CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021054	Methylorubrum zatmanii strain PSBB041 chromosome, complete genome	3 crisprs	csa3,DEDDh,PD-DExK,WYL,cas3	1	3	2	0
NZ_CP021055	Methylobacterium zatmanii strain PSBB041 plasmid unnamed sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021054_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021054_1

3627601-3627842

Orphan

Consensus_repeat	Method
TCGATCCGGACAAGGACGGCACG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP021054_1

>merge|NZ_CP021054|1|3627601-3627842|CRISPRCasFinder
TCGATCCGGACAAGGACGGCACGATCGATCTGAAGGAGGCCCTGGCCGCCGGCTCCGCTGCCTTCGACAAGCTCGATCCGGATAAGGACGGCACGCTCGATGCCAAGGAGCTCAAGGGCCGCGTCAGCGAGGCCGACCTCAAGAAGCTCGACCCGGACAACGACGGCACCCTCGACAAGAAGGAATACCTTGCCGCCGTCGAGGCGCAATTCAAGGCCGCTAACCCGGACAATGATGGCACC

>NZ_CP021054|1|1|3627601-3627842|CRISPRCasFinder
TCGATCCGGACAAGGACGGCACG	ATCGATCTGAAGGAGGCCCTGGCCGCCGGCTCCGCTGCCTTCGACAAGC
TCGATCCGGATAAGGACGGCACG	CTCGATGCCAAGGAGCTCAAGGGCCGCGTCAGCGAGGCCGACCTCAAGAAGC
TCGACCCGGACAACGACGGCACC	CTCGACAAGAAGGAATACCTTGCCGCCGTCGAGGCGCAATTCAAGGCCG
CTAACCCGGACAATGATGGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021054.1\|WP_085857104.1\|3639138_3639633_+\|DUF4102-domain-containing-protein	unknown	unknown	gnl\|CDD\|379139
NZ_CP021054.1\|WP_056506576.1\|3635868_3637743_-\|DNA-polymerase-III-subunit-gamma/tau	unknown	unknown	gnl\|CDD\|236382
NZ_CP021054.1\|WP_056506583.1\|3628567_3630124_-\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
NZ_CP021054.1\|WP_085857103.1\|3637999_3638488_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_085857100.1\|3623486_3624116_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_085857099.1\|3621561_3621840_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_003601795.1\|3628104_3628464_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234609
NZ_CP021054.1\|WP_056506594.1\|3620035_3621022_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274824
NZ_CP021054.1\|WP_003607156.1\|3638522_3638783_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|379323
NZ_CP021054.1\|WP_056464855.1\|3624663_3627183_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|366183
NZ_CP021054.1\|WP_056506600.1\|3617090_3617801_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235014
NZ_CP021054.1\|WP_056506597.1\|3617846_3618368_-\|DUF2380-domain-containing-protein	unknown	unknown	gnl\|CDD\|371669
NZ_CP021054.1\|WP_085857102.1\|3632487_3634902_+\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|225747
NZ_CP021054.1\|WP_015822387.1\|3621836_3622586_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|274822
NZ_CP021054.1\|WP_003601812.1\|3618600_3619869_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|274821
NZ_CP021054.1\|WP_012253408.1\|3635455_3635779_-\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|234669
NZ_CP021054.1\|WP_012752622.1\|3622582_3623476_+\|multidrug-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|163573
NZ_CP021054.1\|WP_085857101.1\|3630255_3631515_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP021054.1\|WP_003601790.1\|3631687_3632266_-\|polysaccharide-export-protein	unknown	unknown	gnl\|CDD\|224512
NZ_CP021054.1\|WP_015822385.1\|3621113_3621548_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|259872

Protein	Function_ID	Function_description	E-value
NZ_CP021054.1\|WP_085857104.1\|3639138_3639633_+\|DUF4102-domain-containing-protein	gnl\|CDD\|379139	pfam13356, Arm-DNA-bind_3, Arm DNA-binding domain. This DNA-binding domain is found at the N-terminus of a wide variety of phage integrase proteins.	5.53797e-12
NZ_CP021054.1\|WP_056506576.1\|3635868_3637743_-\|DNA-polymerase-III-subunit-gamma/tau	gnl\|CDD\|236382	PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated.	0
NZ_CP021054.1\|WP_056506583.1\|3628567_3630124_-\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	3.13991e-178
NZ_CP021054.1\|WP_015822385.1\|3621113_3621548_+\|hypothetical-protein	gnl\|CDD\|259872	cd04210, Cupredoxin_like_1, Uncharacterized Cupredoxin-like subfamily. Cupredoxins contain type I copper centers and are involved in inter-molecular electron transfer reactions. Cupredoxins are blue copper proteins because they have an intense blue color due to the presence of a mononuclear type 1 (T1) copper site. Structurally, the cupredoxin-like fold consists of a beta-sandwich with 7 strands in 2 beta-sheets, which is arranged in a Greek-key beta-barrel. Some of these proteins have lost the ability to bind copper. Majority of family members contain multiple cupredoxin domain repeats; ceruloplasmin and coagulation factors V/VIII have six repeats; Laccase, ascorbate oxidase, and spore coat protein A, and multicopper oxidase CueO contain three repeats; and nitrite reductase has two repeats. Others are mono-domain cupredoxins, such as plastocyanin, pseudoazurin, plantacyanin, azurin, rusticyanin, stellacyanin, quinol oxidase and the periplasmic domain of cytochrome c oxidase subunit II.	2.06631e-07
NZ_CP021054.1\|WP_085857101.1\|3630255_3631515_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.53724e-46
NZ_CP021054.1\|WP_003601795.1\|3628104_3628464_+\|hypothetical-protein	gnl\|CDD\|234609	PRK00068, PRK00068, hypothetical protein; Validated.	0.000154502
NZ_CP021054.1\|WP_056506594.1\|3620035_3621022_+\|hypothetical-protein	gnl\|CDD\|274824	TIGR03866, PQQ_ABC_repeats, PQQ-dependent catabolism-associated beta-propeller protein. Members of this protein family consist of seven repeats each of the YVTN family beta-propeller repeat (see TIGR02276). Members occur invariably as part of a transport operon that is associated with PQQ-dependent catabolism of alcohols such as phenylethanol.	0
NZ_CP021054.1\|WP_003607156.1\|3638522_3638783_-\|PepSY-domain-containing-protein	gnl\|CDD\|379323	pfam13670, PepSY_2, Peptidase propeptide and YPEB domain. This region is likely to have a protease inhibitory function (personal obs:C Yeats). The name is derived from Peptidase & Bacillus subtilis YPEB.	1.17039e-13
NZ_CP021054.1\|WP_056464855.1\|3624663_3627183_+\|TonB-dependent-receptor	gnl\|CDD\|366183	pfam00593, TonB_dep_Rec, TonB dependent receptor. This model now only covers the conserved part of the barrel structure.	9.3452e-34
NZ_CP021054.1\|WP_056506600.1\|3617090_3617801_-\|hypothetical-protein	gnl\|CDD\|235014	PRK02227, PRK02227, (5-formylfuran-3-yl)methyl phosphate synthase.	5.75003e-75
NZ_CP021054.1\|WP_056506597.1\|3617846_3618368_-\|DUF2380-domain-containing-protein	gnl\|CDD\|371669	pfam11684, DUF3280, Protein of unknown function (DUF2380). This family of proteins with unknown function appears to be restricted to Proteobacteria.	2.00332e-49
NZ_CP021054.1\|WP_085857102.1\|3632487_3634902_+\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|225747	COG3206, GumC, Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane].	8.9914e-76
NZ_CP021054.1\|WP_015822387.1\|3621836_3622586_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|274822	TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	6.14626e-126
NZ_CP021054.1\|WP_003601812.1\|3618600_3619869_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|274821	TIGR03863, PQQ_ABC_bind, ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are putative substrate-binding proteins of an ABC transporter family that associates, in gene neighborhood and phylogenomic profile, with pyrroloquinoline-quinone (PQQ)-dependent degradation of certain alcohols, such as 2-phenylethanol in Pseudomonas putida U. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	0
NZ_CP021054.1\|WP_012253408.1\|3635455_3635779_-\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|234669	PRK00153, PRK00153, YbaB/EbfC family nucleoid-associated protein.	1.93994e-39
NZ_CP021054.1\|WP_012752622.1\|3622582_3623476_+\|multidrug-ABC-transporter-permease	gnl\|CDD\|163573	TIGR03861, ABC_efflux_transporter_permease_protein, alcohol ABC transporter, permease protein. Members of this protein family, part of a larger class of efflux-type ABC transport permease proteins, are found exclusively in genomic contexts with pyrroloquinoline-quinone (PQQ) biosynthesis enzymes and/or PQQ-dependent alcohol dehydrogenases, such as the phenylethanol dehydrogenase PedE of Pseudomonas putida U. Members include PedC, an apparent phenylethanol transport protein whose suggested role is efflux to limit intracellular concentrations of toxic metabolites during phenylethanol catalysis. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	4.94525e-117
NZ_CP021054.1\|WP_003601790.1\|3631687_3632266_-\|polysaccharide-export-protein	gnl\|CDD\|224512	COG1596, Wza, Periplasmic protein involved in polysaccharide export, contains SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis].	1.70025e-30

>NZ_CP021054.1|WP_056464855.1|3624663_3627183_+|TonB-dependent-receptor
MRVLRGSLIASVALLPGHVMAQGAGGGQAVTLEEISVVSNTPVAASRRVVATQTPSGLREVTVLDGIDRNKLPQNTSVLTSGDVSRVGFPSTVRALDERVGSISVNNAQGNPFQPTITYRGFEASPLGGSPQGVAVYLNGARFNTSFGDTVQWDLIPDIAVDRIELEGSNPAFGLNALGGSLAVTLKNGFTYQGSEINVLGGSFGRGAVAFQHGQRIDNIGLYVAGTKLGEDGWRKHSPSRLNQIYADLGVQGEKSEFHFNVIGASNSLTGNGTAPVELLKADRSDVFTYPDQTKNDFLRFQLSGTYDVTPTITVQGNAYYGLFRQRTANGDAADVENCEVDERFVCSEGADDNQFFLRDRTGSPVRTDRLRTFNFGGINPTFADRFDEGGPYAFLNQTRTSTDNFGATVQTVIRETLFGLPNRFVLGGQYDGGRTRFGADNSIGGLTLDRGFSPPGIVVSSDDGIITPVSVHTSNDYGGIYFSNNTDLTDRLTLTLQGRFNMAKIVLRDQIGTALNGDHYYQRFNPGVGATYKVIPDYLVAYGGYTEANRAPTPAELSCADPLAPCSLTNFFVGDPPLKQVVARTVEAGIRGRIPQPDEYFGGILSWKAGFFSTRNDDDILFVPAPDTIGRAFFRNVGSTKRQGVEASLFYNAPRWNAFIDYAFVDATFESPVELAAPGNPFNSAGGDESGVVLVRPGNRLPGVAPHQLKVGVQYQVTPEWRVGALARFATGKFLVGDPTNQNKTTGDFAVVGLNTSYRVASNIELYGYIENAFNANYATFGTFSPVNEVPIVRVPNATSNRSLAPGAPVAAFGGLRILFEPPPAAPVVEPFPLVRKG
>NZ_CP021054.1|WP_085857100.1|3623486_3624116_+|hypothetical-protein
MIPRSVHAPLCLALILAAGPVLAQPKTDPDWPCPQRKVTTLGYGSFWTGPDLAEAGEWGSDREAAQLARKLASRRTELREVDTLLDEFAQKADPAEKGKRLTRVFAGVFEIINGERSTVMNGISRYAQGQRRLAERIRDEADKVSEFKDSPESDSTKVASKEVADLESRFNWDRRIFDERNQSVSYVCEVPTILEQRLGEIARRIQAHL
>NZ_CP021054.1|WP_012752622.1|3622582_3623476_+|multidrug-ABC-transporter-permease
MRSPSNPAVAARAEDGAKPVPHAGRLDAVGYLIALGGIVRRELLRFFHQKERFFSAMVRPLVWLFIFAAGFRNTLGTSITPPYETYVLYEAYVVPGLAVMIQLFNGMQSSLSMVYDREVGSMKVLLTSPYPRWSLLLAKLVAGVSVSIVQAYAFLAIAWFWETGIPPLGYLAALPAFLASGLMLGAIGLFLSSLVRQLENFASVMNFVIFPMFFASSALYPLWQVRASSEWLYLICQANPFTHAVELVRFALYGRFEPVACAVVVGTGLLFFTLAAIAYDPGRGIMARRGGPAGEAA
>NZ_CP021054.1|WP_015822387.1|3621836_3622586_+|ATP-binding-cassette-domain-containing-protein
MSAALDVAGVSHRFGQRAALSDVSITVERGHFMALLGPNGAGKTTLFSVITRLYNNQEGRVSILGHPLDREPSRALAGLGVVFQARTLDTDLTVAQNLHYHASLHGIGRAAARARIETLLARVGLAERRDDKIRTLSGGQSRRIEIARSLIHAPRLLLLDEPTVGLDLESRADIVAIVRALVREEGLSVLWATHIFEEISPEDDAVVLHKGRIVARGRAGEIGGPGETLEAAFRRLVAEPDKRAVKSAA
>NZ_CP021054.1|WP_085857099.1|3621561_3621840_+|hypothetical-protein
MMRTRTSLAVPRGFRGSALLALVVLATPALADDKAACAEGISVVKAQAEKLAPEAVPQKLKRALKIAEREQGEGEFDECLEALDDAKRALPK
>NZ_CP021054.1|WP_015822385.1|3621113_3621548_+|hypothetical-protein
MKWTTRLGLAAAALMLAAAPASALDLTKKRQNLPDLVLGNEEGNDFVVENKDIELEAGKAYRLRIVAKGRQEYKFYAPEFFRYIWFNQIVIEHKEIHGGGPPDHLEFDDPGEIAIEFVAIKPGAYKWYAQGLEEKGMAGTITVK
>NZ_CP021054.1|WP_056506594.1|3620035_3621022_+|hypothetical-protein
MVARLRAGLGCALLAGVSLGSAGSAQAFTAYVTNEKANTVSVIDTETLAVTGTWKVGRRPRGVTLSKDDKELFVCASDDDRIDVLDTATGKVVRSLRSGPDPEQFILDQSGNPLYVANEDDSQVTILDIEKNKVLAEVPVGVEPEGMGLSPDGKILVNTSETTNMAHFIDTKTFEVIDNVLVDARPRFAEFSADGKFLWVSAEVGGTVSVIDVATRKVIKKITFKVPSVTDEQIQPVGVRLTKDGTRAFVALGPANRVAVVDAKTYEVQKYLPVGQRVWQLAFTPDEKQLYTTNGTSNDVSVIDVEGLKVVKSIPVGLLPWGVAISKK
>NZ_CP021054.1|WP_003601812.1|3618600_3619869_+|ABC-transporter-substrate-binding-protein
MRLSVPLLLAAGLATGPAAFLAASIHARAQEPKAATGEPPPGSPANETPAPVPGSETHIAVLYRPVPAPSSYDAEADPEDLGVAGARMAVKDNNTTGRFTKQTFALDEVALDGERDPVEAAKALADKGVRFFVLALPAAEVLAVADALKETGAVILNAGAPDDRLRGADCRANLFHVLPSRAMQTDALAQYLTLMRWRKIFLITGPTERDKAYADAMRNSARKFGLKITAEKPWTFGPLAKARGDTPTRAEAMVFTRGLDYDLAVVADEEGDWGDYVPFRTVDPRPVAGTQGLIATTWHPTLETWGAAQAQNRFRRLASRLMRPLDYQVWAAVRTVGEAATQTRSTDPATLAAHLVKPEFSLPAYKGVSLTYRPWDHQLRQPIIVVQPKAMVSVAPEQGFIHQRTPLDTLGADMPETACKLP
>NZ_CP021054.1|WP_056506597.1|3617846_3618368_-|DUF2380-domain-containing-protein
MRLRALLPALTLLSTLSGTALAEDAARKAAIFPAEVNDPTLAYGRKPLPADQKRLDLVTDVLRKQLAEKGGLESVDLSPQAEEIRKESPLYKCNDCVAPIAKALGAELAVTAFADKGANQLFSLVVTIAEAETGKVVRRGQVVIRANTDDDWSHATRWIVKNRLLAEPLPGRS
>NZ_CP021054.1|WP_056506600.1|3617090_3617801_-|hypothetical-protein
MSDIVSISSPRPRLLVSVRGPDEALTALRAGADLIDAKDPERGALGALPPETVRAIVAGVGGQAVTSAVAGDGTGREIAAAIATIAATGVDFIKIAVGATDDAALAEAAAQAPGRVIGVLFAEDDVAEDGPARLAAAGFVGAMIDTRGKSGTTLTSLMAASQLAAFVAGCRTHGLMSGLAGSLGLGDIPALARLDPDYLGFRGGLCRAGDRRQALDGARVAQAVEAMRAGPRADAA
>NZ_CP021054.1|WP_003601795.1|3628104_3628464_+|hypothetical-protein
MRIALTLPVALAVLVTAGPALAVSCKDDISTVERRLNSAGAEQVTGKEPPGGVTSSNSPKALDKPPAGAPSDPSTKPTKAGVEEARTLLAKAKEQEKAGQETACQDTMTKVKEKAGALP
>NZ_CP021054.1|WP_056506583.1|3628567_3630124_-|undecaprenyl-phosphate-glucose-phosphotransferase
MNAIDVRDLLKVARENGALTSVPAPLALHSDQNSVSAPSAPIPAPTPPKGAWLSPVVLAGCVRLAEFCGLILLGLALHQALLRGVVPLAPRYHAAILAVTLAALGLFQASGSYRISAFRDLPRTAVKLATGWSIAFLMVAAAMVLAKVADHYSRIWLLSYYMAGLGILLGGRAALSAFVRMQMAKGRFDRRTAIVGGGPAAVELIHALEASSDNGIRIIGIFDDRGDDRSSTDVAGYPKLGNVSDLVTYARHAPVDLVVFTLPISAETRILQMLAKLSVLPVDIRLSAHATKLRLRPRAYSYLGGVPLLDVFDKPLADWDVILKGAFDRVVGLLLLLALSPAMIAVALAVKLTSPGPVLFRQKRYGFNNELIEIFKFRSMYVDLCDAGASQLVTKTDARVTPVGRFIRKTSLDELPQLFNVIRGDLSLVGPRPHAVQAKAANTLYDQVVDGYFARHKVKPGITGWAQINGWRGETDTSEKLQRRVEHDLHYIENWSILFDLKILLTTPLALFKTDNAY
>NZ_CP021054.1|WP_085857101.1|3630255_3631515_-|glycosyltransferase-family-1-protein
MASPFAAPLTAALTPQGPAGHAIADLSSRVGTGERHCILHVFRAPVGGLFRHVIDLTRLQAEAGHAVGLVCDASTGGERAERTLADLAPYLALGVTRVSMRRNPHASDLHVLRTVRAQALAVGADVLHGHGAKGGVFARLAPLGSAGRGVIRAYTPHGGSYNYRPGTTLHRVYMAAEQVMARATDLFLFESEYVASRHAAFAGGSPRLERIVHNGIAEAEFAPVETADDPFDLVYVGELREAKGLPVLLRALARLRGQGRELRLLMVGSGPDTESIAAMAENLGLRHAIAFEPPQAIRPVLGRGRVMVVPSLAESLPYVVLEAAAAGQPLVATNVGGIPEIFGAFSSDLVPPGDCEALSTAILHILDEEPSRRQGRARALSNSLRTRFSMNRMATDVLCGYAAAFSAKRMRTASVPATA
>NZ_CP021054.1|WP_003601790.1|3631687_3632266_-|polysaccharide-export-protein
MAMQRRAFLLALPSVLALGGCLRPDFRTVDLDATGTGSIGTRYSLAAGDKLRVIVFGQDNLSNIYAVDGGGRIAMPLIGVVQVGGQTTAQAARLIESKLAAGYVREPHVTVEVDAYRPFYILGEVTTSGQYPYVNGMTVETAVAIAAGFGPRAARDYAVLTREGQGGLINGIVPMSYPVRPGDTIVVKERFF
>NZ_CP021054.1|WP_085857102.1|3632487_3634902_+|lipopolysaccharide-biosynthesis-protein
MPRLRLSTDPSLPPSGGPGGPGDGLAVAQIGGVLRRSWAWIAVPTLVAAIGAGVFVQVVTPRYTGEAKVLLESRDPAFARTAAERTDQTQPIDEQAVASQVQVAMSRDIAREAIRSLKLVGNPEFDPEAEGSSAIRRTLMMLGLVSAPMDRPSEDRILESYLDHLLVYPVGKSRILAVEFRSRDPELAARGANTVADLYLASLEAASVDTARYASTWLGNNIANLRARVAEAEAKVEAFRAKHGLIGTGSSAAAQPLSSQQLSELSSQLSQARTIQADLTARAKLLKDMIKEGRAFEIPDVANNELIRRTVESRMAMRAQLALESRTLLPAHPRIKELTAQVQDLENQIKAAAERVVRTLENDAKIAGARVESLRAAVEGQQDVVAKGNTSEVELRALEREAKSQREQLESYLARYREAAARDGENASPANARVVSRAIVPDLPSFPKKLPIVAFATMLAFLLASAGVIGRHLLVTPAGPGGDRTGDEGEPLVQSTRTDRPRDFYPEPEPPPSRRPVYEPVYGGAYPASAAERFAPALAFAHSLRATATVHHPVFASTAPIGAEAAAQADGAKTDKEGFGVPAKSSASSADLDGLIARLENGTGQSQGRGQGRGPLAGPSKGGCVLVVETPRADGTPGLASNLARVLGPRYQTLLVDVNGVVSGPSEPGLTDLVAGAADFLDVIQPVRGSRLHAVKRGAAPLDVLVEEPQGLAIGLNALSQSYDWVLCRLDARHAEDGADLIPAVGPCMDSIVIASDAASDDPALISLYRLAKETGVARVVVARHGEDADLTPSLEGTPLRLSA
>NZ_CP021054.1|WP_012253408.1|3635455_3635779_-|YbaB/EbfC-family-nucleoid-associated-protein
MRDLMGIMKQAQAMQEKMASVQSELEAVEVSGASGGGAVTVRMTAKGQVLGVSIDPSLMVADEREILEDLIVAACNDARGKAEATAQEKMAELTKGLPLPPGMKLPF
>NZ_CP021054.1|WP_056506576.1|3635868_3637743_-|DNA-polymerase-III-subunit-gamma/tau
MDETHGTLTDEPGLPGMPTPAPVPATTPYRVLARKYRPQTFDDLIGQGAMVRTLGNAFAANRIPQAWMLTGVRGVGKTTTARILARGLNYLRTGQPDTGPTVSMPELGQHCQAIMESRHMDVLEMDAASHTGIDDVRGIIDGIRYSPVSARYKVYIVDEVHMLSEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEADVLAAHLKKICAAEGVEAEDEALAAVTRAAEGSVRDALSLLDQAIAHGAGAVSAAGVRDMLGLADRSRIVDLFEAVMRGDVPAAFAEIRAQYDAGADPAVVLSDLAGFTHLVTRLKLVPGAEADPTLSEAERVRGVAFAGRLPVRALSRAWQILLKALPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEALRQLRADIASSEGNGAARPSLGRDGGSPMASHGSAALQMAPPAPQPSPRPTLAAVPSPVTAAAPQPASRPAPVAPAGPRLGRFEDVVAQAEAARDIALKVALERDVHLVRFEEGRIEFRLAPGGRQSLPTDLARALDAWTGRRWLVALSKEQGAPTLAENTRAAEETRHQNAAAHPLVREVLSRFPGAQIVDVRDKAPETDSAAAEGAGPAAPPPEETDDDA
>NZ_CP021054.1|WP_085857103.1|3637999_3638488_+|hypothetical-protein
MRMTTIPVRLAVLALLASLSVPAGAQDRAGGPAQEGAPKDWQGRYRYEHAAGRTAGGTGIVVNYDLVLLPPDVSDGCVLTVRGFQADETLRCRTRPEGQDLAVTFDRYGDGRTVNGYGVAVYKPGQPLFTLAKGGALVTRWQGLKPDGQGVADRGAYFKKVR
>NZ_CP021054.1|WP_003607156.1|3638522_3638783_-|PepSY-domain-containing-protein
MSFRPLAAFAIGFALLSGPVLADEKLPPDQQAKVEDILKKEGFTKWKEIELDDGMIEVDDAIDANGKQFDLKLDPKTLEVVKRKAE
>NZ_CP021054.1|WP_085857104.1|3639138_3639633_+|DUF4102-domain-containing-protein
MAKISKRVVEAAEPRERDYFLWCDELPGFGVRIFSTGRRSYLVQYRNAGRSRRVTIGLHGPVTAEQARKEALNLLGQVARGEDPAEEKATRRRSLTVAQLCERYLEATKTGTVLGRGRKPKKASTLISDRGRIEHHIVPLLGNRLVQDLTRVDVQRFVRDVQAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021054_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021054_2

4055128-4055209

Orphan

Consensus_repeat	Method
GCCGCCGCGGAAGCCACCGCCGCCGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021054_2

>merge|NZ_CP021054|2|4055128-4055209|CRISPRCasFinder
GACGGTGTAGCAGCCACCACCGGCGAAATACGGGTCGTAACCGACCGTCGTGTAGCCGTAGGGGCCGCCCCAGCCGCCGTAC

>NZ_CP021054|2|2|4055128-4055209|CRISPRCasFinder
GACGGTGTAGCAGCCACCACCGGCGAA	ATACGGGTCGTAACCGACCGTCGTGTA
GCCGTAGGGGCCGCCCCAGCCGCCGTAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021054.1\|WP_003604640.1\|4059894_4060803_+\|co-chaperone-YbbN	unknown	unknown	gnl\|CDD\|225660
NZ_CP021054.1\|WP_003603578.1\|4051715_4052321_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
NZ_CP021054.1\|WP_085857206.1\|4052697_4053264_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|235782
NZ_CP021054.1\|WP_085857204.1\|4047833_4050014_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021054.1\|WP_056505071.1\|4058083_4059073_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223512
NZ_CP021054.1\|WP_012253692.1\|4051283_4051643_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_056505065.1\|4063129_4064245_-\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|237425
NZ_CP021054.1\|WP_085857207.1\|4061953_4062928_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226830
NZ_CP021054.1\|WP_056505088.1\|4050348_4051206_-\|pantoate--beta-alanine-ligase	unknown	unknown	gnl\|CDD\|376824
NZ_CP021054.1\|WP_003604638.1\|4061614_4061821_+\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NZ_CP021054.1\|WP_085857208.1\|4064366_4065071_-\|transglutaminase	unknown	unknown	gnl\|CDD\|368714
NZ_CP021054.1\|WP_056505083.1\|4053498_4054515_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176190
NZ_CP021054.1\|WP_056505091.1\|4045931_4047770_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	unknown	unknown	gnl\|CDD\|237402
NZ_CP021054.1\|WP_003604639.1\|4060888_4061557_+\|ATP-dependent-protease	unknown	unknown	gnl\|CDD\|225362
NZ_CP021054.1\|WP_056460962.1\|4059144_4059660_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_056505074.1\|4056795_4057914_-\|NADH:flavin-oxidoreductase/NADH-oxidase	unknown	unknown	gnl\|CDD\|239242
NZ_CP021054.1\|WP_056505077.1\|4055863_4056637_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226222
NZ_CP021054.1\|WP_056505079.1\|4054607_4055015_+\|DUF4174-domain-containing-protein	unknown	unknown	gnl\|CDD\|379363
NZ_CP021054.1\|WP_003603570.1\|4043362_4043866_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP021054.1\|WP_085857203.1\|4043978_4045745_+\|sulfite-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|273882

Protein	Function_ID	Function_description	E-value
NZ_CP021054.1\|WP_056505065.1\|4063129_4064245_-\|PAS-domain-S-box-protein	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	6.92754e-63
NZ_CP021054.1\|WP_003603578.1\|4051715_4052321_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	8.11995e-16
NZ_CP021054.1\|WP_085857206.1\|4052697_4053264_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|235782	PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional.	8.00369e-73
NZ_CP021054.1\|WP_085857204.1\|4047833_4050014_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	3.17795e-87
NZ_CP021054.1\|WP_056505071.1\|4058083_4059073_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223512	COG0435, ECM4, Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP021054.1\|WP_056505079.1\|4054607_4055015_+\|DUF4174-domain-containing-protein	gnl\|CDD\|379363	pfam13778, DUF4174, Domain of unknown function (DUF4174). This domain of unknown function is found in a putative tumor suppressor gene and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion.	3.6869e-39
NZ_CP021054.1\|WP_085857207.1\|4061953_4062928_-\|hypothetical-protein	gnl\|CDD\|226830	COG4395, COG4395, Uncharacterized protein conserved in bacteria [Function unknown].	1.82413e-45
NZ_CP021054.1\|WP_056505088.1\|4050348_4051206_-\|pantoate--beta-alanine-ligase	gnl\|CDD\|376824	pfam02569, Pantoate_ligase, Pantoate-beta-alanine ligase. Pantoate-beta-alanine ligase, also know as pantothenate synthase, (EC:6.3.2.1) catalyzes the formation of pantothenate from pantoate and alanine.	4.06668e-148
NZ_CP021054.1\|WP_003604638.1\|4061614_4061821_+\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	7.20159e-23
NZ_CP021054.1\|WP_085857208.1\|4064366_4065071_-\|transglutaminase	gnl\|CDD\|368714	pfam06035, Peptidase_C93, Bacterial transglutaminase-like cysteine proteinase BTLCP. Members of this family are predicted to be bacterial transglutaminase-like cysteine proteinases. They contain a conserved Cys-His-Asp catalytic triad. Their structure is predicted to be similar to that of Salmonella typhimurium N-hydroxyarylamine O-acetyltransferase, in pfam00797, however they lack the sub-domain which is important for arylamine recognition.	4.45763e-92
NZ_CP021054.1\|WP_056505083.1\|4053498_4054515_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	4.18067e-180
NZ_CP021054.1\|WP_056505091.1\|4045931_4047770_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
NZ_CP021054.1\|WP_003604639.1\|4060888_4061557_+\|ATP-dependent-protease	gnl\|CDD\|225362	COG2802, COG2802, Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only].	1.10013e-62
NZ_CP021054.1\|WP_003604640.1\|4059894_4060803_+\|co-chaperone-YbbN	gnl\|CDD\|225660	COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones].	2.69497e-94
NZ_CP021054.1\|WP_085857203.1\|4043978_4045745_+\|sulfite-reductase-subunit-alpha	gnl\|CDD\|273882	TIGR01931, Sulfite_reductase_flavoprotein_alpha-component, sulfite reductase [NADPH] flavoprotein, alpha-component. This model describes an NADPH-dependent sulfite reductase flavoprotein subunit. Most members of this family are found in Cys biosynthesis gene clusters. The closest homologs below the trusted cutoff are designated as subunits nitrate reductase.	0
NZ_CP021054.1\|WP_056505077.1\|4055863_4056637_+\|hypothetical-protein	gnl\|CDD\|226222	COG3698, COG3698, Predicted periplasmic protein [Function unknown].	1.38974e-93
NZ_CP021054.1\|WP_003603570.1\|4043362_4043866_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.14705e-52
NZ_CP021054.1\|WP_056505074.1\|4056795_4057914_-\|NADH:flavin-oxidoreductase/NADH-oxidase	gnl\|CDD\|239242	cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis. Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent. The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.	0

>NZ_CP021054.1|WP_056505079.1|4054607_4055015_+|DUF4174-domain-containing-protein
MAWKTAAMTAAMLAVAGSAGAAGGDPLSGYRWKSRVLVLAAPDGDDAQLKAQRQALASGRTGASARDLVTVEAVGKGAEAAALRRHLGLPDNAFRAVLVGKDGGAKLTSEEPIPPQRLFSTIDAMPMRQDEAKQR
>NZ_CP021054.1|WP_056505083.1|4053498_4054515_-|NADP-dependent-oxidoreductase
MAVVNRRIVLAARPHGEPKPEHFRLEEGRTPTPQHGEVLLRTRWLSLDPYMRGRMSAAKSYAKPVEIGETMVGQTVSEVVVSEHPNFAEGDLVLANAGWQEFAVSDGKNLQRIDPADGPPSQFLGILGMPGMTAYTGLLEIGRPQPKETVVVAAAAGPVGSLVGQIARIKGARAVGIAGGAEKCAYLTETLGFDAAVDHRAADFPDALARACPDGIDVYFENVGGAVFDAVLPLLNDFARVPVCGLVAGYNLSELPAGPDRSPVLMRAILTKRLTLRGFIVSDFAAMHGDFVRDVGGWLRAGRVKAREDVVEGLENAPAAFAGMLRGANFGKLVVKVA
>NZ_CP021054.1|WP_085857206.1|4052697_4053264_-|single-stranded-DNA-binding-protein
MAGSVNKVILVGNLGRDPETRRLSSGDPVVNLRIATSESWKDKASGERKEKTEWHSVVIYNDNLAKVAEQYLRKGSKVYIEGQLQTRKWTDQSGAEKYTTEVVLQRFRGEMTILDGRGGGGGGDFAGEDEGGGQISRGGDRGGDRGGDRGGRDDYGSSRSGGGGGGDRRPSSGGGAKPNYDLDDDIPF
>NZ_CP021054.1|WP_003603578.1|4051715_4052321_-|XRE-family-transcriptional-regulator
MLNTASNAPVAEERPLEKALGHQVRLLRRERDLSVADLGSAAGISPGMISKIENGAISPSLASINAIASALNVPITALFAAFEETRDCSYVKRGQGVPIERRGTKVGHLYELLGAGIRGDVVVEPYLITLQDEAEAYTSFRHVGTEFIYMLTGEVIYHHSGQDYHLAPGDALMFDSNGLHGPAKLIKTPMTYLSVIVYPRT
>NZ_CP021054.1|WP_012253692.1|4051283_4051643_-|hypothetical-protein
MTAGRQRVRGALLAFSGLLGSPVFAADLPVFEPGPPVGAPSAPRFFPRGDGDAEGDRPPRALPRRLVGCAPRIVPVPTNAPYDPSYVGSEYGLGKPSYYGFRPGPGYDDPFDRPLRYCP
>NZ_CP021054.1|WP_056505088.1|4050348_4051206_-|pantoate--beta-alanine-ligase
MSDTTLRFDTLEALRAQVDAWRKGGDRIVLVPTMGALHAGHLALVAHAKAIGRRAIVSIFVNPTQFGPNEDFSRYPRDTETDLALLAQAGADAAWLPSVETMYPTGFSTRIEPGPAAEGLCGTVRPGHFAGVATVVTKLINQVRPDIALFGEKDFQQLQVIRSVIRDLDLAVTIEGVPTLREVDGLALSSRNRYLDPRERQIAPRLHAVLADIAERLARGMEAAPLVTEGIAALEAAGFGPVQYLEIRDAHTLQPVARAEREARVLVAAYLGKTRLIDNVAVVPA
>NZ_CP021054.1|WP_085857204.1|4047833_4050014_-|TonB-dependent-siderophore-receptor
MRISCVIVQRRRTAATLLLLLSTPSLMASGRDARAQEHGADVTLDELTVTGDGSAAAGYQPRRSSFGTGTETPLLDTPANIAVVSQAVLRDQRVLSLDEALRNVSGIAQTNSIGGTQEGVVRRGFGTTRDSSILRDGRRTVLQQNFSHSIERVEVLKGPASLLYGISEPGGLINLVSKRPLFTRQNSLDVTATSFGGAIIQPDLTGPIEGTNLAYRIVGDVQDYDYWRNFGTIRRQVAAPSLTWRGDATTVTIGYEFAHYNIPFDRGTTFDPRTGRPLRVPRERRFDEAVSRVEAMSHLGSLDLEHRFDDDWKVNTGFSASNLTYDDNQIRPTSYNPATGLLTRRADATRGADFNAQVARVDLVGRFEALGLRHDLLVGAMHERVDYYRRESYRGANQGGFNVFNPVYGRLGASDRLSLPASNNRDRLINTSLYLQDSIHLTDGLILVAGASAQFYDQLAYAGVPAVASTDIDGIKPLPRAGLVYRIAPHLSVYGSYTQSFRPNVTDLDRTGPLLPEEGDAYELGIKAELGAGLHVTGAVFDTEKTNVLVTQVVNGTRTATTAGKARSRGFELDVAGQIAPDWSVIASYGFTDAMVTEDPTLAGNRLLNTPRTTASLFLTHQVGLVARATSLGSLSLGDGFLELGWGSRYVGERPGDAANSFTLPDYVVCDAFLSYRTSVNGLPAALQLNLKNVLDETYYPSSGASNVLVAVGEPFQALMTARVSW
>NZ_CP021054.1|WP_056505091.1|4045931_4047770_+|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit
MDDHKPIETPDGPAVDTPGIGARRYETPPTELPITEAEAARAAGLAHNEHLKIASGYLRGGLADGLLKHATGAISEDDGQLVKFHGMYMQDDRDIRAERTKKKLEKAYSFMIRLRIAGGVVTPKQWLILDNIATTYAGSALRATTRQTFQYHGVIKSNLKRTMAAIDSALLDTIAACGDVNRNVMAATNPAQAGAHKIALQLAKDISDTLLPKTGAWREIWLDGERVVGGEDAAEIEPVYGKTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKKNRVTGWNVTVGGGMGMTHGETDTFPRTADVLGFVQPEDALKAAEAVMTVQRDWGNRKNRKNARLKYTIERFGLDAFRAEVEKRIGKKLGAPKPFTFDGNGDRYGWVEGDDGRHHLTLYVPSGRIKDIEGGPQFLSGLRRIAEVHEGDFRLTGNQNVIIANVPAGKRAEIDALVDEYGLTRGASALRRNSMACVALPTCGLALAESERYLPDLLSELEESLARHGLQDEPITIRSTGCPNGCARPFISEIGLVGRGPERYHLYLGAAFDGSRLSKLYREDVTASEIKGTLDPLFAAYAKDRQPGEHFGDFVIRAGFVAKTSNGPDFHERTGPLRAA
>NZ_CP021054.1|WP_085857203.1|4043978_4045745_+|sulfite-reductase-subunit-alpha
MSRQALLPRTAPFGDQERAHLDAALGAATPIQRAWLTGFLAGLDAAAGQPATAAAAPPKAAEPLTILFASESGNSEKLAGDVSKLARKQGFKPKVVDFADLDLATLPKAGKLIAIAATWGEGEPPARAARAYGELMSDAAPRLDGLAFGVLALGDTSYAEFCAIGKALDARFEALGAKRAYDRADLDLDFEKPAADWIKGTLKALAPAEAPADNVVAVDFRAGAEDEDGEVSREPAVVEVIDHVNLNSSRSDKETIHLALEFEDGAPAYEPGDSLEIFPENDPQLVDEILRATGLSGDEGLRKALLAERDITTLSPTTVERFAKATGHADAQKFVESGEVKAWIEGRHLIDLIERFPTTLTAEHLNTVTRPLPPRAYSIASSRKEVGDEVHLTIAAVRYETHGRARAGVASVHVADRIKNGAKLRVRVKPNKHFRLPSDPSTDIIMVGPGTGVAPFRAFVQERRATEAPGRSWLFFGDRHFTHDFLYQLEWQDALEDGSLAKIDVAFSRDQPEKIYVQDRIDAHAAEVVEWLDGGAHFYVCGDAKNMAKDVRAAVVRAFESVKGLSSADAEAHVASLERARRYQQDVY
>NZ_CP021054.1|WP_003603570.1|4043362_4043866_+|Lrp/AsnC-family-transcriptional-regulator
MDSIDLKILALLQKDATLSIAAIGEQVGLSQTPCWKRIQRLEADGVIDRRVAVLDPVKLGLGLTVFVSIETADHSKDWLEQFADRIAAMPEVLEFYRMAGDVDYMLRVVVADMAAYDTFYKNLIATLPLKNVTSRFAMEKVKSTTALPLPAPPPRGRAEPRLAVVGE
>NZ_CP021054.1|WP_056505077.1|4055863_4056637_+|hypothetical-protein
MRRLAVPALAAALVSGFVLGPLAPVPVQAQPVPAAKGPCQAVEFEGQPYTVCTVDLRRERVRLFWLGTDGLPYGSLSSLADRQGPRLSFAMNAGMYDKGQAPVGLYVEDGRELKGASTANGPGNFHLKPNGVFYVKGDRAGVLDTGRYLRAKPAPDFATQSGPMLVIDGKIHPKISADGPSQKIRNGVGVRDGGHVAVFAISERPVTFGAFARLFKDSFGCRNALFLDGSVSSLYAPGLGRSDLSRPLGPLVGAVGR
>NZ_CP021054.1|WP_056505074.1|4056795_4057914_-|NADH:flavin-oxidoreductase/NADH-oxidase
MSARLFEPLRLDDLELENRILIAPMCQYSALAGAATDWHLMHLGQLAQSGAGLLTLEATAVSPEARISPGDLGLYDDATERALARVLDAVRGYAPIPVAIQINHAGRKASSRAPWEGGAQIAPDSVDGWQTEAPSAVSHAEGEVPPHALDADGLKRVRDGFVATAKRAMRLGIDAVELHGAHGYLLHQFLSPLSNRRDDQYGGSLENRMRFPLECFEAVREVVPAGKPVWMRVSATDWVEDGWTLDETVELACALKSRGAAAIHVSTGGLSTAQKIPVGPGYQVPFAERIKAETGLTTIAVGLITEPRQAEGILAEGKADAVSLARAMLYDPRWPWHAAAELGAQVRAPKQYWRSQPHQYKDLFKSSAFGQR
>NZ_CP021054.1|WP_056505071.1|4058083_4059073_+|glutathione-S-transferase-family-protein
MGLLVEGEWHDKGYDTAKSGGRFERSAAAFRNWVTPDGTPGPTGEGGFIGEAERYHLIVALACPWAHRTLIVRRLKGLEAITVSVVSPYMREEGWVFRAEEEGGVPGSTADPLFGAKRLYEIYVRAKPDYSGRVTVPVLWDKQRETIVSNESAEIIRMLNDAFGAGGPDLYPEALRSEIDAVNERVYDRVNNGVYKAGFATKQDAYENAFTALFSELDALEDRLGRQRYLCGSVLTEADIRLFTTLVRFDAVYVGHFKCNRRRIADYPNLSNYLRDLYALPGVAETVNLDQIKRHYYGSHPGINPTGIVPLGPELDFAAPNDRALRFGG
>NZ_CP021054.1|WP_056460962.1|4059144_4059660_+|hypothetical-protein
MTIRSRAPLLALLGLLAAGPASAQQGAEVTITGRCERLVIGGLDITQNCKEQLVNTVSRGRTTFDFAAWDGQSLSFSGAGTQHEQTEETEQLQPISLVVPGMKNKEGIVRSPAPAVGSCKFSKPEPGKTMIACEATSQGKTYAGVFITETKAGAEPGKDGVKDGPANPPKP
>NZ_CP021054.1|WP_003604640.1|4059894_4060803_+|co-chaperone-YbbN
MLEANAAAGAPVDGLIKDTTTAGFRQDVIAESMNQPVIVDFWAPWCGPCKQLTPVLEKVVRASGGRVKLAKLNIDEHPGVWQQIGQQLGLQSIPAVIAIDRGRPVDAFMGAVPESEVRAFVDRLAGPSEIDQVLEEAAAVASAGDLPAASELYAAVLREEPENLKAIAGLAKTQLELGETESAKQVLAMAPPDKADDPLFAGVRAALELAEQAGTLGDLAALQKRIEADPNDFQARFDLALGLNAAGKREEAVDQLVAIARADRSWNEDAARKQLLQFFEAWGLMDPAAIRGRRQLSTLLFS
>NZ_CP021054.1|WP_003604639.1|4060888_4061557_+|ATP-dependent-protease
MSPQPSCKSPADCPAVIPVFPLPGALLLPRGQMPLNIFEPRYLAMVDDALRSERIIGMIQPDADGAGSLLSPRLYRVGCAGRISQFAETGDGRYLISLTGVSRFRVENELSVTTAYRRCQVSYDAFAQDFEARAGEEAVDRESVLKTLRNFVDANELQVDWAGIDEASNEALVNALCMMSPFGVREKQAMLEAPDLKTRAEVLVAVTEMELVRASGSEPTLQ
>NZ_CP021054.1|WP_003604638.1|4061614_4061821_+|Trm112-family-protein
MADTPTPTVEATRVDPRLLELLVCPLTKEPLEYDAAREELISRSAKLAYPIRDGIPIMLPEEARSLTE
>NZ_CP021054.1|WP_085857207.1|4061953_4062928_-|hypothetical-protein
MASSPARRRRVVTLLALAASLALAAPAVDARPGGGGGMGSRGSKTFSAPPSTATSPGAMGPIQRSQTSPSPGFNNPGMAAQNRGSRFGGGFLGGMLGAGLLGALLGAGFSGGLGGIGSFIGLIFQIGLIAFLVMMAVRFFRRRQEGQPAMAGNAPHARSGLPPQGGMNPGVNPMGGGLGAGGLGGARPQPVQPVQVQPDDFQAFERSLQEIQSAYGREDVAALRRLATPEMVSYFEEDLRANAARGVINRISDVKLLQGDLSEAWREGPAEFATVAMRFSLRDEVFERASNRHVENGPQEAKEFWTFVREPGGPWLLSAIQQGR
>NZ_CP021054.1|WP_056505065.1|4063129_4064245_-|PAS-domain-S-box-protein
MTVSAAAASPAPDGGAETGFLALLPLPALILAGSEAGTTIAGVNPALLALTGFDEAALVGSGIEVLACHHGSHTGWTPLREALARGEAQSAELLFGRNGGASFWGEIHLTVLPGEGSPRFLGQIVDVTRRRDAEDALALSRQREALGLLTNSVAHEFNNFLQILIGYIDGLKRRLGDRPEPFIQRAIIRSTEASERAAVLTRQLLAHSRRIAPDLRPVDLAAAVRFGLDRLRPTLPPGIQLDLSIPDDLPPALCNPIQLELALGHILANACEAMSGQGRIRVALFAIEPGDRTLQRPEAGAVGLTVSDIGHGLSPEMLSRALAPFATTRESGRGAGLAIVHGLMKRQNGTISIESRPGEGATVRLVFPAAR
>NZ_CP021054.1|WP_085857208.1|4064366_4065071_-|transglutaminase
MRYAVLRSVGDGSAFPRGNVRRRLRRAAHLSLVGATLLLGGAAAPAQPSQARTVASLPEAGSAADAGAPARPVAAWNDFCARYPSECTVDPSEPALVSLTPALWHTLTTVNRRVNARIKPITDMAHWGVVDRWDFPDDGFGDCEDIQLLKRRMLVERRLPRRALRMTVVIDEIGEGHAVLMVRTDRGDLILDNKTNAVLPWQRTGYSFIKREGQDGRAWVGLDNGTSPVTTANR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021054_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021054_3

4055383-4055523

Orphan

Consensus_repeat	Method
GCCGCCGCGGAAGCCACCGCCGCCGAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021054_3

>merge|NZ_CP021054|3|4055383-4055523|CRISPRCasFinder
TCCGCCGCCGAAACGCGGGCCGCCGAAGCCGCCGCCGAAGCGCGGACCGCCAAACCCACCACCGCGGAAACCGCCGCCGGCGAAGCCGCCGCGGAAGCCACCGCCGCCGAACCCGCCACCGCGGAAGCCGCCGCCACCGAA

>NZ_CP021054|3|3|4055383-4055523|CRISPRCasFinder
TCCGCCGCCGAAACGCGGGCCGCCGAA	GCCGCCGCCGAAGCGCGGACCGCCAAACCC
ACCACCGCGGAAACCGCCGCCGGCGAA	GCCGCCGCGGAAGCCACCGCCGCCGAACCC
GCCACCGCGGAAGCCGCCGCCACCGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021054.1\|WP_003604640.1\|4059894_4060803_+\|co-chaperone-YbbN	unknown	unknown	gnl\|CDD\|225660
NZ_CP021054.1\|WP_003603578.1\|4051715_4052321_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380339
NZ_CP021054.1\|WP_085857206.1\|4052697_4053264_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|235782
NZ_CP021054.1\|WP_085857204.1\|4047833_4050014_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
NZ_CP021054.1\|WP_056505071.1\|4058083_4059073_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223512
NZ_CP021054.1\|WP_012253692.1\|4051283_4051643_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_056505065.1\|4063129_4064245_-\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|237425
NZ_CP021054.1\|WP_085857207.1\|4061953_4062928_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226830
NZ_CP021054.1\|WP_056505088.1\|4050348_4051206_-\|pantoate--beta-alanine-ligase	unknown	unknown	gnl\|CDD\|376824
NZ_CP021054.1\|WP_003604638.1\|4061614_4061821_+\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NZ_CP021054.1\|WP_085857208.1\|4064366_4065071_-\|transglutaminase	unknown	unknown	gnl\|CDD\|368714
NZ_CP021054.1\|WP_056505083.1\|4053498_4054515_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176190
NZ_CP021054.1\|WP_056505091.1\|4045931_4047770_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	unknown	unknown	gnl\|CDD\|237402
NZ_CP021054.1\|WP_003604639.1\|4060888_4061557_+\|ATP-dependent-protease	unknown	unknown	gnl\|CDD\|225362
NZ_CP021054.1\|WP_056460962.1\|4059144_4059660_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021054.1\|WP_056505074.1\|4056795_4057914_-\|NADH:flavin-oxidoreductase/NADH-oxidase	unknown	unknown	gnl\|CDD\|239242
NZ_CP021054.1\|WP_056505077.1\|4055863_4056637_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226222
NZ_CP021054.1\|WP_056505079.1\|4054607_4055015_+\|DUF4174-domain-containing-protein	unknown	unknown	gnl\|CDD\|379363
NZ_CP021054.1\|WP_003603570.1\|4043362_4043866_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP021054.1\|WP_085857203.1\|4043978_4045745_+\|sulfite-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|273882

Protein	Function_ID	Function_description	E-value
NZ_CP021054.1\|WP_056505065.1\|4063129_4064245_-\|PAS-domain-S-box-protein	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	6.92754e-63
NZ_CP021054.1\|WP_003603578.1\|4051715_4052321_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	8.11995e-16
NZ_CP021054.1\|WP_085857206.1\|4052697_4053264_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|235782	PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional.	8.00369e-73
NZ_CP021054.1\|WP_085857204.1\|4047833_4050014_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	3.17795e-87
NZ_CP021054.1\|WP_056505071.1\|4058083_4059073_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223512	COG0435, ECM4, Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP021054.1\|WP_056505079.1\|4054607_4055015_+\|DUF4174-domain-containing-protein	gnl\|CDD\|379363	pfam13778, DUF4174, Domain of unknown function (DUF4174). This domain of unknown function is found in a putative tumor suppressor gene and in a ligand for the the urokinase-type plasminogen activator receptor, which plays a role in cellular migration and adhesion.	3.6869e-39
NZ_CP021054.1\|WP_085857207.1\|4061953_4062928_-\|hypothetical-protein	gnl\|CDD\|226830	COG4395, COG4395, Uncharacterized protein conserved in bacteria [Function unknown].	1.82413e-45
NZ_CP021054.1\|WP_056505088.1\|4050348_4051206_-\|pantoate--beta-alanine-ligase	gnl\|CDD\|376824	pfam02569, Pantoate_ligase, Pantoate-beta-alanine ligase. Pantoate-beta-alanine ligase, also know as pantothenate synthase, (EC:6.3.2.1) catalyzes the formation of pantothenate from pantoate and alanine.	4.06668e-148
NZ_CP021054.1\|WP_003604638.1\|4061614_4061821_+\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	7.20159e-23
NZ_CP021054.1\|WP_085857208.1\|4064366_4065071_-\|transglutaminase	gnl\|CDD\|368714	pfam06035, Peptidase_C93, Bacterial transglutaminase-like cysteine proteinase BTLCP. Members of this family are predicted to be bacterial transglutaminase-like cysteine proteinases. They contain a conserved Cys-His-Asp catalytic triad. Their structure is predicted to be similar to that of Salmonella typhimurium N-hydroxyarylamine O-acetyltransferase, in pfam00797, however they lack the sub-domain which is important for arylamine recognition.	4.45763e-92
NZ_CP021054.1\|WP_056505083.1\|4053498_4054515_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	4.18067e-180
NZ_CP021054.1\|WP_056505091.1\|4045931_4047770_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
NZ_CP021054.1\|WP_003604639.1\|4060888_4061557_+\|ATP-dependent-protease	gnl\|CDD\|225362	COG2802, COG2802, Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only].	1.10013e-62
NZ_CP021054.1\|WP_003604640.1\|4059894_4060803_+\|co-chaperone-YbbN	gnl\|CDD\|225660	COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones].	2.69497e-94
NZ_CP021054.1\|WP_085857203.1\|4043978_4045745_+\|sulfite-reductase-subunit-alpha	gnl\|CDD\|273882	TIGR01931, Sulfite_reductase_flavoprotein_alpha-component, sulfite reductase [NADPH] flavoprotein, alpha-component. This model describes an NADPH-dependent sulfite reductase flavoprotein subunit. Most members of this family are found in Cys biosynthesis gene clusters. The closest homologs below the trusted cutoff are designated as subunits nitrate reductase.	0
NZ_CP021054.1\|WP_056505077.1\|4055863_4056637_+\|hypothetical-protein	gnl\|CDD\|226222	COG3698, COG3698, Predicted periplasmic protein [Function unknown].	1.38974e-93
NZ_CP021054.1\|WP_003603570.1\|4043362_4043866_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.14705e-52
NZ_CP021054.1\|WP_056505074.1\|4056795_4057914_-\|NADH:flavin-oxidoreductase/NADH-oxidase	gnl\|CDD\|239242	cd02932, OYE_YqiM_FMN, Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis. Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent. The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.	0

>NZ_CP021054.1|WP_056505079.1|4054607_4055015_+|DUF4174-domain-containing-protein
MAWKTAAMTAAMLAVAGSAGAAGGDPLSGYRWKSRVLVLAAPDGDDAQLKAQRQALASGRTGASARDLVTVEAVGKGAEAAALRRHLGLPDNAFRAVLVGKDGGAKLTSEEPIPPQRLFSTIDAMPMRQDEAKQR
>NZ_CP021054.1|WP_056505083.1|4053498_4054515_-|NADP-dependent-oxidoreductase
MAVVNRRIVLAARPHGEPKPEHFRLEEGRTPTPQHGEVLLRTRWLSLDPYMRGRMSAAKSYAKPVEIGETMVGQTVSEVVVSEHPNFAEGDLVLANAGWQEFAVSDGKNLQRIDPADGPPSQFLGILGMPGMTAYTGLLEIGRPQPKETVVVAAAAGPVGSLVGQIARIKGARAVGIAGGAEKCAYLTETLGFDAAVDHRAADFPDALARACPDGIDVYFENVGGAVFDAVLPLLNDFARVPVCGLVAGYNLSELPAGPDRSPVLMRAILTKRLTLRGFIVSDFAAMHGDFVRDVGGWLRAGRVKAREDVVEGLENAPAAFAGMLRGANFGKLVVKVA
>NZ_CP021054.1|WP_085857206.1|4052697_4053264_-|single-stranded-DNA-binding-protein
MAGSVNKVILVGNLGRDPETRRLSSGDPVVNLRIATSESWKDKASGERKEKTEWHSVVIYNDNLAKVAEQYLRKGSKVYIEGQLQTRKWTDQSGAEKYTTEVVLQRFRGEMTILDGRGGGGGGDFAGEDEGGGQISRGGDRGGDRGGDRGGRDDYGSSRSGGGGGGDRRPSSGGGAKPNYDLDDDIPF
>NZ_CP021054.1|WP_003603578.1|4051715_4052321_-|XRE-family-transcriptional-regulator
MLNTASNAPVAEERPLEKALGHQVRLLRRERDLSVADLGSAAGISPGMISKIENGAISPSLASINAIASALNVPITALFAAFEETRDCSYVKRGQGVPIERRGTKVGHLYELLGAGIRGDVVVEPYLITLQDEAEAYTSFRHVGTEFIYMLTGEVIYHHSGQDYHLAPGDALMFDSNGLHGPAKLIKTPMTYLSVIVYPRT
>NZ_CP021054.1|WP_012253692.1|4051283_4051643_-|hypothetical-protein
MTAGRQRVRGALLAFSGLLGSPVFAADLPVFEPGPPVGAPSAPRFFPRGDGDAEGDRPPRALPRRLVGCAPRIVPVPTNAPYDPSYVGSEYGLGKPSYYGFRPGPGYDDPFDRPLRYCP
>NZ_CP021054.1|WP_056505088.1|4050348_4051206_-|pantoate--beta-alanine-ligase
MSDTTLRFDTLEALRAQVDAWRKGGDRIVLVPTMGALHAGHLALVAHAKAIGRRAIVSIFVNPTQFGPNEDFSRYPRDTETDLALLAQAGADAAWLPSVETMYPTGFSTRIEPGPAAEGLCGTVRPGHFAGVATVVTKLINQVRPDIALFGEKDFQQLQVIRSVIRDLDLAVTIEGVPTLREVDGLALSSRNRYLDPRERQIAPRLHAVLADIAERLARGMEAAPLVTEGIAALEAAGFGPVQYLEIRDAHTLQPVARAEREARVLVAAYLGKTRLIDNVAVVPA
>NZ_CP021054.1|WP_085857204.1|4047833_4050014_-|TonB-dependent-siderophore-receptor
MRISCVIVQRRRTAATLLLLLSTPSLMASGRDARAQEHGADVTLDELTVTGDGSAAAGYQPRRSSFGTGTETPLLDTPANIAVVSQAVLRDQRVLSLDEALRNVSGIAQTNSIGGTQEGVVRRGFGTTRDSSILRDGRRTVLQQNFSHSIERVEVLKGPASLLYGISEPGGLINLVSKRPLFTRQNSLDVTATSFGGAIIQPDLTGPIEGTNLAYRIVGDVQDYDYWRNFGTIRRQVAAPSLTWRGDATTVTIGYEFAHYNIPFDRGTTFDPRTGRPLRVPRERRFDEAVSRVEAMSHLGSLDLEHRFDDDWKVNTGFSASNLTYDDNQIRPTSYNPATGLLTRRADATRGADFNAQVARVDLVGRFEALGLRHDLLVGAMHERVDYYRRESYRGANQGGFNVFNPVYGRLGASDRLSLPASNNRDRLINTSLYLQDSIHLTDGLILVAGASAQFYDQLAYAGVPAVASTDIDGIKPLPRAGLVYRIAPHLSVYGSYTQSFRPNVTDLDRTGPLLPEEGDAYELGIKAELGAGLHVTGAVFDTEKTNVLVTQVVNGTRTATTAGKARSRGFELDVAGQIAPDWSVIASYGFTDAMVTEDPTLAGNRLLNTPRTTASLFLTHQVGLVARATSLGSLSLGDGFLELGWGSRYVGERPGDAANSFTLPDYVVCDAFLSYRTSVNGLPAALQLNLKNVLDETYYPSSGASNVLVAVGEPFQALMTARVSW
>NZ_CP021054.1|WP_056505091.1|4045931_4047770_+|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit
MDDHKPIETPDGPAVDTPGIGARRYETPPTELPITEAEAARAAGLAHNEHLKIASGYLRGGLADGLLKHATGAISEDDGQLVKFHGMYMQDDRDIRAERTKKKLEKAYSFMIRLRIAGGVVTPKQWLILDNIATTYAGSALRATTRQTFQYHGVIKSNLKRTMAAIDSALLDTIAACGDVNRNVMAATNPAQAGAHKIALQLAKDISDTLLPKTGAWREIWLDGERVVGGEDAAEIEPVYGKTYLPRKFKTVVAVPPSNEVDIFAHDLGFIAILDKKNRVTGWNVTVGGGMGMTHGETDTFPRTADVLGFVQPEDALKAAEAVMTVQRDWGNRKNRKNARLKYTIERFGLDAFRAEVEKRIGKKLGAPKPFTFDGNGDRYGWVEGDDGRHHLTLYVPSGRIKDIEGGPQFLSGLRRIAEVHEGDFRLTGNQNVIIANVPAGKRAEIDALVDEYGLTRGASALRRNSMACVALPTCGLALAESERYLPDLLSELEESLARHGLQDEPITIRSTGCPNGCARPFISEIGLVGRGPERYHLYLGAAFDGSRLSKLYREDVTASEIKGTLDPLFAAYAKDRQPGEHFGDFVIRAGFVAKTSNGPDFHERTGPLRAA
>NZ_CP021054.1|WP_085857203.1|4043978_4045745_+|sulfite-reductase-subunit-alpha
MSRQALLPRTAPFGDQERAHLDAALGAATPIQRAWLTGFLAGLDAAAGQPATAAAAPPKAAEPLTILFASESGNSEKLAGDVSKLARKQGFKPKVVDFADLDLATLPKAGKLIAIAATWGEGEPPARAARAYGELMSDAAPRLDGLAFGVLALGDTSYAEFCAIGKALDARFEALGAKRAYDRADLDLDFEKPAADWIKGTLKALAPAEAPADNVVAVDFRAGAEDEDGEVSREPAVVEVIDHVNLNSSRSDKETIHLALEFEDGAPAYEPGDSLEIFPENDPQLVDEILRATGLSGDEGLRKALLAERDITTLSPTTVERFAKATGHADAQKFVESGEVKAWIEGRHLIDLIERFPTTLTAEHLNTVTRPLPPRAYSIASSRKEVGDEVHLTIAAVRYETHGRARAGVASVHVADRIKNGAKLRVRVKPNKHFRLPSDPSTDIIMVGPGTGVAPFRAFVQERRATEAPGRSWLFFGDRHFTHDFLYQLEWQDALEDGSLAKIDVAFSRDQPEKIYVQDRIDAHAAEVVEWLDGGAHFYVCGDAKNMAKDVRAAVVRAFESVKGLSSADAEAHVASLERARRYQQDVY
>NZ_CP021054.1|WP_003603570.1|4043362_4043866_+|Lrp/AsnC-family-transcriptional-regulator
MDSIDLKILALLQKDATLSIAAIGEQVGLSQTPCWKRIQRLEADGVIDRRVAVLDPVKLGLGLTVFVSIETADHSKDWLEQFADRIAAMPEVLEFYRMAGDVDYMLRVVVADMAAYDTFYKNLIATLPLKNVTSRFAMEKVKSTTALPLPAPPPRGRAEPRLAVVGE
>NZ_CP021054.1|WP_056505077.1|4055863_4056637_+|hypothetical-protein
MRRLAVPALAAALVSGFVLGPLAPVPVQAQPVPAAKGPCQAVEFEGQPYTVCTVDLRRERVRLFWLGTDGLPYGSLSSLADRQGPRLSFAMNAGMYDKGQAPVGLYVEDGRELKGASTANGPGNFHLKPNGVFYVKGDRAGVLDTGRYLRAKPAPDFATQSGPMLVIDGKIHPKISADGPSQKIRNGVGVRDGGHVAVFAISERPVTFGAFARLFKDSFGCRNALFLDGSVSSLYAPGLGRSDLSRPLGPLVGAVGR
>NZ_CP021054.1|WP_056505074.1|4056795_4057914_-|NADH:flavin-oxidoreductase/NADH-oxidase
MSARLFEPLRLDDLELENRILIAPMCQYSALAGAATDWHLMHLGQLAQSGAGLLTLEATAVSPEARISPGDLGLYDDATERALARVLDAVRGYAPIPVAIQINHAGRKASSRAPWEGGAQIAPDSVDGWQTEAPSAVSHAEGEVPPHALDADGLKRVRDGFVATAKRAMRLGIDAVELHGAHGYLLHQFLSPLSNRRDDQYGGSLENRMRFPLECFEAVREVVPAGKPVWMRVSATDWVEDGWTLDETVELACALKSRGAAAIHVSTGGLSTAQKIPVGPGYQVPFAERIKAETGLTTIAVGLITEPRQAEGILAEGKADAVSLARAMLYDPRWPWHAAAELGAQVRAPKQYWRSQPHQYKDLFKSSAFGQR
>NZ_CP021054.1|WP_056505071.1|4058083_4059073_+|glutathione-S-transferase-family-protein
MGLLVEGEWHDKGYDTAKSGGRFERSAAAFRNWVTPDGTPGPTGEGGFIGEAERYHLIVALACPWAHRTLIVRRLKGLEAITVSVVSPYMREEGWVFRAEEEGGVPGSTADPLFGAKRLYEIYVRAKPDYSGRVTVPVLWDKQRETIVSNESAEIIRMLNDAFGAGGPDLYPEALRSEIDAVNERVYDRVNNGVYKAGFATKQDAYENAFTALFSELDALEDRLGRQRYLCGSVLTEADIRLFTTLVRFDAVYVGHFKCNRRRIADYPNLSNYLRDLYALPGVAETVNLDQIKRHYYGSHPGINPTGIVPLGPELDFAAPNDRALRFGG
>NZ_CP021054.1|WP_056460962.1|4059144_4059660_+|hypothetical-protein
MTIRSRAPLLALLGLLAAGPASAQQGAEVTITGRCERLVIGGLDITQNCKEQLVNTVSRGRTTFDFAAWDGQSLSFSGAGTQHEQTEETEQLQPISLVVPGMKNKEGIVRSPAPAVGSCKFSKPEPGKTMIACEATSQGKTYAGVFITETKAGAEPGKDGVKDGPANPPKP
>NZ_CP021054.1|WP_003604640.1|4059894_4060803_+|co-chaperone-YbbN
MLEANAAAGAPVDGLIKDTTTAGFRQDVIAESMNQPVIVDFWAPWCGPCKQLTPVLEKVVRASGGRVKLAKLNIDEHPGVWQQIGQQLGLQSIPAVIAIDRGRPVDAFMGAVPESEVRAFVDRLAGPSEIDQVLEEAAAVASAGDLPAASELYAAVLREEPENLKAIAGLAKTQLELGETESAKQVLAMAPPDKADDPLFAGVRAALELAEQAGTLGDLAALQKRIEADPNDFQARFDLALGLNAAGKREEAVDQLVAIARADRSWNEDAARKQLLQFFEAWGLMDPAAIRGRRQLSTLLFS
>NZ_CP021054.1|WP_003604639.1|4060888_4061557_+|ATP-dependent-protease
MSPQPSCKSPADCPAVIPVFPLPGALLLPRGQMPLNIFEPRYLAMVDDALRSERIIGMIQPDADGAGSLLSPRLYRVGCAGRISQFAETGDGRYLISLTGVSRFRVENELSVTTAYRRCQVSYDAFAQDFEARAGEEAVDRESVLKTLRNFVDANELQVDWAGIDEASNEALVNALCMMSPFGVREKQAMLEAPDLKTRAEVLVAVTEMELVRASGSEPTLQ
>NZ_CP021054.1|WP_003604638.1|4061614_4061821_+|Trm112-family-protein
MADTPTPTVEATRVDPRLLELLVCPLTKEPLEYDAAREELISRSAKLAYPIRDGIPIMLPEEARSLTE
>NZ_CP021054.1|WP_085857207.1|4061953_4062928_-|hypothetical-protein
MASSPARRRRVVTLLALAASLALAAPAVDARPGGGGGMGSRGSKTFSAPPSTATSPGAMGPIQRSQTSPSPGFNNPGMAAQNRGSRFGGGFLGGMLGAGLLGALLGAGFSGGLGGIGSFIGLIFQIGLIAFLVMMAVRFFRRRQEGQPAMAGNAPHARSGLPPQGGMNPGVNPMGGGLGAGGLGGARPQPVQPVQVQPDDFQAFERSLQEIQSAYGREDVAALRRLATPEMVSYFEEDLRANAARGVINRISDVKLLQGDLSEAWREGPAEFATVAMRFSLRDEVFERASNRHVENGPQEAKEFWTFVREPGGPWLLSAIQQGR
>NZ_CP021054.1|WP_056505065.1|4063129_4064245_-|PAS-domain-S-box-protein
MTVSAAAASPAPDGGAETGFLALLPLPALILAGSEAGTTIAGVNPALLALTGFDEAALVGSGIEVLACHHGSHTGWTPLREALARGEAQSAELLFGRNGGASFWGEIHLTVLPGEGSPRFLGQIVDVTRRRDAEDALALSRQREALGLLTNSVAHEFNNFLQILIGYIDGLKRRLGDRPEPFIQRAIIRSTEASERAAVLTRQLLAHSRRIAPDLRPVDLAAAVRFGLDRLRPTLPPGIQLDLSIPDDLPPALCNPIQLELALGHILANACEAMSGQGRIRVALFAIEPGDRTLQRPEAGAVGLTVSDIGHGLSPEMLSRALAPFATTRESGRGAGLAIVHGLMKRQNGTISIESRPGEGATVRLVFPAAR
>NZ_CP021054.1|WP_085857208.1|4064366_4065071_-|transglutaminase
MRYAVLRSVGDGSAFPRGNVRRRLRRAAHLSLVGATLLLGGAAAPAQPSQARTVASLPEAGSAADAGAPARPVAAWNDFCARYPSECTVDPSEPALVSLTPALWHTLTTVNRRVNARIKPITDMAHWGVVDRWDFPDDGFGDCEDIQLLKRRMLVERRLPRRALRMTVVIDEIGEGHAVLMVRTDRGDLILDNKTNAVLPWQRTGYSFIKREGQDGRAWVGLDNGTSPVTTANR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP021054.1	4055527-4055556	2	0.933

1. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to position: 4055527-4055556, mismatch: 2, identity: 0.933

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggaagccaccgccaccgaagcc	Protospacer
*********************.***** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MK977705	Gordonia Phage Mollymur, complete genome	57292-57321	4	0.867
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1069090-1069119	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	35460-35489	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP010856	Marinovum algicola DG 898 plasmid pMaD1, complete sequence	208365-208394	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MH588544	Caulobacter phage CcrBL10, complete genome	64557-64586	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MN855811	Bacteriophage sp. isolate 126, partial genome	13522-13551	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1026811-1026840	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4416811-4416840	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	628541-628570	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	285797-285826	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	JN116822	Rhodococcus phage RRH1, complete genome	5309-5338	5	0.833
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP047317	Burkholderia glumae AU6208 plasmid pwszb, complete sequence	43845-43874	5	0.833
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1824344-1824373	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1824993-1825022	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1824369-1824398	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1824369-1824398	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1824369-1824398	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1824369-1824398	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	551345-551374	6	0.8
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	781821-781850	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	1032424-1032453	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_HG917973	Mycobacterium marinum E11 plasmid pRAW, complete sequence	77768-77797	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_AP018497	Mycobacterium marinum strain ATCC 927 plasmid pMMRN, complete sequence	25993-26022	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_018696	Paraburkholderia phenoliruptrix BR3459a plasmid pSYMBR3459, complete sequence	72309-72338	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	3889-3918	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_AP012556	Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence	174108-174137	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MH316566	Gordonia phage Nedarya, complete genome	31603-31632	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	615071-615100	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP046258	Gordonia sp. 135 plasmid pG135, complete sequence	123655-123684	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	89939-89968	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1300006-1300035	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	31740-31769	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_011143	Phenylobacterium zucineum HLK1 plasmid, complete sequence	155769-155798	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	39657-39686	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	664893-664922	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1068026-1068055	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1467493-1467522	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MF377442	Arthrobacter phage Franzy, complete genome	30933-30962	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_041930	Arthrobacter phage Brent, complete genome	30934-30963	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_LN997849	Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence	129963-129992	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2002359-2002388	6	0.8
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP034185	Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence	214513-214542	6	0.8
NZ_CP021054_2	2.1\|4055155\|27\|NZ_CP021054\|CRISPRCasFinder	4055155-4055181	27	MF324902	Rhodococcus phage Krishelle, complete genome	16162-16188	7	0.741
NZ_CP021054_2	2.1\|4055155\|27\|NZ_CP021054\|CRISPRCasFinder	4055155-4055181	27	MF324898	Rhodococcus phage Hiro, complete genome	16147-16173	7	0.741
NZ_CP021054_2	2.1\|4055155\|27\|NZ_CP021054\|CRISPRCasFinder	4055155-4055181	27	MF324903	Rhodococcus phage AppleCloud, complete genome	15856-15882	7	0.741
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	797389-797418	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	CP003954	Rhodococcus opacus PD630 plasmid 5, complete sequence	5042-5071	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_AP018921	Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence	18807-18836	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NC_011892	Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence	328417-328446	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	772081-772110	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP035710	Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence	217354-217383	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	136072-136101	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1213294-1213323	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP013255	Kocuria flava strain HO-9041 plasmid 1, complete sequence	50094-50123	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	KY249644	Synechococcus virus S-ESS1, complete genome	59381-59410	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	KY249644	Synechococcus virus S-ESS1, complete genome	59408-59437	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP010024	Paraburkholderia fungorum strain ATCC BAA-463 plasmid pBIL, complete sequence	296970-296999	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	574288-574317	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_018583	Gordonia sp. KTR9 plasmid pGKT3, complete sequence	40020-40049	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	858068-858097	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	KU160664	Arthrobacter phage Salgado, complete genome	10006-10035	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MK494113	Mycobacterium phage Refuge, complete genome	27924-27953	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MF140418	Arthrobacter phage LiSara, complete genome	10032-10061	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	KU160654	Arthrobacter phage Laroye, complete genome	9998-10027	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP046906	Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence	40667-40696	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	600373-600402	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	20509-20538	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_LR594673	Variovorax sp. PBL-E5 plasmid 3	137669-137698	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	JN699011	Mycobacterium phage Stinger, complete genome	10138-10167	7	0.767
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MK279899	Arthrobacter phage Maja, complete genome	19493-19522	7	0.767
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	412294-412323	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1091449-1091478	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	126482-126511	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	893000-893029	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NC_047877	Bordetella phage CN2, complete genome	31984-32013	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	MN010758	Gordonia phage Dardanus, complete genome	289-318	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_AP017657	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_3, complete sequence	46488-46517	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	505141-505170	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NC_048733	Microbacterium phage Burro, complete genome	9311-9340	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MH252365	Ralstonia phage phiRSP, complete genome	4963-4992	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	210021-210050	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	410659-410688	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	516268-516297	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	412375-412404	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	893731-893760	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	478197-478226	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	887495-887524	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	38208-38237	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	341186-341215	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1489880-1489909	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	66594-66623	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	707424-707453	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	410660-410689	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MH576962	Streptomyces phage Satis, complete genome	35759-35788	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	MK620894	Streptomyces phage Kradal, complete genome	35763-35792	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	151550-151579	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_LR134470	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 28, complete sequence	1493-1522	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	76292-76321	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP040821	Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence	59657-59686	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1065070-1065099	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	HM486077	Tsukamurella phage TPA2, complete sequence	6881-6910	8	0.733
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NC_015210	Tsukamurella phage TPA2, complete genome	6881-6910	8	0.733
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NC_004984	Microcystis aeruginosa strain UV025 plasmid pMa025, complete sequence	2542-2571	9	0.7
NZ_CP021054_3	3.1\|4055410\|30\|NZ_CP021054\|CRISPRCasFinder	4055410-4055439	30	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	434846-434875	9	0.7
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP049159	Caballeronia sp. SBC1 plasmid pSBC1_3, complete sequence	449534-449563	9	0.7
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP049320	Caballeronia sp. SBC2 plasmid pSBC2-4, complete sequence	1686-1715	9	0.7
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP013454	Burkholderia vietnamiensis strain MSMB608WGS plasmid pMSMB608, complete sequence	116282-116311	9	0.7
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	114538-114567	9	0.7
NZ_CP021054_3	3.2\|4055467\|30\|NZ_CP021054\|CRISPRCasFinder	4055467-4055496	30	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	797777-797806	9	0.7

1. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MK977705 (Gordonia Phage Mollymur, complete genome) position: , mismatch: 4, identity: 0.867

gccgccgcggaagccaccgccgccgaaccc---	CRISPR spacer
gccgccgccgaagccaccgccgccg---ccgaa	Protospacer
******** ****************   **

2. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgacgaagccaccgccgccgtcgcc	Protospacer
*******  ****************   **

3. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggaagtcgccgccgccggcccg	Protospacer
*************.*.*********. **

4. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP010856 (Marinovum algicola DG 898 plasmid pMaD1, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
tccgccgcggaagccgccgccgctgatacc	Protospacer
 **************.*******.**  **

5. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccaaagccaccgccgccgccgcc	Protospacer
******** .***************   **

6. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MN855811 (Bacteriophage sp. isolate 126, partial genome) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgctgaagccgccgccgccgcagca	Protospacer
******** ******.********* * *

7. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagacaccgccgcccggccc	Protospacer
******** **** ********** ..***

8. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccg-cggaagccaccgccgccgaaccc	CRISPR spacer
-ccgcaaccggaacccgccgccgccgaaccc	Protospacer
 **** . ***** **.**************

9. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagacaccgccgcccggccc	Protospacer
******** **** ********** ..***

10. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagacaccgccgcccggccc	Protospacer
******** **** ********** ..***

11. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to JN116822 (Rhodococcus phage RRH1, complete genome) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccaccgccg-ccgaaccc	CRISPR spacer
gccgccgcggaagccgccgccgatcggatc-	Protospacer
***************.****** .**.*.*

12. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP047317 (Burkholderia glumae AU6208 plasmid pwszb, complete sequence) position: , mismatch: 5, identity: 0.833

gccgccgcggaagccacc---gccgccgaaccc	CRISPR spacer
ggcgccgcggcagccaccgcggccgccgaa---	Protospacer
* ******** *******   *********

13. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

14. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

15. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

16. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

17. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

18. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

19. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccaaagcgctgaccgccgtggcc	Protospacer
*********.****** *******. . **

20. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
ggcgccgccgaggcgcgggccgccattgcc	Protospacer
* *********.******.******   **

21. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cgcgccgcggacgccaccgccgcggacgcc	Protospacer
  ********* *********** **  **

22. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_HG917973 (Mycobacterium marinum E11 plasmid pRAW, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgacgcggcagccaccgccgccggtaca	Protospacer
**** ***** **************.  *

23. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP018497 (Mycobacterium marinum strain ATCC 927 plasmid pMMRN, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgacgcggcagccaccgccgccggtaca	Protospacer
**** ***** **************.  *

24. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_018696 (Paraburkholderia phenoliruptrix BR3459a plasmid pSYMBR3459, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccaccgcggaatccaccgccgccgcgcat	Protospacer
***.******** ************ .* .

25. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gcgaccgccgaagcccccgccgccgaagcg	Protospacer
** .**** ****** *********** *

26. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP012556 (Mycobacterium avium subsp. hominissuis TH135 plasmid pMAH135, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggcggccaccgccgccggtacg	Protospacer
********** .*************.  *

27. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MH316566 (Gordonia phage Nedarya, complete genome) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggctgccaccgccgccgccagc	Protospacer
**********  *************    *

28. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgcgccggaagccaccgccgccggaggc	Protospacer
.****  ******************.*  *

29. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP046258 (Gordonia sp. 135 plasmid pG135, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggaagccgccgccgaagccgcc	Protospacer
***************.******  *   **

30. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagccgccgccgcccggcgc	Protospacer
******** ******.******** ..* *

31. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gacgccgcgcaagccatcgccgccgacggc	Protospacer
* ******* ******.*********   *

32. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgcgccggaagccaccgccgccggaggc	Protospacer
.****  ******************.*  *

33. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_011143 (Phenylobacterium zucineum HLK1 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgccgcggaatcccccgccgccgtgtcc	Protospacer
.*********** ** ********* ..**

34. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc---	CRISPR spacer
accgccaccgaagccaccgccgccg---ccgaa	Protospacer
.*****.* ****************   **

35. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gacgccgcgcaagccatcgccgccgacggc	Protospacer
* ******* ******.*********   *

36. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gacgccgcgcaagccatcgccgccgatggc	Protospacer
* ******* ******.*********   *

37. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gacgccgcgcaagccatcgccgccgacggc	Protospacer
* ******* ******.*********   *

38. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MF377442 (Arthrobacter phage Franzy, complete genome) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgccgccgaagccgccgccgccgttgcc	Protospacer
.******* ******.*********   **

39. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_041930 (Arthrobacter phage Brent, complete genome) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgccgccgaagccgccgccgccgttgcc	Protospacer
.******* ******.*********   **

40. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_LN997849 (Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgc--cgaaccc	CRISPR spacer
ctcgcctcggaagccaccgccgcagcgaag--	Protospacer
 .**** ****************  ****

41. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcgcaagccgccgccgcacaggcc	Protospacer
********* *****.*******  *. **

42. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP034185 (Deinococcus sp. S14-83 strain S14-83T plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgccggagaagccaccgccgcccacgcc	Protospacer
.****** .*************** *  **

43. spacer 2.1|4055155|27|NZ_CP021054|CRISPRCasFinder matches to MF324902 (Rhodococcus phage Krishelle, complete genome) position: , mismatch: 7, identity: 0.741

atacgggtcgtaaccgaccgtcgtgta	CRISPR spacer
gaacgggtcgtaaccgaccgtggacat	Protospacer
. ******************* *

44. spacer 2.1|4055155|27|NZ_CP021054|CRISPRCasFinder matches to MF324898 (Rhodococcus phage Hiro, complete genome) position: , mismatch: 7, identity: 0.741

atacgggtcgtaaccgaccgtcgtgta	CRISPR spacer
gaacgggtcgtaaccgaccgtggacat	Protospacer
. ******************* *

45. spacer 2.1|4055155|27|NZ_CP021054|CRISPRCasFinder matches to MF324903 (Rhodococcus phage AppleCloud, complete genome) position: , mismatch: 7, identity: 0.741

atacgggtcgtaaccgaccgtcgtgta	CRISPR spacer
gaacgggtcgtaaccgaccgtggacat	Protospacer
. ******************* *

46. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
ggcgccgccgaagcgcggaccgcgggccgg	Protospacer
* ********************* .. *

47. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to CP003954 (Rhodococcus opacus PD630 plasmid 5, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
cccgccgccgaagcgcggatcgccgccgca	Protospacer
 ******************.****.   *

48. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP018921 (Pseudonocardia autotrophica strain NBRC 12743 plasmid pPA12743CP, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
tccgccgcagaagcgccgaccgccacaggt	Protospacer
 ******* ******* ******** *  .

49. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NC_011892 (Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccggagcgcgggccgcccgcgac	Protospacer
**********.*******.***** .   *

50. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
accgccgccgacgcgctgaccgccgccgcc	Protospacer
.********** **** *******.   **

51. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP035710 (Sphaerotilus natans subsp. sulfidivorans strain D-507 plasmid pSna507_unt10, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
accgccgccgaggcccggaccgccggcgcc	Protospacer
.**********.** *********..  **

52. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc---	CRISPR spacer
gccgccgccgacgcgcagaccgc---gctctga	Protospacer
*********** ****.******   .*.*

53. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccgaagcgcgggcccggatgctc	Protospacer
******************.**   * .*.*

54. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP013255 (Kocuria flava strain HO-9041 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cgcgccgcccaagccaccgccgccgaagag	Protospacer
  ******  *****************

55. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to KY249644 (Synechococcus virus S-ESS1, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
ctggccgccgaagccgccgccgccgaactg	Protospacer
 . ***** ******.************.

56. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to KY249644 (Synechococcus virus S-ESS1, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
ctggccgccgaagccgccgccgccgaactg	Protospacer
 . ***** ******.************.

57. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP010024 (Paraburkholderia fungorum strain ATCC BAA-463 plasmid pBIL, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgcccccgaagccaccgccgccgcccat	Protospacer
.***** * ****************  * .

58. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggaagacaccgccgaagccgtc	Protospacer
************* ********  *   .*

59. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_018583 (Gordonia sp. KTR9 plasmid pGKT3, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgccgaagccaccgccaccgcggtc	Protospacer
 ******* ************.*** . .*

60. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgccgccgaagccatcgccgccgcggcg	Protospacer
.******* *******.******** . *

61. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to KU160664 (Arthrobacter phage Salgado, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagccgccgccgccctgctg	Protospacer
******** ******.********  .*.

62. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MK494113 (Mycobacterium phage Refuge, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gatgccgccgaagccaccgccgccgccagc	Protospacer
* .***** ****************    *

63. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MF140418 (Arthrobacter phage LiSara, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagccgccgccgccctgctg	Protospacer
******** ******.********  .*.

64. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to KU160654 (Arthrobacter phage Laroye, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgccgaagccgccgccgccctgctg	Protospacer
******** ******.********  .*.

65. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP046906 (Streptomyces sp. QHH-9511 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cgcgccgccgacgccaccgccgccgtccac	Protospacer
  ****** ** *************  * *

66. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
ttcgccgcggatgccaccgccaccgtgctc	Protospacer
 .********* *********.*** .*.*

67. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gtcgccgcggaggccgccgccgccggcgtc	Protospacer
*.*********.***.*********.  .*

68. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_LR594673 (Variovorax sp. PBL-E5 plasmid 3) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gagcgcgcgaaagccatcgccgccgaactc	Protospacer
*    ****.******.***********.*

69. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to JN699011 (Mycobacterium phage Stinger, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
accgccgcgcaggccaccgccgccctggcc	Protospacer
.******** *.************  . **

70. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MK279899 (Arthrobacter phage Maja, complete genome) position: , mismatch: 7, identity: 0.767

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
agcgccgcggaagccgccgccgcggcttcc	Protospacer
. *************.******* *  .**

71. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccgaggcgccgaccgcgaggata	Protospacer
***********.**** ****** *.. .

72. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccgaagcccggacctacctcgtc	Protospacer
************** ******  *    .*

73. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
cccgccgccgaggcgcgggccgcccggctg	Protospacer
 **********.******.***** ..*.

74. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccgaagcgctgatcgcggcgcag	Protospacer
**************** **.*** . .*

75. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NC_047877 (Bordetella phage CN2, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
tccgccgccgaagcccgaaccgcccagggg	Protospacer
 ************* **.****** *.

76. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to MN010758 (Gordonia phage Dardanus, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
aacgccgccgaagcgcggtccgcgaccttc	Protospacer
. **************** **** *  ..*

77. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_AP017657 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_3, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccgaagcgcggcgcgcaagcgta	Protospacer
******************  *** *.  .

78. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
tccgccgccgaggcgcgggccgcccggctg	Protospacer
 **********.******.***** ..*.

79. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NC_048733 (Microbacterium phage Burro, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgccgaagcgcgcaccctcgaggtt	Protospacer
***************** *** .*.*. ..

80. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MH252365 (Ralstonia phage phiRSP, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
tttcatgcggaagccatcgccgccgaaccg	Protospacer
 ..  .**********.************

81. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgcggacgccgccgccgccgcggaa	Protospacer
 ********** ***.********* .

82. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

83. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgcggacgccgccgccgccgcggaa	Protospacer
 ********** ***.********* .

84. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

85. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgcggacgccgccgccgccgcggag	Protospacer
 ********** ***.********* .

86. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

87. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

88. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

89. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgcggacgccgccgccgccgcggag	Protospacer
 ********** ***.********* .

90. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

91. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgcggcatccaccgccgccgccaat	Protospacer
 ********* * ************    .

92. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cccgccgcggacgccgccgccgccgcggag	Protospacer
 ********** ***.********* .

93. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cttgccgccgaagccaccgccgacgaaagg	Protospacer
 ..***** ************* ****

94. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MH576962 (Streptomyces phage Satis, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccacggaagccgccgccgcctgctgg	Protospacer
******.********.******** . .

95. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to MK620894 (Streptomyces phage Kradal, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccacggaagccgccgccgcctgctgg	Protospacer
******.********.******** . .

96. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
tccgccgccgaagtcaccgccgcctccgct	Protospacer
 ******* ****.**********    *.

97. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_LR134470 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 28, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgccgcggcagcgaccgccgcgatgacg	Protospacer
********** *** ******** . . *

98. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cacgccgcggaagccgccggcgccggtgca	Protospacer
  *************.*** *****.  *

99. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP040821 (Paraoceanicella profunda strain D4M1 plasmid pD4M1C, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
cgcgccgtggaagccgccgccgccgccttc	Protospacer
  *****.*******.*********  ..*

100. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gaagacgccgaagccaccgccgccgatgag	Protospacer
*  * *** *****************

101. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to HM486077 (Tsukamurella phage TPA2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
atcgccgcggtagccacggccgccgccatc	Protospacer
..******** ****** *******   .*

102. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NC_015210 (Tsukamurella phage TPA2, complete genome) position: , mismatch: 8, identity: 0.733

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
atcgccgcggtagccacggccgccgccatc	Protospacer
..******** ****** *******   .*

103. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NC_004984 (Microcystis aeruginosa strain UV025 plasmid pMa025, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
gccgccgtcgaagcccggaccgctgcggtg	Protospacer
*******.****** ********.. . .

104. spacer 3.1|4055410|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgccgaagcgcggaccgccaaaccc	CRISPR spacer
tccgccgccgaggcgcgggccgcccggttg	Protospacer
 **********.******.***** ....

105. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP049159 (Caballeronia sp. SBC1 plasmid pSBC1_3, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgacgccgaagccaccgccgcatggttt	Protospacer
**** *** **************  .....

106. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP049320 (Caballeronia sp. SBC2 plasmid pSBC2-4, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
gccgacgccgaagccaccgccgcatggttt	Protospacer
**** *** **************  .....

107. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP013454 (Burkholderia vietnamiensis strain MSMB608WGS plasmid pMSMB608, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
ctcgccgcggacgcctccgccgccgcttgg	Protospacer
 .********* *** *********  .

108. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
ggtcccgcggacgccaccgccgccgctgga	Protospacer
* . ******* *************

109. spacer 3.2|4055467|30|NZ_CP021054|CRISPRCasFinder matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gccgccgcggaagccaccgccgccgaaccc	CRISPR spacer
agtgccgcggaagacaccgccgccacggca	Protospacer
. .********** **********. . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1418258 : 1427526

Rhizobium_phage(28.57%)

portal,protease,terminase,capsid,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085856413.1\|1418258_1420337_+\|terminase	terminase	A0A2H4JIC6	uncultured_Caudovirales_phage	1.2e-117	41.0
WP_085856414.1\|1420340_1420598_+	hypothetical protein	NA	NA	NA	NA
WP_085856415.1\|1420591_1422202_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	3.8e-108	43.8
WP_085856416.1\|1422213_1423368_+\|protease	Clp protease ClpP	A0A0A8IKZ4	Aurantimonas_phage	3.3e-53	48.9
WP_085856417.1\|1423378_1423759_+\|head	head decoration protein	R9TP46	Rhizobium_phage	8.2e-30	59.1
WP_085856418.1\|1423762_1424794_+\|capsid	major capsid protein	R9TRN2	Rhizobium_phage	8.3e-125	63.5
WP_085857567.1\|1424859_1425102_+	hypothetical protein	NA	NA	NA	NA
WP_085856419.1\|1425098_1425464_+	hypothetical protein	NA	NA	NA	NA
WP_085856420.1\|1425460_1426126_+	hypothetical protein	NA	NA	NA	NA
WP_085856421.1\|1426125_1426560_+	hypothetical protein	G8DH50	Emiliania_huxleyi_virus	2.2e-18	38.5
WP_085856422.1\|1426584_1427526_+	hypothetical protein	G8DH51	Emiliania_huxleyi_virus	5.1e-81	52.2

DBSCAN-SWA_2

3114437 : 3155478

Paracoccus_phage(30.0%)

head,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085857014.1\|3114437_3115913_-\|protease	serine protease	NA	NA	NA	NA
WP_056507414.1\|3116091_3116538_+	DMT family transporter	NA	NA	NA	NA
WP_085857015.1\|3116650_3121969_+	alpha-2-macroglobulin family protein	NA	NA	NA	NA
WP_056507408.1\|3121973_3124175_+	penicillin-binding protein 1C	NA	NA	NA	NA
WP_003607143.1\|3124310_3124631_+	quaternary ammonium compound-resistance protein SugE	NA	NA	NA	NA
WP_056507404.1\|3124635_3125436_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_056507401.1\|3125487_3126123_-	class GN sortase	NA	NA	NA	NA
WP_056507398.1\|3126119_3128336_-	marine proteobacterial sortase target protein	A0A2K9L1J5	Tupanvirus	4.1e-12	22.2
WP_085857016.1\|3128580_3129192_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_056507502.1\|3129279_3130020_-	hypothetical protein	NA	NA	NA	NA
WP_012253028.1\|3130082_3131096_-	nickel transporter	NA	NA	NA	NA
WP_056507392.1\|3131086_3131764_-	DUF1007 family protein	NA	NA	NA	NA
WP_015822039.1\|3131878_3132340_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
WP_015822040.1\|3132336_3134337_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
WP_056507391.1\|3134383_3134917_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
WP_085857017.1\|3135079_3136663_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
WP_056507383.1\|3136809_3138225_-	ATP-binding protein	NA	NA	NA	NA
WP_003606557.1\|3138611_3139289_-	DNA-binding response regulator	NA	NA	NA	NA
WP_003606558.1\|3139327_3139867_-	hypothetical protein	NA	NA	NA	NA
WP_056507374.1\|3139880_3140129_-	hypothetical protein	NA	NA	NA	NA
WP_012253038.1\|3140150_3140504_-	hypothetical protein	NA	NA	NA	NA
WP_056507371.1\|3141190_3141754_-	lysozyme	W6E9Q2	Rhizobium_phage	4.1e-25	40.8
WP_056507368.1\|3141874_3142957_-	DUF2793 domain-containing protein	A0A0K1LM04	Rhodobacter_phage	4.4e-36	40.0
WP_085857018.1\|3142981_3146890_-	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	1.1e-196	36.4
WP_056507362.1\|3146913_3147378_-	peptidase P60	A0A1V0DYB6	Dinoroseobacter_phage	8.5e-29	46.1
WP_085857019.1\|3147385_3148279_-	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	1.1e-61	43.1
WP_085857020.1\|3148289_3148931_-	TIGR02217 family protein	A0A0K1LLZ8	Rhodobacter_phage	5.5e-42	49.5
WP_056507352.1\|3148942_3149569_-\|tail	phage tail tape measure protein	G9JXH3	Shigella_phage	1.5e-07	67.4
WP_056507350.1\|3149568_3149799_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_056507499.1\|3149795_3150122_-	gene transfer agent family protein	NA	NA	NA	NA
WP_085857021.1\|3150124_3150535_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_015822059.1\|3150564_3150984_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_056507345.1\|3150980_3151322_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_056507342.1\|3151343_3151919_-	hypothetical protein	NA	NA	NA	NA
WP_056507339.1\|3151952_3152708_+	peptidase S1	NA	NA	NA	NA
WP_003606880.1\|3152855_3153704_+	peptidase S1	I6WTR7	Cotesia_sesamiae_Mombasa_bracovirus	2.9e-06	23.4
WP_085857022.1\|3155007_3155478_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	3.6e-27	50.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021054

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection