIGQLKRDELAAIRPAIEIELMRRIKRAFDPAGIMNPGKVVSLEI
>NZ_CP021030.1|WP_085777168.1|956315_959651_+|DUF1217-domain-containing-protein
MITASLAYTILSKDMTSSLNKVASQATVKKDAQYYADNINKVKDVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQEDELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVNNTRLRTYVLKAFKIDPTYASKDFLRQVLTSDLSDPTSVVNAQGGDKYKALAAQFSFNADGTVNGSAQTATQKASIIETYTLNNQSVIIDNSVGSDVVYVSKTAAEYNQAYYTAKIGTITNVDDLVADSRLTSYIKTAYSMGADFTAPALRMVLTDPGYAQLMGFTNVYNAFNFKADGTTSTTARAQTIAQSNKLKDAAASTANYYSVTSRSSSITNVDDLLADSVLARYIKDAYGLGSSFSNAELKSILTDSTYAAAQGHADLNADFNFQADGSINGSVIQTDAQRKSTTDKSAANATHFNSMIGNVTNVDDIMSDPVAVSYLRTSMQIADSVSDATLRSFLVDPSAASAQGYSDVHDLFNFKTDGSVATLYATQSAAQSASTASKADDAAVYYQATIAGISNVDQLLADRRLNNFIRNAYGIPSTVSDVDLRAILTDQSGTGTYADVAAAFNFKADGSLEDGMAAQTSAQITNTKIAATARTDDYSARMATISNVDDLIADPAITTFLKSTYNLPFDITDADLRSILTDATAAAAAGYSDLNADFNFAADGSLPVVSSIQTADQAQTTNDNYMARYDDERDEAIEEVADNYKSMMADSSSLLNFSDVKTVNDFLRTNRTADFTRSNDNLPDLYHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERITNLARAFNFGPDGKAAAPLQALPDATMAKYATDYKAHVTMLLKAGPVKDKASKDATAEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEDNTQELYLQQTLETQQGESNDGVRLALYFSRKASSITSIYSLLGDKALYQVITTAYSLPSQISGMDVAKQADLINRFVKLEDLQDPKKVDKLLRRFTAMYDVQNSTQQSPALQILTGGGTQQA
>NZ_CP021030.1|WP_085777167.1|955447_956014_-|hypothetical-protein
MNNPVLKPVWAGTTLRLDPSRFPQQISYAIHDCSDDVSITIDERGAVLRKVLPSSGLPLSIALPRRVFKGVAARAIDHGDGEVTVTLELHHADPELCIPLLVAHDLSDIAADWRSWSEAFRIPMLMVEADGVARPLEDHIGALRTSDLKPRRRHSYFANRRPRFLVRRTTGQLGVAMKIEGKEIIARN
>NZ_CP021030.1|WP_085779975.1|954394_955354_+|4-hydroxybenzoate-octaprenyltransferase
MQDTGEFNDRVSDAPSDNWVYRTLPPWLWPYAQLARWDRPIGWELLMWPCFWSATLASNAAIGQGLYSGSLLMSHLFLYFIGAVAMRGAGCTYNDLVDHEIDMEVARTRSRPLPSGRVTRGRAKIFIGIQALVGLFVLLQFNWFTVFLGLLSLGIVALYPYAKRFTDWPQFYLGLAFSWGALMGWAGILGGLSFAAILLYAASVAWTIGYDTIYAHQDKEDDELIGVRSTARLFGDKTRQWLIGLYGLTLVLMFAAFALAGANLIAFLALFGAAGMFAWQIIRLDINDPAQCLALFKSNNRVGLTIFAGLFFSLLFAIP
>NZ_CP021030.1|WP_085777166.1|953425_954238_+|MipA/OmpV-family-protein
MSHRSVVSISFLIAFSSVGSATAQESGQHFWSGDWYLSVGVAGFSAPKFEGSRRYEFRFSPLISAGRQGSAPRFSSRNDNPSLALMDNGTFRAGIVGKFVPSRVEGDGHELKGMKKVKWGAEAGGFVEVYPTDFLRARAEVRQGIRSHDGVVADLAVDAFTDIAPNLQLSGGPRATFATSGYYDAYYGVNAKQAAASGLDQYKPSSGIQSYGAGAALTWKATENLSASSFLEYKRLAGPAADSSLVRQRGSKNQVLIGVSATYRFNFSLQ
>NZ_CP021030.1|WP_085777165.1|952257_953208_+|IS110-family-transposase
MTDNSMICAGIDVGKSHLDIALHPGKARLRVTYDTAGLKALDAFLREHDVSRIGFEASGGYEWRLLAHLRAGKRPAARLQPAQLRFFAKSRLKRAKNDRLDAVLIALFTASLEQLPALPDARFDKLAAELTYLEQIEQQIALVKTFAETALSEAIKRRHLREVARLETCRKAHLLRLEKTVRDDCDLAQRLDLLISIKGIGLRSALCLIIRLPELGHASRAEIAALAGVAPYDDDSGKYHGRRRIQGGRERLRKSLFMCAFTATRHNPDLAAFYTRLRQNGKEHLCAVIAVARKLIVLANTILFRKTEWTPQHRKN
>NZ_CP021030.1|WP_085779974.1|951425_952007_+|histidine-phosphatase-family-protein
MSSAFPEIYLVRHGETEWSLSGRHTGRSDIPLTANGEAAARKLAERLAGLSFPAVWSSPSARARNTCALAGFGADAVIRDELAEWDYGAYEGVTTKAILAERPGWQLFRDGCPNGETAADVGARADAVIHALRQAAAPILIFSSSHFLRVLAARWLGLPPQGGAHFVLDTASISVLGYEHDLTEPVIRRWNQR
>NZ_CP021030.1|WP_085779977.1|965381_965645_-|DUF982-domain-containing-protein
MKWHTPGEFSPLMLVVNGPEKYKLVASLWEAAQMLTACWPLDDGEEYLTAVKACRDAIHGDLPAEDARYALIRAAKEAGIPVITVVH
>NZ_CP021030.1|WP_085777173.1|966082_967078_-|transporter
MDTLPVNIPGFVWAYRFSPDEKTAVRLTNTATVADLIAENCFYWLHLNLVDARVPALLETLDGLTEEARSALTTHDTHAALTVDEQMLYGTLVDCQRDFDQDINNLGWLHFAMSDRFIITTRLQPLRSVERARTLIEKNPGKFSRPVDLFELLVIEFQRTLIAIVIELTEELNQIEDIVYDNAPRDERRRLAPVRRTVVRLHRHLRTVLALMRRAGAADEDEMPFGFDDVARRLTSRLETVDHDVYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTGYAVILIIASIVFAWWLLRRVDIL
>NZ_CP021030.1|WP_085777174.1|967282_969061_+|acyl-CoA-dehydrogenase
MYKAPVEEIAFTLKHVAGMGEAMSKGLFDDLGEDLVDAILDEAGRFATEEVAPLAEIGDRQGARLVDGEVRLPDGWRDLYRSWIAGGWNGLTAPEAFGGQALPDMLNVAALEMWNSGSMAFALAPTLTMGAIEAVSTHGSAALKEKYLAKMVSGEWTGTMNLTEPHAGSDLGVLKARAERRPDGSYRISGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHALEHKLGIHGSPTCTMIYGDGRFGDEKGAIGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGSTGPGMSPIVDHPDVARMLLTMRALTQGARAISYACAHAIDMSRRAGDTSRHWKERAALLTPIAKSFSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGDQVMGFIGELKAIAEAVERSNLDGFGETAARLAVAIADLDAATAWLLAVLADDKAAEALAGATPYQRLFGLVLTGCYLAKGALAESGDGKGEGRIALCRFAAENLLAETAALRDRVVNGAASLAAARILLA
>NZ_CP021030.1|WP_085777175.1|969090_969843_+|crotonase/enoyl-CoA-hydratase-family-protein
MTDHIIVEQPSAHPGVQLIRFNRPEKKNAFTRAMYRTMTEALTAANTDANIRVTVFLGTEGSFSAGNDIGDFLATAMGGSMGDELIDFLYALAGSEKPLVSGVDGLAIGIGTTLNLHCDLTIASDRSQFRTPFVDLALVPEAASSLIAPRVMGHQRAFAMLAAGEAFSAEEAREAGLIWKVTTPDEVENAALIAAAKLAAKPPEALRIARDLICGSREEVIARIDVEARHFAARLKSAEARAAFEAFMRR
>NZ_CP021030.1|WP_085777176.1|969872_970877_-|hypothetical-protein
MRKTKRRNPYYAGPVSDHFDGTLFFNPEGIEPLGFRELLRWQFGGGRDRWPRSVPSPYPAAKPDPHVGGGDLRVTMVGHATLLVQVAELNILTDPVWSERVSPFTFAGPRRVVPPGIAFDDLPPIDLVLVSHNHYDHLDIATLIRLHAKHRPRIVTPLGNDTIMRRAVPDLQTTAMDWGERISHAGISIDAEPAHHWSARGGADRRMALWASFVLSTPAGKIYHVGDTGFHRGINYKAAQRKHGGFRLAILPFGAYEPRWFMKGQHQNPEEAVMGMKLANAAYVAGHHFATFQLTNEAVDAPVRALQEAMSEHEIASDRFRPLRAGEVFNVPMV
>NZ_CP021030.1|WP_004680452.1|970957_971776_-|oxidoreductase
MTDKNRSVALVTGASSGIGLATAQSLVKAGYRVFGTSRKPVANRPGITMLICDVADEASVQAAVAEIVRQTGRLDLVVNNAGVGLIGGAEESSIAQAQRLFDVNVFGVARVANAVLPVMRKQKSGRIINMSSILGLIPAPYNAFYASTKHALEGYSESLDHEVRNFGIRVVLVQPGVTRTSFEENLTRADQPLPVYASERARSEALMRKWVETGDAPEVVADMVVKAATAKKPKLRYSAGKQSRQVRSLRRYLPERLVDSLLRKVNEFPASA
>NZ_CP021030.1|WP_085777177.1|971861_972311_+|helix-turn-helix-transcriptional-regulator
MKNNSIPQCPVARGLQSVGDAWSILVLRDAHTGLTRFDQFRKSLGIVPTMLTKRLKALTEDGLLEKRLYSERPPREEYVLTEAGRDFLPVLMMIGAWAHRHCDGELARYIDVESGAEIEPIAIDAVTGAKLGTRPLRMSLQPESEPGDR
>NZ_CP021030.1|WP_085777178.1|972358_973609_-|class-I-SAM-dependent-RNA-methyltransferase
MSTETVTIEKLGAQGDGIAGSAGGPVYVPFSLPGETVAIARVKNQGTIMSIATASPDRQEPACRHFGPDGINGTCGGCTLQHLADGPYRAFKRQLVVDALKSKGLTPEVGEIVPARPGERRRVVFAARKTEKDMLIGFNQAESHHIVAIEECPISSAGIVARLPAIKAIATSLATNAEPFRVAVLETLSGLDLAIDEIKKLSDPQRRKAIETVLGLRGIARVTLNGEILVEPAKPIIDFGGVEVSPPAGGFAQATKPAEEAMAELVLAHVGKAKRIADLFAGAGTFSLRLARIGRVHAVEAEAAALAALDQAARKTQGLKPVSVEKRDLFRRPVMTQEFKPYDAVVFDPPRAGAEFQCRELARSAVKKIAAVSCNPLTLARDLAILVEGGYCITGVTPIDQFLWTSHVEVVATLEK
>NZ_CP021030.1|WP_085779978.1|973605_974352_-|TlyA-family-RNA-methyltransferase
MSDQNSQRLDQLLVSRGLFASRSRARDAVQRGTVRIAGEVVTKAGALFGDDADIEIDDPAQAYVSRAALKLAAALDHFRLDPAGHHCLDIGASTGGFTEVLLLRGARHVTAIDVGHRQMHPRLSGDPRVTNREGLNARSLSADDIGEPATFIVSDVSFISLKLALAPALDLAAAGAVAVLLVKPQFEAGREAIGKGGLLKDPSSAPAVAAELERWFTEDMGWNSLGLIPSPIAGGDGNQEFLLAGLKP
>NZ_CP021030.1|WP_085777179.1|974616_976560_+|methyl-accepting-chemotaxis-protein
MSVKNISLNGKLAATFAALILIFVSVSSFVYSKATASAAASTEQEKSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTAAGEPQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIEEVVKIGVNAAKGQLDGFRQASAKIKATAREKSNALAAIRADANSDLTTTLLAGGIVASLAAALLAWLMSRTIVRPVVGMTAAMDRLAGGQNDIEVPAVERGDEIGRMAKSVLVFKQAAIEKLRLAGETDRMRDDAERQRQASDEQKAREEGELRYAVDALAGGLAGLAVGDVAARIQTPFAPQYDSLRNDFNHAVEKLQAALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEETAAALEQVTTTVRDSAKRAEDVGNLVERTRLGAEKSGDVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAKAAKEIKDLITNSGTHVQTGVTLVGETGKALEAIVAEVQEINRNVNAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEQQTAASHALAQEASALDELLRQFKLGTELAAPVQRTAAATPASRPIASPARALASKVTKAFGGKQASAAVAVQEDWTEF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021030_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021030_2

1287524-1287707

Orphan

Consensus_repeat	Method
GCGATCGCCGCCATCGCCAAGG	PILER-CR

2 spacers

WYL

The CRISPR arrays of NZ_CP021030_2

>merge|NZ_CP021030|2|1287524-1287707|PILER-CR
GCGATCGCCGCCATCGCCTTCGGTTCGGTGACCGCCGCCGATGGCACCCATGATTCGCGCATTGCGTTGATGAAGAAGATCGGCGGTTCGGCGGGCGCGATGGCCGCCATCGCCAAGGGCGAGAAGCCCTATGATGCCGAGACGGTAAGGTCGGCGCTGACGACGATCGCCGCCACCGCCAAGG

>NZ_CP021030|2|1|1287524-1287707|PILER-CR
GCGATCGCCGCCATCGCCTTCG	GTTCGGTGACCGCCGCCGATGGCACCCATGATTCGCGCATTGCGTTGATGAAGAAGATCGGCGGTTCGGCGGGCGCGA
TGGCCGCCATCGCCAAGGGCGA	GAAGCCCTATGATGCCGAGACGGTAAGGTCGGCGCTGACGACGA
TCGCCGCCACCGCCAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021030.1\|WP_085777455.1\|1295539_1297879_-\|glucose/quinate/shikimate-family-membrane-bound-PQQ-dependent-dehydrogenase	unknown	unknown	gnl\|CDD\|274418
NZ_CP021030.1\|WP_085777442.1\|1281921_1282653_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP021030.1\|WP_085777456.1\|1298019_1299522_-\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP021030.1\|WP_085777451.1\|1290426_1290699_+\|Ni(II)/Co(II)-sensing-transcriptional-repressor-DmeR	unknown	unknown	gnl\|CDD\|197388
NZ_CP021030.1\|WP_085777450.1\|1289654_1290149_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP021030.1\|WP_085777454.1\|1292810_1293050_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|368980
NZ_CP021030.1\|WP_085777457.1\|1299782_1301228_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182502
NZ_CP021030.1\|WP_085777443.1\|1282712_1283366_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP021030.1\|WP_085777445.1\|1284805_1285651_+\|phosphatase	unknown	unknown	gnl\|CDD\|277341
NZ_CP021030.1\|WP_085777440.1\|1280219_1281482_-\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP021030.1\|WP_085777444.1\|1284100_1284703_+\|superoxide-dismutase	unknown	unknown	gnl\|CDD\|223678
NZ_CP021030.1\|WP_085777453.1\|1291876_1292782_+\|class-A-beta-lactamase	unknown	unknown	gnl\|CDD\|185339
NZ_CP021030.1\|WP_085777449.1\|1288983_1289613_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|239354
NZ_CP021030.1\|WP_085780009.1\|1286728_1287364_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP021030.1\|WP_085777441.1\|1281564_1281906_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP021030.1\|WP_085777452.1\|1290718_1291726_+\|CDF-family-Co(II)/Ni(II)-efflux-transporter-DmeF	unknown	unknown	gnl\|CDD\|224151
NZ_CP021030.1\|WP_085780008.1\|1283563_1283890_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021030.1\|WP_085777448.1\|1288020_1288935_+\|cytochrome-c	unknown	unknown	gnl\|CDD\|224921
NZ_CP021030.1\|WP_085777439.1\|1279640_1280258_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP021030.1\|WP_085777446.1\|1285906_1286599_-\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253

Protein	Function_ID	Function_description	E-value
NZ_CP021030.1\|WP_085777455.1\|1295539_1297879_-\|glucose/quinate/shikimate-family-membrane-bound-PQQ-dependent-dehydrogenase	gnl\|CDD\|274418	TIGR03074, PQQ_membr_DH, membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family. This protein family has a phylogenetic distribution very similar to that coenzyme PQQ biosynthesis enzymes, as shown by partial phylogenetic profiling. Members of this family have several predicted transmembrane helices in the N-terminal region, and include the quinoprotein glucose dehydrogenase (EC 1.1.5.2) of Escherichia coli and the quinate/shikimate dehydrogenase of Acinetobacter sp. ADP1 (EC 1.1.99.25). Sequences closely related except for the absense of the N-terminal hydrophobic region, scoring in the gray zone between the trusted and noise cutoffs, include PQQ-dependent glycerol (EC 1.1.99.22) and and other polyol (sugar alcohol) dehydrogenases.	0
NZ_CP021030.1\|WP_085777442.1\|1281921_1282653_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.15493e-26
NZ_CP021030.1\|WP_085777457.1\|1299782_1301228_+\|MFS-transporter	gnl\|CDD\|182502	PRK10504, PRK10504, putative transporter; Provisional.	4.67164e-77
NZ_CP021030.1\|WP_085777451.1\|1290426_1290699_+\|Ni(II)/Co(II)-sensing-transcriptional-repressor-DmeR	gnl\|CDD\|197388	cd10153, RcnR-FrmR-like_DUF156, Transcriptional regulators RcnR and FrmR, and related domains; this domain family was previously known as part of DUF156. This domain family includes various transcriptional regulators that respond to different stressors. It includes Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), and E. coli FrmR (formally known as YaiN, formaldehyde sensitive). Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA; RcnA may act through modulating NikR, to repress the NIkABCDE nickel transporter. In vitro, purified RncR binds to the rncA promoter DNA fragment in the absence of Ni2+ or Co2+, and the affinity of RncR for this promoter is reduced in the presence of excess nickel. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon. This family belongs to a larger superfamily that includes CsoRs (copper-sensitive operon repressors). CsoRs form homotetramers (dimer of dimers). In Mycobacterium tuberculosis CsoR, within each dimer, two Cys residues on opposite subunits, along with a His residue, bind the Cu(I) ion (forming a triagonal S2N coordination complex, C-H-C). These residues are conserved in the majority of members of this superfamily. In this family, however, not all these residues are conserved; in E.coli RcnR and FrmR there is a His or a Thr instead of the second Cys (C-H-H or C-H-T) respectively. For E. coli FrmR, an N-terminal His residue, not conserved in all members of this family, is also involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue that facilitate allosteric regulation of DNA binding for CsoRs are poorly conserved in this family.	1.60917e-33
NZ_CP021030.1\|WP_085777450.1\|1289654_1290149_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.73883e-11
NZ_CP021030.1\|WP_085777454.1\|1292810_1293050_-\|DUF1127-domain-containing-protein	gnl\|CDD\|368980	pfam06568, DUF1127, Domain of unknown function (DUF1127). This family is found in several hypothetical bacterial proteins. In some cases it represents it represents the C-terminal region whereas in others it represents the whole sequence.	0.00257137
NZ_CP021030.1\|WP_085777443.1\|1282712_1283366_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	4.38941e-27
NZ_CP021030.1\|WP_085777445.1\|1284805_1285651_+\|phosphatase	gnl\|CDD\|277341	cd07396, MPP_Nbla03831, Homo sapiens Nbla03831 and related proteins, metallophosphatase domain. Nbla03831 (also known as LOC56985) is an uncharacterized Homo sapiens protein with a domain that belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.47673e-62
NZ_CP021030.1\|WP_085777440.1\|1280219_1281482_-\|multidrug-efflux-MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.00717e-146
NZ_CP021030.1\|WP_085777444.1\|1284100_1284703_+\|superoxide-dismutase	gnl\|CDD\|223678	COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism].	4.48365e-101
NZ_CP021030.1\|WP_085777453.1\|1291876_1292782_+\|class-A-beta-lactamase	gnl\|CDD\|185339	PRK15442, PRK15442, beta-lactamase TEM; Provisional.	1.73139e-78
NZ_CP021030.1\|WP_085777439.1\|1279640_1280258_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.28389e-08
NZ_CP021030.1\|WP_085780009.1\|1286728_1287364_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	3.29244e-37
NZ_CP021030.1\|WP_085777441.1\|1281564_1281906_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.83274e-06
NZ_CP021030.1\|WP_085777452.1\|1290718_1291726_+\|CDF-family-Co(II)/Ni(II)-efflux-transporter-DmeF	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	1.81704e-72
NZ_CP021030.1\|WP_085777456.1\|1298019_1299522_-\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP021030.1\|WP_085777448.1\|1288020_1288935_+\|cytochrome-c	gnl\|CDD\|224921	COG2010, CccA, Cytochrome c, mono- and diheme variants [Energy production and conversion].	3.84134e-17
NZ_CP021030.1\|WP_085777449.1\|1288983_1289613_-\|glutathione-S-transferase	gnl\|CDD\|239354	cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains.	3.16299e-29
NZ_CP021030.1\|WP_085777446.1\|1285906_1286599_-\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.92289e-69

>NZ_CP021030.1|WP_085780009.1|1286728_1287364_+|LysE-family-translocator
MNYHENLWLFFTLLFGIIIVPGMDMLFVLANALTGGIRRGLAATGGIMAGGAVHSAYGAAGVGVLVTMLPQLFNLLLFAGVAYMIWIGVSLMRSSITVEAVGPATARSGWRAFRQGAVTCLVNPKAYIFMFAVYPQFLKPEYGPIWLQGLIMGAMTVVTQFAVYGALAMTAGRSRDLLVANPDATAFVGRCAGLLLVAVSAFSLWQGWKTA
>NZ_CP021030.1|WP_085777446.1|1285906_1286599_-|YafY-family-transcriptional-regulator
MRKASRLFEIIQILRLARKPMTAAVMAETLEVTVRSIYRDIAALQAMRVPIEGGRGIGYIMRPGFDLPPLMFSIEEMEAIVLSLALLERTADEELKQAARRVNQKISGAVPAPLREAMNNKALYAWGSTAQPAAIDLAVVRRAIRDERKLMLAYRDELGRASERTIQPIALIYYSQTANIVAWCELRQAIRNFRSDRVEGCEEADDFFKGDGDRLRDLWTSGWTEKAAAV
>NZ_CP021030.1|WP_085777445.1|1284805_1285651_+|phosphatase
MSSSAVPLFRFGIIADPQYAAVAPHAAMDRHYANSLTKVAEAIEIFNGEELSFVMTLGDVIDRSFASFDDILPVYGKLRHEALFLLGNHDFSVSAGHLSEIVARLGMPSPYYSFSRHGWRFIVLDGSEVSAFAPPENHPHRALAARMLAELQAKEAANAHHWNGALSDEQFAWLGDEIANAAAAGEKVIVMNHYPVYPPGEHGMWDSERVVALLASQPHVVAYLNGHDHVGNYGKAGACHFVNFKGVVDTENQNAFAIVELHPNRIEIRGFGREESRTLVY
>NZ_CP021030.1|WP_085777444.1|1284100_1284703_+|superoxide-dismutase
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKSFGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFANAGATQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEAFIDSLINWDYVLERYEAATK
>NZ_CP021030.1|WP_085780008.1|1283563_1283890_-|hypothetical-protein
MNRNIIPHLAIAALPFLVTAAHASSDEAWKQLAAEVEAKCRKAAVAIEKPNAVVDPFGSSRYGLALVTGKPKGAKGFVVQICVYDKQEKSVEIGSEMDAKELGLTPAK
>NZ_CP021030.1|WP_085777443.1|1282712_1283366_-|class-I-SAM-dependent-methyltransferase
MSERRDRAEDQQKIYQRWAPVYDRVYRGILRDGHRKLAALAAAAGTDILEIGVGTGLTLAHYPNRCRVTGIDISEHMIARAREKVRRENLQHVRALEVMDAHALRLADKSFDVVCLPFVITLIPEPERALDECARVLRPGGEIILASKLGDGAGLQGVIEAAVAPLVRHIGWSSAFRIHRIVAWAERRGDFSTTDILPVFPNGFFKIVRLKQRGFSS
>NZ_CP021030.1|WP_085777442.1|1281921_1282653_-|sulfite-exporter-TauE/SafE-family-protein
MTSDIFFFIAVGFCAQIVDGALGMAFGVLSTTSLLAFGVPAANASAMTHVTEMFTTAASGLSHTYHRNVDWRLVARLAPAGMIGGAIGATLLANINGKVIEPFVSAYLIAIGLLILYKAFRPQNRREVRDWAVPPVGFCGGLLDAIGGGGWGPVVTSTLIGRGHDLKRVIGSTNFTEFAVTLTISITFVVTLGWSELNSAIGLIIGGVIAAPFGAILVKRLPVRALMVAVSMVIITTSALRIF
>NZ_CP021030.1|WP_085777441.1|1281564_1281906_+|nuclear-transport-factor-2-family-protein
MQSVNRRTCHVRDLYSAYLADRKDIAGAMLTEDFTFSSPRDHHIDRAAYFERCWPKEPLFRAIHIEFLAINGDEAAVRYRAEKLDGASFANMESLRFRGDRIASVEVYFGRNL
>NZ_CP021030.1|WP_085777440.1|1280219_1281482_-|multidrug-efflux-MFS-transporter
MTDTQWDAGVRPGSIYWKRNLAVSLIGSFTTIVAMTLLLPFLPLYVEELGVTDHAAIVQWSGIAYGATFLAAALVAPLWGRLGDIYGRKLMLVRASLGMTLAISLMGMAGDVWQLVALRLFVGLAGGYSSGSMVLVATQTPKDRSAWALGVLSSGIMAGNLVGPLIGGALPPIIGIRGTFLAAGGMIFFAFLATTLLIKEEKSPDRRQAAKASGGWKSIADRRPVIAMLATGMLLMLANMSIEPIITVYVAEILPVEAQVTMISGLVMSAAALGSILSASWLGRLADRIGHWPVIAGALAVAGLLLIPQAFVTSSWQLILLRFLMGAALGGLLPCIAAVIRHSVPDSAAGSILGLSVSSQYVGQVAGPVLGGFVGGHIGMRAVFLGTSLLLVAGAAYAWAVRPRDTETSNMRASADQLDA
>NZ_CP021030.1|WP_085777439.1|1279640_1280258_+|TetR/AcrR-family-transcriptional-regulator
MKDQKKRGRPRAFDAKAALGKARDVFWDRGFAAASLDNLSAATNLNRPSLYGAFGDKEALYLDALEAYRQDGMDVLKQALDPSLPLRDNLARVYAGALAIYLHGETAARGCLLIGTASVEAVEHERVREVLGRSLNDFDGEIEKRMRIAVERGELPESADPLALARLASAVMHSLAVRARAGDSRETLEAIARSGVELICGSTHV
>NZ_CP021030.1|WP_085777448.1|1288020_1288935_+|cytochrome-c
MVRRFIRLLLCLIGVAVLGGGAVYVVTAPDPLPESHWAGLGAPDPANGEMVFWAGGCVSCHSAPGSEGDARLTLAGGLALKSPFGTFHVPNISPDEKAGIGAWTLAQFGNAMKRGVAPGGEHLYPSFPYGSYSRMSDKDVNDLFAFLKTLPKSTSVAPPHELPFPYNIRLALGGWKFLYFNDQPRVALAKNDDKIKRGQYLVEGPGHCGECHTPRDALGGFQADLWLAGAPNPEGKGRIPDITPASKSIGNWSEADIANYLETGFTPDFDSVGGSMVDVQHNIARLPAADREAIAAYLKAVPGR
>NZ_CP021030.1|WP_085777449.1|1288983_1289613_-|glutathione-S-transferase
MPDFKLHCFALSGNAYKVALFFALAGIEWESIFVDYLGGETRTEQWRETINEQGEAPVLEHGQTKISQSGVILDYLSEVTGQFGAQSAEERREIMRWILFDNHKFTSCYATLRFIFGLQKSGETPVVEFLRLRAKAAYAIVDGHLAHRAFMVGNRVTIADLSLAGYVFMPEETGIDHRAYPAIAAWKDRISSMPGWRHPYDLMPGPTSL
>NZ_CP021030.1|WP_085777450.1|1289654_1290149_-|GNAT-family-N-acetyltransferase
MTEIEDSEISLMRPSVVTIRAAKPRDLPELNEMIALLAAHHGDAAATTPEQLERDLFGPLPWITALVAETSEGLIGYAILVPLYRAQEGKRGMDLHHLFVRDGHRGHGTGQLLVDRARETARNAGCGYLSVSAATGNVLAHRFYEQMDFTPRPVTGMRYMQSIA
>NZ_CP021030.1|WP_085777451.1|1290426_1290699_+|Ni(II)/Co(II)-sensing-transcriptional-repressor-DmeR
MSHTTLQKKKLIARVSRLKGQLEAVERALEAERPCGEILRLLASIRGALTGLTGEVLDDHLREHVLNAEDDRARAEAVEEISEVLRTYIR
>NZ_CP021030.1|WP_085777452.1|1290718_1291726_+|CDF-family-Co(II)/Ni(II)-efflux-transporter-DmeF
MNAGIGKVEVKALQHDHVFLGADHLRNERRIWLVIALTAVMMVAEIAAGTVYGSMALVADGWHMSTHASALLISALAYLFARRQARNPRFTFGTGKLGDLAGFASAIVLALIALLMAWESLLRLSNPVPIGFAQAIAVAVIGLAVNLASAWLLAGGGHAAHGHHAHAHGHHAHGHHAHRNGHGGHGDHAHHHAEAGDNNIRAAYLHVMADALTSVLAIAALTLGSLYGWLWLDPIMGIVGGLVIANWSWSLLKSSGGVLLDIMPEGETLPGEIRQAIETEEDRITDLHVWQVGPGHHAAIVAVVTSQARDPAFYKDRLSALEELSHVTVEVTRAA
>NZ_CP021030.1|WP_085777453.1|1291876_1292782_+|class-A-beta-lactamase
MDPSLTRRMLIGSALCLPALGLSTLALAANAQETAGEGDDNIERRLAALEKRTGGRLGVSVLDTQTSISFGYRGSEAFPMCSTFKALAAGFVLARVDKGQESLERRVTYGRDKLVDYSPLSEKHAGADGMTIAELCEAAVTVSDNTAGNLLLESFGGPPALTDWLRSIGDGTTRLDRTEPTLNEGRKDDPRDTTAPDAMLDTLGNLTLGSVLTGASCDKLIAWLVASTTGKERLRAGLPADWKVGDKTGTGPNGSLGDIAVIWPPDRGPIVAAVYIAEATAPVKDLNPTFAEVGRMITEMV
>NZ_CP021030.1|WP_085777454.1|1292810_1293050_-|DUF1127-domain-containing-protein
MAHTETQPIVSAPTNQVAGPTNIIANLIAGLQAWRRAVVSRQRLAELTPDQLRDIGHPEANRPVLEIKAGLITNLMSMR
>NZ_CP021030.1|WP_085777455.1|1295539_1297879_-|glucose/quinate/shikimate-family-membrane-bound-PQQ-dependent-dehydrogenase
MALVITSILFIIIGVALGGGGLWLISLGGSIFYLFAGLMFLITAALLLMRKAVALWVYAVLVVAALAWAIWEVGFDWWQLGPRGGVIILLGLWLLTPWIRRPLGFRSPTGIVYGANPWPLAVPVILAILVAVYSMTTDPHDLAGDLPKDAVAANPAFGGSVPDGEWHQYGRTPFGQRYSPLDQINVANVSTLKEAWRYQTGDVKRPEDISETTYQVTPLKVKDTLYLCTPHNWAIALDAKTGKEKWKYDSNSGMNPNRQHQTCRGVTYYADPDGAAGEPCAERVYLPTSDARLIALDAADGKVCTSFADQGVLHLETGMRFNPAGYYYSTSPPVAVAGEIIIGGAVNDNYSTEEQSGVIRAFDIKTGALIWNWDSGNPDVTTPIADGQTYTTNSPNSWSVFSVDEALGMVYIPLGNQVPDQIGIGRSDNVEKFSSSIVALDIASGQLRWVRQTVHHDLWDMDVPAQPALIDLTKPDGSVVPALVGPTKQGDLYVLDRRSGEPIIPTKEIPAPGGAVSGDHTSPTQPISDLTFSPEPLREKDMWGVSLFDQLLCRIDFHRYRYEGRYTPPSLKGTIVYPGNFGTFNWGSVAVDPERQIMFGMPTYLAFTSRLVPAADIPPRGQDEKGSEQGLNRNDGAPYGVFMGPFLGPLQIPCQAPPWGYVAGVDLRTGKIAYMHKNGTVHDMTPLPLPFKVGVPGIGGPMLTKGGVAFLGAAVDNYLRAYDVTNGRELWRARLPAGGQATPMTYTTDDNKQYVVMVAGGHGSVGTTPGDYVIAYTLP
>NZ_CP021030.1|WP_085777456.1|1298019_1299522_-|YdiU-family-protein
MTSTPQKIRSGAAFPFDNSYVGLPERFFARQMPTPVAEPRLIKLNEPLAAELGLDVETLRRDGAAIFSGNLVPEGAEPLAMAYAGHQFGGFSPQLGDGRAILLGEVVDRSGKRFDIQLKGAGPTPFSRRGDGRAAIGPVLREYIISEAMFALGIPATRALAAVTTGEPVYREEVLPGAVFTRVAASHIRVGTFQYFAARGDTDGVRALADYVVDRHYPELKAAEEPHLALFSAIAERQAALIARWLHVGFIHGVMNTDNMTVSGETIDFGPCAFMDVYNPATVFSSIDQHGRYAYANQPSIGQWNLARLGETLLPLIGPEPDDAVDKANAIIRAYGERFQAEWLAGMRRKVGIAGEEDGDLELVQALLSLMQAQGGDFTLTFRRLADLAGNDGAEPAFAGGFREPEACTPWLTRWRERLSRDPQTAAQRASAMRRVNPAFIPRNHRVEQAIEAAVEHGDFSLFEALLTVLSKPYEDRPEFAAYMEPPKPEERVLQTFCGT
>NZ_CP021030.1|WP_085777457.1|1299782_1301228_+|MFS-transporter
MSDQIYQAPMVRRAAPNFRVIAMIVASAMLMENIDATVLATALPTMARDFAVSAPAMSISLTSYLLSLAIFIPASGRMADSFGSRTVFRAAIAVFVIGSVLCALAPTLPFLVLARLLQGMGGAMMMPVGRLVLMRSVARKDMVSAMSWLLVPALIGPIVGPPLGGFIVTYLDWRWIFYINVPIGIIGMIFVSIYIDEVKGKAAGPFDTIGFILSGISLGSLLFGFEMSSHEGEGAFSIFLISVGLLFGIGYLRHARRHPSPIMDFSLMKVSSFGTSVIAGSLTRITQGAQPFLLPLLFQIGFGLSAAAAGQIVISTALGALAMKPMARFVFSRLGFRRSLVLNGILGTAGYALCAAFRPDWPMPLIFVVLVLSAFFLSFQFTAYNTIAYDEIDKERMSSATSFYTTFQQLMLSLGICIGALALHGSMAFSGSETPDLGDFSTAFIVVTIISITATVWNLRFSPTAGEEISGYKAKRAKDAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1620770 : 1629992

Aeromonas_phage(14.29%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085777703.1\|1620770_1622069_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.9e-97	51.0
WP_003547190.1\|1622078_1622555_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_085777704.1\|1622558_1623869_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.2e-32	39.9
WP_085777705.1\|1623868_1624480_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.0e-17	35.4
WP_085777706.1\|1624596_1625466_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	9.8e-95	59.2
WP_085777707.1\|1625476_1626364_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_085777708.1\|1626367_1627423_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.8e-95	51.8
WP_085777709.1\|1627429_1628008_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	2.4e-33	43.4
WP_085780032.1\|1627997_1629992_-	hypothetical protein	A0A0G2Y9S0	Acanthamoeba_polyphaga_mimivirus	3.0e-06	25.9

DBSCAN-SWA_2

1942590 : 2007062

Rhizobium_phage(75.47%)

terminase,transposase,tail,tRNA,integrase,capsid

attL 1956563:1956578|attR 2015082:2015097

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085780050.1\|1942590_1943604_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	4.8e-24	41.9
WP_085780051.1\|1943622_1944480_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.6e-33	37.2
WP_085777929.1\|1944476_1945181_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.3e-41	48.8
WP_085777930.1\|1945363_1945555_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	3.4e-08	72.1
WP_085777931.1\|1945606_1946221_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_085777932.1\|1946217_1947045_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.2e-53	46.1
WP_085777933.1\|1947135_1948419_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.4e-97	45.8
WP_085777934.1\|1948423_1949197_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	4.0e-23	30.2
WP_085777935.1\|1949193_1949847_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.1e-17	35.3
WP_085777936.1\|1950031_1951621_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	6.6e-12	29.2
WP_085780052.1\|1951710_1952583_-	ATP-binding protein	NA	NA	NA	NA
WP_064696006.1\|1952788_1953136_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	3.2e-12	38.0
WP_085777937.1\|1953181_1955713_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.1e-57	49.0
WP_085777938.1\|1955717_1956104_+	hypothetical protein	NA	NA	NA	NA
WP_085777939.1\|1956106_1956964_+	phytoene/squalene synthase family protein	NA	NA	NA	NA
1956563:1956578	attL	NA	NA	NA	NA
WP_085777940.1\|1957035_1957503_+	hypothetical protein	NA	NA	NA	NA
WP_085777941.1\|1957512_1958946_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_085777942.1\|1959051_1959195_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_004678838.1\|1959493_1959640_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_085777943.1\|1960524_1961619_+	DUF2157 domain-containing protein	NA	NA	NA	NA
WP_085777944.1\|1961615_1962206_+	GDYXXLXY domain-containing protein	NA	NA	NA	NA
WP_085777945.1\|1962702_1965279_+	hypothetical protein	L7TQW5	Rhizobium_phage	0.0e+00	93.4
WP_157131385.1\|1965431_1965593_+	hypothetical protein	L7TJ64	Rhizobium_phage	7.7e-22	94.3
WP_085777946.1\|1965608_1966286_+	hypothetical protein	L7TML1	Rhizobium_phage	1.6e-108	81.7
WP_157131386.1\|1966285_1966462_+	hypothetical protein	L7TK99	Rhizobium_phage	3.7e-25	91.4
WP_085777947.1\|1966494_1967292_+	hypothetical protein	L7TQX0	Rhizobium_phage	7.6e-94	65.4
WP_085777948.1\|1967377_1968088_+	DUF2815 family protein	L7TLT1	Rhizobium_phage	1.5e-125	96.6
WP_085777949.1\|1968095_1968506_+	endodeoxyribonuclease	L7TJ68	Rhizobium_phage	1.2e-74	97.8
WP_157131387.1\|1968498_1969119_+	LysM peptidoglycan-binding domain-containing protein	L7TML5	Rhizobium_phage	2.6e-113	97.0
WP_085777950.1\|1969213_1969891_+	hypothetical protein	L7TKA4	Rhizobium_phage	3.1e-80	68.1
WP_157131388.1\|1969887_1970058_+	hypothetical protein	NA	NA	NA	NA
WP_085777951.1\|1970054_1970255_+	hypothetical protein	NA	NA	NA	NA
WP_085777952.1\|1970251_1970434_+	hypothetical protein	NA	NA	NA	NA
WP_085777953.1\|1970437_1972057_+	AAA family ATPase	L7TLT7	Rhizobium_phage	5.4e-272	94.5
WP_157131448.1\|1972225_1974190_+	DNA polymerase	L7TJ71	Rhizobium_phage	0.0e+00	92.4
WP_085777955.1\|1974193_1974400_+	hypothetical protein	L7TML7	Rhizobium_phage	1.5e-30	95.6
WP_085777956.1\|1974472_1974874_+	hypothetical protein	L7TKA9	Rhizobium_phage	2.4e-64	94.7
WP_085777957.1\|1974873_1975071_+	hypothetical protein	L7TQX7	Rhizobium_phage	5.9e-32	93.8
WP_085777958.1\|1975063_1975822_+	hypothetical protein	L7TLU4	Rhizobium_phage	3.1e-137	94.0
WP_157131389.1\|1975806_1976505_+	hypothetical protein	L7TJ75	Rhizobium_phage	3.6e-87	84.9
WP_085777960.1\|1976529_1977006_+	hypothetical protein	L7TMM1	Rhizobium_phage	1.8e-21	78.0
WP_157131390.1\|1977002_1977161_+	hypothetical protein	L7TKB4	Rhizobium_phage	2.1e-19	94.2
WP_085777963.1\|1977655_1979209_+\|tail	phage tail protein	L7TJ79	Rhizobium_phage	1.1e-264	92.6
WP_085777964.1\|1979328_1979838_+	hypothetical protein	L7TKB9	Rhizobium_phage	1.3e-54	75.7
WP_085777965.1\|1979847_1980612_+	hypothetical protein	L7TQY4	Rhizobium_phage	1.5e-107	80.9
WP_085777966.1\|1980621_1980852_+	hypothetical protein	L7TLV7	Rhizobium_phage	7.7e-31	97.4
WP_085777967.1\|1981194_1982172_+\|capsid	capsid protein	L7TJ83	Rhizobium_phage	5.2e-177	97.2
WP_085777968.1\|1982241_1982553_+	hypothetical protein	NA	NA	NA	NA
WP_085780053.1\|1983453_1984953_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_085777969.1\|1984952_1985687_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.7e-32	33.7
WP_085777970.1\|1986749_1987361_+\|tail	phage tail protein	L7TQY6	Rhizobium_phage	6.2e-104	94.6
WP_085777971.1\|1987360_1989742_+	hypothetical protein	L7TLW2	Rhizobium_phage	0.0e+00	93.2
WP_085777972.1\|1989741_1990206_+	hypothetical protein	L7TJ86	Rhizobium_phage	2.6e-62	72.7
WP_085777973.1\|1990198_1990738_+	hypothetical protein	L7TMN3	Rhizobium_phage	4.3e-64	77.1
WP_085777974.1\|1990737_1992747_+	hypothetical protein	L7TKC9	Rhizobium_phage	0.0e+00	93.5
WP_085777975.1\|1992756_1996530_+	transglycosylase SLT domain-containing protein	L7TQZ1	Rhizobium_phage	0.0e+00	94.1
WP_085777976.1\|1996593_1997841_+	hypothetical protein	L7TLW7	Rhizobium_phage	3.1e-150	87.2
WP_085777977.1\|1997843_1998434_+	hypothetical protein	L7TMN7	Rhizobium_phage	2.9e-42	86.9
WP_085777978.1\|1998433_1998682_+	hypothetical protein	L7TKD4	Rhizobium_phage	3.6e-34	100.0
WP_085777979.1\|1998681_1998903_+	hypothetical protein	L7TQZ6	Rhizobium_phage	3.0e-32	97.3
WP_085777980.1\|1999028_2000717_+\|terminase	phage terminase large subunit	L7TLX3	Rhizobium_phage	0.0e+00	96.4
WP_085777981.1\|2000961_2001375_+	hypothetical protein	L7TJ94	Rhizobium_phage	8.9e-70	97.8
WP_157131391.1\|2001852_2002707_-	hypothetical protein	L7TR00	Rhizobium_phage	4.1e-77	88.5
WP_085777983.1\|2003374_2004142_+	hypothetical protein	A0A076YL19	Mesorhizobium_phage	3.1e-84	64.7
WP_157131392.1\|2004248_2004467_+	hypothetical protein	L7TQW1	Rhizobium_phage	1.0e-32	97.2
WP_085777985.1\|2004469_2004694_+	hypothetical protein	NA	NA	NA	NA
WP_157131393.1\|2004693_2004858_+	hypothetical protein	L7TLR9	Rhizobium_phage	3.5e-22	94.4
WP_085777986.1\|2005568_2005955_+	winged helix-turn-helix transcriptional regulator	L7TMK8	Rhizobium_phage	4.1e-61	97.7
WP_157131394.1\|2006045_2007062_+\|integrase	site-specific integrase	L7TK95	Rhizobium_phage	2.2e-162	82.2
2015082:2015097	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2224711 : 2234931

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085778164.1\|2224711_2227633_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1
WP_085778165.1\|2227915_2228422_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	3.2e-45	56.5
WP_085778166.1\|2228547_2229195_-	MarC family protein	NA	NA	NA	NA
WP_085778167.1\|2229432_2232240_+	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	2.5e-75	41.6
WP_085778168.1\|2232891_2233191_-	hypothetical protein	NA	NA	NA	NA
WP_085778169.1\|2233281_2233776_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.3e-24	37.2
WP_020921292.1\|2233819_2234392_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	5.7e-43	54.7
WP_085778170.1\|2234421_2234931_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.6e-44	58.8

DBSCAN-SWA_4

4042278 : 4052299

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085779580.1\|4042278_4042989_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	6.0e-50	49.1
WP_085779581.1\|4042988_4043345_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_085779582.1\|4043341_4044070_+	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	6.2e-42	38.2
WP_085780202.1\|4044075_4045299_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	8.3e-15	29.9
WP_085780203.1\|4045399_4046374_-	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	9.5e-139	75.1
WP_085779583.1\|4046582_4048751_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	3.8e-212	52.8
WP_085779584.1\|4048729_4049131_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A249Y1D6	Staphylococcus_phage	1.3e-09	35.3
WP_085779585.1\|4049144_4049366_-	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.9e-17	53.4
WP_085780204.1\|4050061_4052299_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.6e-123	40.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021031

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

288406 : 336721

Stx2-converting_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085780431.1\|288406_288640_+\|transposase	transposase	NA	NA	NA	NA
WP_157131477.1\|288621_289014_+	hypothetical protein	NA	NA	NA	NA
WP_157131478.1\|289290_289719_+	hypothetical protein	NA	NA	NA	NA
WP_157131479.1\|290163_290391_+	hypothetical protein	NA	NA	NA	NA
WP_086083886.1\|290554_291772_+	cytochrome P450	NA	NA	NA	NA
WP_085780434.1\|291807_292050_+	ferredoxin	NA	NA	NA	NA
WP_085780596.1\|292256_292808_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_085780597.1\|292864_294442_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-09	28.7
WP_085780435.1\|294719_295817_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_085780436.1\|295871_296627_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.3e-10	38.0
WP_085780598.1\|299299_299659_+	Nif11 family protein	NA	NA	NA	NA
WP_085780599.1\|299752_301231_+	radical SAM family RiPP maturation amino acid epimerase	NA	NA	NA	NA
WP_085780600.1\|303069_303963_+	nitrogenase iron protein	NA	NA	NA	NA
WP_085780438.1\|304074_305577_+	nitrogenase molybdenum-iron protein alpha chain	NA	NA	NA	NA
WP_085780439.1\|305699_307241_+	nitrogenase molybdenum-iron protein subunit beta	NA	NA	NA	NA
WP_085780440.1\|307300_308785_+	nitrogenase iron-molybdenum cofactor biosynthesis protein NifE	NA	NA	NA	NA
WP_085780441.1\|308794_310153_+	nitrogenase iron-molybdenum cofactor biosynthesis protein NifN	NA	NA	NA	NA
WP_085780442.1\|310149_310644_+	nitrogen fixation protein NifX	NA	NA	NA	NA
WP_085780443.1\|310647_311133_+	NifX-associated nitrogen fixation protein	NA	NA	NA	NA
WP_157131480.1\|311399_312392_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_085780444.1\|313533_315171_-	MFS transporter	NA	NA	NA	NA
WP_085780445.1\|316687_317413_+	response regulator	NA	NA	NA	NA
WP_085780446.1\|317803_318628_+	LuxR family transcriptional regulator	A0A1I9KF49	Aeromonas_phage	7.1e-18	28.3
WP_157131481.1\|319287_320856_+	hypothetical protein	NA	NA	NA	NA
WP_157131482.1\|320842_321910_+	lysine 2,3-aminomutase	NA	NA	NA	NA
WP_085780449.1\|322471_323359_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_085780601.1\|323699_324560_+	cupin-like domain-containing protein	NA	NA	NA	NA
WP_085780450.1\|325056_326304_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_085780452.1\|329358_330585_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_157131483.1\|331135_331606_+\|transposase	transposase	NA	NA	NA	NA
WP_010003750.1\|331505_331850_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_085780453.1\|331923_333516_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	7.1e-75	35.7
WP_085780454.1\|334419_335466_+	peptidase C45	NA	NA	NA	NA
WP_157131484.1\|336289_336721_+\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	3.8e-07	39.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP021033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

514623 : 525537

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085781727.1\|514623_516021_-	sensor histidine kinase	W8CYF6	Bacillus_phage	4.1e-18	28.5
WP_085781728.1\|516010_516679_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.9e-06	30.4
WP_085781729.1\|516885_517452_+	isochorismatase family protein	NA	NA	NA	NA
WP_085781730.1\|517448_518459_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_085781731.1\|518948_521288_-	PAS domain S-box protein	Q8QNA2	Ectocarpus_siliculosus_virus	1.3e-11	38.7
WP_085781732.1\|521507_521927_-	HD domain-containing protein	G3KAZ0	Pseudomonas_phage	2.8e-07	32.6
WP_085781733.1\|521932_522259_-	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_085781734.1\|522340_522697_-	hypothetical protein	NA	NA	NA	NA
WP_085781735.1\|522804_523095_-	hypothetical protein	NA	NA	NA	NA
WP_085781736.1\|523443_523758_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	1.6e-23	58.5
WP_085781737.1\|523908_525537_+	chaperonin GroEL	A0A240F779	uncultured_virus	4.1e-179	60.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021031

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP021033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection