CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP028135	Vibrio alginolyticus strain K01M1 plasmid pL9064	0 crisprs	NA	0	0	0
NZ_CP017890	Vibrio alginolyticus strain K01M1 chromosome 2, complete sequence	1 crisprs	cas3,csa3,PD-DExK,DEDDh,WYL	0	0	2
NZ_CP017889	Vibrio alginolyticus strain K01M1 chromosome 1, complete sequence	1 crisprs	cas3,DinG,csa3,RT,csx1,DEDDh	2	1	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017890_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017890_1

828947-829043

Orphan

Consensus_repeat	Method
TTAATTACGACTGCCTATAAGAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP017890_1

>merge|NZ_CP017890|1|828947-829043|CRISPRCasFinder
TTAATTACGACTGCCTATAAGAGACAAAGACTACTTTAAGTCCGGCTTTAAGCCTGCTCTCAGCTCAATTCTATTAATTACGACTGCCTATAAGAGA

>NZ_CP017890|1|1|828947-829043|CRISPRCasFinder
TTAATTACGACTGCCTATAAGAGA	CAAAGACTACTTTAAGTCCGGCTTTAAGCCTGCTCTCAGCTCAATTCTA
TTAATTACGACTGCCTATAAGAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017890.1\|WP_017820201.1\|815635_817090_+\|ATPase-RavA-stimulator-ViaA	unknown	unknown	gnl\|CDD\|236815
NZ_CP017890.1\|WP_086047359.1\|834977_835682_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153443
NZ_CP017890.1\|WP_086047354.1\|822201_823431_-\|alanine-racemase	unknown	unknown	gnl\|CDD\|183984
NZ_CP017890.1\|WP_086047352.1\|820853_821162_-\|AzlD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377512
NZ_CP017890.1\|WP_086047351.1\|819006_820713_+\|D-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|236872
NZ_CP017890.1\|WP_042782765.1\|830528_830852_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379462
NZ_CP017890.1\|WP_086047357.1\|830865_832524_+\|toprim-domain-containing-protein	unknown	unknown	gnl\|CDD\|238542
NZ_CP017890.1\|WP_086047356.1\|826092_828879_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222797
NZ_CP017890.1\|WP_086047350.1\|813964_815626_+\|DUF3763-domain-containing-protein	unknown	unknown	gnl\|CDD\|184118
NZ_CP017890.1\|WP_005375979.1\|813179_813695_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP017890.1\|WP_005375982.1\|817721_818624_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP017890.1\|WP_086047360.1\|835783_836629_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222794
NZ_CP017890.1\|WP_086047358.1\|832523_834590_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176480
NZ_CP017890.1\|WP_086047353.1\|821158_821890_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224215
NZ_CP017890.1\|WP_029854548.1\|829125_829791_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222800
NZ_CP017890.1\|WP_086047355.1\|823632_825264_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP017890.1\|WP_031427788.1\|834742_834988_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017890.1\|WP_079741455.1\|830137_830491_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|177282
NZ_CP017890.1\|WP_062866725.1\|836639_836843_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP017890.1\|WP_049877479.1\|829826_830213_+\|RusA-family-crossover-junction-endodeoxyribonuclease	unknown	unknown	gnl\|CDD\|226936

Protein	Function_ID	Function_description	E-value
NZ_CP017890.1\|WP_017820201.1\|815635_817090_+\|ATPase-RavA-stimulator-ViaA	gnl\|CDD\|236815	PRK10997, yieM, ATPase RavA stimulator ViaA.	0
NZ_CP017890.1\|WP_086047359.1\|834977_835682_+\|hypothetical-protein	gnl\|CDD\|153443	cd08041, OBF_kDNA_ligase_like, The Oligonucleotide/oligosaccharide binding (OB)-fold domain of kDNA ligase-like ATP-dependent DNA ligases is a DNA-binding module that is part of the catalytic core unit. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP-dependent ligases are present in many organisms such as viruses, bacteriohages, eukarya, archaea and bacteria. The mitochondrial DNA of parasitic protozoan is highly unusual. It is termed the kinetoplast DNA (kDNA) and consists of circular DNA molecules (maxicircles) and several thousand smaller circular molecules (minicircles). This group is composed of kDNA ligase, Chlorella virus DNA ligase, and similar proteins. kDNA ligase and Chlorella virus DNA ligase are the smallest known ATP-dependent ligases. They are involved in DNA replication or repair. ATP dependent DNA ligases have a highly modular architecture consisting of a unique arrangement of two or more discrete domains. The adenylation and oligonucleotide/oligosaccharide binding (OB)-fold domains comprise a catalytic core unit that is common to most members of the ATP-dependent DNA ligase family. The catalytic core unit contains six conserved sequence motifs (I, III, IIIa, IV, V and VI) that define this family of related nucleotidyltransferases. The OB-fold domain contacts the nicked DNA substrate and is required for the ATP-dependent DNA ligase nucleotidylation step. The RxDK motif (motif VI), which is essential for ATP hydrolysis, is located in the OB-fold domain.	6.61081e-16
NZ_CP017890.1\|WP_086047354.1\|822201_823431_-\|alanine-racemase	gnl\|CDD\|183984	PRK13340, PRK13340, alanine racemase; Reviewed.	0
NZ_CP017890.1\|WP_086047352.1\|820853_821162_-\|AzlD-domain-containing-protein	gnl\|CDD\|377512	pfam05437, AzlD, Branched-chain amino acid transport protein (AzlD). This family consists of a number of bacterial and archaeal branched-chain amino acid transport proteins. AzlD is known to be involved in conferring resistance to 4-azaleucine although its exact role is uncertain.	5.32129e-07
NZ_CP017890.1\|WP_086047351.1\|819006_820713_+\|D-lactate-dehydrogenase	gnl\|CDD\|236872	PRK11183, PRK11183, D-lactate dehydrogenase; Provisional.	0
NZ_CP017890.1\|WP_042782765.1\|830528_830852_+\|hypothetical-protein	gnl\|CDD\|379462	pfam14090, HTH_39, Helix-turn-helix domain. This helix-turn-helix domain is often found in phage proteins and is likely to be DNA-binding.	3.85542e-07
NZ_CP017890.1\|WP_086047357.1\|830865_832524_+\|toprim-domain-containing-protein	gnl\|CDD\|238542	cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.	2.04819e-53
NZ_CP017890.1\|WP_086047356.1\|826092_828879_+\|hypothetical-protein	gnl\|CDD\|222797	PHA00452, PHA00452, T3/T7-like RNA polymerase.	1.66069e-174
NZ_CP017890.1\|WP_086047350.1\|813964_815626_+\|DUF3763-domain-containing-protein	gnl\|CDD\|184118	PRK13531, PRK13531, regulatory ATPase RavA; Provisional.	2.24331e-171
NZ_CP017890.1\|WP_005375979.1\|813179_813695_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	7.43581e-51
NZ_CP017890.1\|WP_005375982.1\|817721_818624_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.80083e-88
NZ_CP017890.1\|WP_086047360.1\|835783_836629_+\|hypothetical-protein	gnl\|CDD\|222794	PHA00439, PHA00439, exonuclease.	2.17408e-58
NZ_CP017890.1\|WP_086047358.1\|832523_834590_+\|hypothetical-protein	gnl\|CDD\|176480	cd08643, DNA_pol_A_pol_I_B, Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication. Family A polymerase functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication. DNA-dependent DNA polymerases can be classified in six main groups based upon phylogenetic relationships with E. coli polymerase I (classA), E. coli polymerase II (class B), E.coli polymerase III (class C), euryarchaaeota polymerase II (class D), human polymerase beta (class x), E. coli UmuC/DinB and eukaryotic RAP 30/Xeroderma pigmentosum variant (class Y). Family A polymerase are found primarily in organisms related to prokaryotes and include prokaryotic DNA polymerase I ,mitochondrial polymerase delta, and several bacteriphage polymerases including those from odd-numbered phage (T3, T5, and T7). Prokaryotic Pol Is have two functional domains located on the same polypeptide; a 5'-3' polymerase and 5'-3' exonuclease. Pol I uses its 5' nuclease activity to remove the ribonucleotide portion of newly synthesized Okazaki fragments and DNA polymerase activity to fill in the resulting gap. A combination of phylogenomic and signature sequence-based (or phonetic) approaches is used to understand the evolutionary relationships among bacteria. DNA polymerase I is one of the conserved proteins that is used to search for protein signatures. The structure of these polymerases resembles in overall morphology a cupped human right hand, with fingers (which bind an incoming nucleotide and interact with the single-stranded template), palm (which harbors the catalytic amino acid residues and also binds an incoming dNTP) and thumb (which binds double-stranded DNA) subdomains.	0
NZ_CP017890.1\|WP_086047353.1\|821158_821890_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|224215	COG1296, AzlC, Predicted branched-chain amino acid permease (azaleucine resistance) [Amino acid transport and metabolism].	3.92956e-37
NZ_CP017890.1\|WP_029854548.1\|829125_829791_+\|hypothetical-protein	gnl\|CDD\|222800	PHA00458, PHA00458, single-stranded DNA-binding protein.	4.47243e-10
NZ_CP017890.1\|WP_086047355.1\|823632_825264_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	7.02556e-68
NZ_CP017890.1\|WP_079741455.1\|830137_830491_+\|hypothetical-protein	gnl\|CDD\|177282	PHA00447, PHA00447, lysozyme.	1.2917e-09
NZ_CP017890.1\|WP_049877479.1\|829826_830213_+\|RusA-family-crossover-junction-endodeoxyribonuclease	gnl\|CDD\|226936	COG4570, Rus, Holliday junction resolvase [DNA replication, recombination, and repair].	0.00105309

>NZ_CP017890.1|WP_086047356.1|826092_828879_+|hypothetical-protein
MTYYKDTFQATAHEIRYERPEPEVLGIEFAEGFTREDYVEQIEREYEAREKAYAREMAKFHKAMNEGTEHETTLGKGLIGKNINTLAEAMRKIASESSRGRPTALKRFLTEVYSNYEQIAVHTLEGCVKGMTDVRPLTDVAIDIIIGIEDEMNFAILERLHGGIAKATQARMSTKRDIKHRRESLKWAVKYQAEMDWVRLSVEERVHYGHALIVLATTELGWFKAARRRDQSTGHNRDYLIAQDNFMWLLEEAQQELARLARPSYAPMVVPPRKWSPETVRRGAYITPASKPLSMIKTQNKAYLRELQTAGMEKVYDALNRIQETPVRINKTILNWLETFIEQQLPWAMDIDLPAMHKLDIKDYTPAKPEGLADDDYRVKEYQAACREFYVMEATERAKFSAMLSVLEMARGVAHKDRFFVPWQGDTRMRVYPVSKLNFQGADYVKALCQFADGVALGKHGMKWLMIHMANLMGVDKVTFEERVKWVEAHKEQIIALAKDPRDCRDFLMSADKPMQAIACATELAEAWSMKNAEEFVSYIPIALDGSCSGLQILGAALRCEKTGEHVNLIPAGRVADIYRVVSDIVTSEFKSMVEGCESKEDAEALATEKALEVYLEAHDGDASNFEKALELAKAHAIREDKEKGIEKEAGYITEMRKVYRSYTEAYAWLQFGIDRGTVKRNVMTYCYGSAQFGFKEQCMEDIIHPAYMEYKQKKNRGEDAVWHFHGNGSAAAALMAKHAYAAVKRTVLRAAQAMDWMQKAAYLIAQDNAPVRWTTPLGFPVLQEYRVTKEQVVNCITLGQRRQLHVRIDTLDYDKNKAKNSIAPNVVHSLDSCHLQSLVNMAYEKHGIKHFALIHDSFGTHAGNTEVFFKVIREAMVEMFENTDVFAELEQEFKLQCNPEKHDKFLTLPEYGNLDLHGIIESDFAFA
>NZ_CP017890.1|WP_086047355.1|823632_825264_-|methyl-accepting-chemotaxis-protein
MSIKNLSIAKKISLSFLLIAIVNIAFGVFLSTELKSIKSELLNYTDDTLPAMERVDSIRDHLSRWRRAQFAAYTYEDADQVKTKISNNIREREKITRELNAYGETIWPGEEQQTYQRLMRQWKKYLVTMDQYNEAMLANDKSKAHPILANSLSAFEAVDSELGELIRLLKEAMDSNKTHILSSVNGLSNSSIASNVIILLIMVGMTYVLTRLICGPLKLVVEQANAIATGDLSSDIDRKAIGNDELGELADATTKMQDDLRQVIDNVIAAVTQLSSAVEEMNQISDISASGMKDQQLQITHIATAMTEMKAAVADVARNTEDSANQANEANRRTQHGVRETQRMVDAIQEVSNVIGAAGDTVAELEQQSNKINVIVDVIRDIADQTNLLALNAAIEAARAGESGRGFAVVADEVRTLAGRTQDSTSEITSIIEQLQSLAKDAKSATELSRTSISECAEQGIQSKQLMSDIEHSISDISDMGTQIATACNQQDSVAEELNRSIENIHLASQEVSQGSEQTAQACRELSQLSISLKDVMSRFKLS
>NZ_CP017890.1|WP_086047354.1|822201_823431_-|alanine-racemase
MRLNKTLLSLTIAAAIAVPVMQATAAPLQISNTAAKAEQVQSANAWLEINLGQFRDNIEQFKSHMDGKTKICAVMKADAYGNGIAGLMPTIIEQQIPCVAVASNAEAQTVRDSGFKGQLMRVRSADIGEIEAAIDLNVEELIGTAEQAKALSKLAEKAGKELKVHLALNDGGMGRNGVDMTTEAGKKEALEIAQQAGVNIVGIMTHFPNYNADDVRQKLASFKDSSAWLIKEANLKRDNILLHVANSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRVASVHHLPKNSTVGYDSSYTTSKESLMANIPVGYSDGYPRKMGNTAEVLINGQRAKVAGVASMNTTMVDVTGIKDVEPGSEVVLFGSQQGKTISAAEMEKHAEVIFPELYTVWGSANPRVYVK
>NZ_CP017890.1|WP_086047353.1|821158_821890_-|branched-chain-amino-acid-ABC-transporter-permease
MTENTQHLQRSSTELHEFNRLDVWNGFTQLLPLSMFVVIFGLAFGVTAVQTGLDVFPTMLMSTLVFAGASQFATLEMWGAEVPLIPVLITVFAINARHLLMGATLYPWLRQLPPTKRYGVMLVASDANWAMALNAFGRKEPGFGLLVGGGLAMWSFWIVGTWIGIYFGSAIKDPVGLGLDMVMGCFLLSMVVAGPKDLRIFAIWAIAAASSMLAYWYLPENSHVVVGAITGGVLGACWKEKKA
>NZ_CP017890.1|WP_086047352.1|820853_821162_-|AzlD-domain-containing-protein
MNIETTIGGTLVIIIAMALVTLITRWGGVYVMSFIPISERVQRFITAMSGSVLVALLAPLAVEGDNGARAALFSTAVVMFIVKKPLPAIAAGIIAAAAVRAL
>NZ_CP017890.1|WP_086047351.1|819006_820713_+|D-lactate-dehydrogenase
MKQKQLIEEFKAIVGEENVLTDEVKTKYYRSGFRSGSGNALAIVFPNTLLEQWKIIKQCVEANCIIIMQAAKTGLTEGSAPSGNDYDRDVVVINITKIKKIHLLDGGKQAVCLPGASLHSLEKELKAVNRAPHSIIGSSSLGATVVGGIANNSGGALVKRGPAYTELAIYAQVDKQGQLHLVNHLGIEGLGETPEEILTNLQEGNFDPAKIIHDERMASDKEYDERVRDVTSDIPSRFNADERRLFEASGCAGKLGVFAVRVDSYPVPEKEQVFYLGTNDPAKLTKLRKDFLSTFDDLPEMGEYLHRDIFNMAEKYGKDVFLSIDLLGTDKLPKMFALKAKVENFLERIPFVSKYLPDTILYYASKLFPQHLPERMLDFRDKYEHHLVLKMSDGGIAEAQKYLKEVWAVEDDCDFFECTPEEGKKAYLHRFAAAGAAIRYETIHRKDVEDIVALDIALRRNDEEWLETLPEEVSKNLVQALYYGHFMCYVFHQDYIFKKGTDTKLMKKLMLEHLNSRGAKYPAEHNVGHLYEAENSLQKFYHELDPTNTFNPGIGKMDKYKRNCNCCA
>NZ_CP017890.1|WP_005375982.1|817721_818624_+|LysR-family-transcriptional-regulator
MRNTDDYIIFYHLIEQGSFSAAARHMSLTKSVVSKRIAKLEQELGVQLLYRTTRTLTLTEAGRAFFTHAKAVYQAVATAEESIVGLGKNLSGHIKISVPTISGELILPQVINEFNQKYPDINIDMDLDNRFVDIVNERFDLAIRTGVLPDSSLIARKLVDANWIICASPQYLAKHGIPKQPQALAKHNCLVYSYQETGAHEWAFKDGDEVYQITVDGNLCTNNSSVLRNVALLGQGIIYVPRVLVYEDLKQGSLIQLFKDETAKCLGIYAVYPYTRQQPEKIKIFIDHLYTSFQSQNHRF
>NZ_CP017890.1|WP_017820201.1|815635_817090_+|ATPase-RavA-stimulator-ViaA
MLGADGLNLALMVADSGIIDSAVNDLMARSQVMMMAENRGVKSSVKGHLLKWRGSVKKRITKVCETERFQQELSLYQEVIHWDEEAFFENIEDVIKKLEWHSAFYMQARRMMEKNKGMNNPMFPHYFCDQWYQSLTDAIKQAQVSELEANKEKVLKDLYQRMETMRNMDKVTESGDAESVGRLWDMASAKLSKTDLTVMKRHAEFLKKHQGLQEIAEQLGRMAGQVNDPELNRAPTEELQLVEEKSDEATDDIVGIHESDDLNKLLPNETMFLAYPELEVVFYKHLVDKRLMNYRTQGKSRTLRKVKAHRPDHKAVDIEKGPFIVCVDASGSMSGFPEQCAKAMAYALMQIALAEQRDCYVIIFSTEHITYELTKQDGLREAADFLTYSFHGGTDLEPTLIKSIDLMSGDKYKNADMVVISDFIAPKQQDELLAKVDALKAKKNRFHAISLSKYGNPALMSMFDHTWSYHPNVVGRLLKRVSNY
>NZ_CP017890.1|WP_086047350.1|813964_815626_+|DUF3763-domain-containing-protein
MTQTLFASNAEKALLSERINKLAKALTDGVYEREHTIKLCLLAALAGESVFLLGPPGIAKSLIAKRLIQAFDNSSYFEYLMTRFSTPEEVFGPLSIQELKDNGRYVRLTKGYLPTAQVVFLDEIWKAGPAILNTLLTVVNEKTFKNGSDIERVPMRLLVSASNELPDEDSGLDALYDRMLVRVFVNRIQNKQNFKSMLTVGTSQEAQVPEGLAITDEEYHQWQQQLDKLTLTDNAFEKLFQLKTMLESKVEAQFGDVANTDMYVSDRRWKKAVKLLKASAFFNGRDEVNPLDLLLLQDCLWNSPESRDVVREVVQEFALKHAFDQQDAEQEIEYCRESLVDVQHELEDAYRMTLTSEAATGILRKETMRFDTSKAKMYKVGAAVNLVKLVVLQSNMSVSESEKGDSRWVYVPKDELDRVIKEGSGDVYGYVNQNTNMCRLRFDVDAANNLVIRDIANRGILVSLVTQEGLDVELYQKWLTQSEKAVNQLSEAEHHMRKVKANFHDALPHSFVDPELPRLMESSLQQVSQRLESIQAESEKVIQRFKNLNQFFS
>NZ_CP017890.1|WP_005375979.1|813179_813695_-|NUDIX-hydrolase
MSKIIHKWKQISLIEEDVVLPTGQAITHTTIHHPGAAVILPITAEGHIVLVHQFRPSLNKWLLELPAGTREGNEEPLCCAKRELEEETGFSAEKFTSLGQVTPLAGFCDEIQYLFVAEKLNKTNRYECDEDEVIEVVTLSIKQLEEKIVDGTITDAKTIACLSKARLCGYI
>NZ_CP017890.1|WP_029854548.1|829125_829791_+|hypothetical-protein
MAKQANKRPLVTLPVGIAQFPWLNKPDTLYDKNGAYKTDLVVNPDDSDVKEVVAQLEGILRDYWQNEKGGKGEMVDILLEKDGKFFFRVKQSSFEYQGETILPKPIFYDARGRRMVKEPQIYGGSEIALSVEVWPYSRTETVRENGKRVTIETHGLTLKPKAVQVISLAAKGEAGAPSADHFGFASHEGGYEYDEDDVRHFEEPDDADEQHGASDDDAGNF
>NZ_CP017890.1|WP_049877479.1|829826_830213_+|RusA-family-crossover-junction-endodeoxyribonuclease
MSTNDMYQGVKVKSAAYRRWEMQVARGLPDLELPKDKRLAVRAIVRYSNKASDLDNCCKSMLDVLQKRYKFDDKNVYVLKLYKVIVPKGQEGLTLKITELEETKWQKFVNEKLLPILQSFLPKLAVKF
>NZ_CP017890.1|WP_079741455.1|830137_830491_+|hypothetical-protein
MAKVRKRETTAHIAVVFTKTGSQVLSDWDVVLADRKRGVLGHGAHHLILRDGDNYPTRDYEVYGNVELEHDGYNDDSVFIRIVGDENNMTTAQCDALEEVIAELQEKYPDAEVVYLN
>NZ_CP017890.1|WP_042782765.1|830528_830852_+|hypothetical-protein
MSKVTQAKQVIEHVAKYGSINSIEAIRHYGITRLSAVVYSLKNTQHALKEGTRDGKFTVYVPDFDARLGALKAAQEVELRDAKTGADAARISAHYTALFMKVHQQMK
>NZ_CP017890.1|WP_086047357.1|830865_832524_+|toprim-domain-containing-protein
MHDEESVLLARGLPCDDCGSSDARAEYSDGHSYCYACPPEAAYKRGNGKPMSSSASNVVTSDFKPLRGEYRALPKRAISEETAKRFGYRVGEAWHPEHKRVEIAHICDVKTEDGKYIAQKCRFADKAFSVNGKISKGTLIGMHLFSGGRRLVISEGEIDMMSISQMQGNKYPVVSLPNGVQSAKTHLLACIDYLKKFEEVVLAFDMDDVGQDSAQKAAEALAGVVNIKIAKYELKDANEMLLAGKTSEMVQALWNAEVYTPDGLLDVDDILETLFEDDNEQGLPWKHKGMNRTSNGRFYGEVHTLGAGTGLGKTTLLLEQADYDVTVLKQKVGLFMVENDPKEVLRSICGKHDGRLYHVRNTEDYTMHEAIRQTAQLYRGDLYIYDNWGLCEWDAIKAKIVYLVSLGFRVFYVDHLTALATGAEKDEKAEIERIMADIASLAQRHQILIHLVSHLSTPEKGSHEEGARVAIKHFKGSRSIGFWSHAMYGLERNQQAESLEERLITTVRQLKRRGFGSGVGGVTRLRYVAEQDKSYEMHGDEPSFKDHEKEQF
>NZ_CP017890.1|WP_086047358.1|832523_834590_+|hypothetical-protein
MAFKLREYQALKILWDYVKYGKTKARILAFDIETNGLLSTVSRFHTAVCEDLVTGEVREYRPHQYHELLKDLVEADVLVAHNGINYDVPALKKLFPFWDIPPTKVIDTLVLSRLLFADIKDRDMAGIRRWRLREQGHEVTGWVLPPKLLGSHSLKAWGYRLQEYKGDYGEQEDAWAEFSEDMLIYCRQDVTVTIKLIRRLMQEFPEASFKAMQLEHEIQWLMSQQERNGFKFNVAKAEQLYFKLLGDRETIRQKLVDKFGTWYASNGVTTPKRSMNRMGMSYTAGAPYTKLKEVTFNPASRDHCAKVLAEAGVVFTEFTDGGTKPKIDEDVLKHIDLPEAQMLNEFFMLNKRIGQIAEGKQAWLRLVTPEGFIHGSINPNGAVTGRATHSFPNIAQVPAGRAPYGQECRECFTVPDGWVLLGSDASGLELRCLGNRMFPWDKGAYNKVILEGDIHWENAQSAGFVERGVLRDKHNPDHELRRGKAKTFIYAFLYGGGDELIGMQVGYTHEEYLAWKEAGAHIPIIKQLERRGERWTRERVCYILKGKEVKKKFLEGLPALDKLIKKCKKAAKDDGYVVGLDGRKVFCRSQHSALNTQLQSDGALICKMWCVVVDQMMQERGYKHGFDGDYAFCAWVHDEVQVACRSEDIAKELGQICKDAMHFVENYYSVDCPLDAEFDIGSSWFETH
>NZ_CP017890.1|WP_031427788.1|834742_834988_+|hypothetical-protein
MKVIYKKLISELIREEAYKAKSLNRVIDRIELTHDEFDDLVNELTPGHFVAVPLRRKPLDVRKMRYLDIDIVAVEGGDDEF
>NZ_CP017890.1|WP_086047359.1|834977_835682_+|hypothetical-protein
MSFKPKKAHNWNGKSLKGDYRVTVKIDGVRLTRNEQGEIVSRSNKPLYNLPPIPEHIQDAEIFLGDWDSTISAVRTHEGDTVPYSAIYELRPNLDPRLDLGIVSDPSAAYIQEQLEASLGCGYEGLVLERLKDGRWIKVKNKETYDVLVTGFQAGTGKHEGRMGALITAYGKVGTGFTDAQRQEWQDLHDQGLAIGMLIEVECMEVTKDGKFRHPRFVRPRVDKLEETPPCKPE
>NZ_CP017890.1|WP_086047360.1|835783_836629_+|hypothetical-protein
MKTIGLFDADWIAFQMAAACQKRHRWPDGIWTLEVDENEVAKAIDDRIEYLRKEISCRKENVYMFLSGTDNWRKHIMPRYKANRDSINNWISRPMILDYALQYIRDNYQFFQHDMLEADDLMGIYATNPEWHGDDKKVIVAIDKDMKSIPAWHYTPDKDFAPWLQSEAEADVLYYKQWLMGDRTDGYEGCQGIGEKTALDLAVSPVLLVPTNHEFKSGARKGQVEVRWKKTPTGDRGACVASHYAKAGHTSEECYQNGMVARILRHGEFCFKTNTVLFTPH
>NZ_CP017890.1|WP_062866725.1|836639_836843_+|hypothetical-protein
MIKFITKLLNIAGFLAAREAATQLKKAQATEKKRDKVIDKLDKAIAKRTNKSVAASVILTKLNQLGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

826092 : 849961

Rhizobium_phage(21.05%)

tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086047356.1\|826092_828879_+	hypothetical protein	A0A2R2ZGE5	Ralstonia_phage	7.7e-117	33.3
WP_029854548.1\|829125_829791_+	hypothetical protein	L7TLT1	Rhizobium_phage	3.1e-08	28.6
WP_049877479.1\|829826_830213_+	RusA family crossover junction endodeoxyribonuclease	A8HP85	Thalassomonas_phage	1.3e-09	36.6
WP_079741455.1\|830137_830491_+	hypothetical protein	NA	NA	NA	NA
WP_042782765.1\|830528_830852_+	hypothetical protein	NA	NA	NA	NA
WP_086047357.1\|830865_832524_+	toprim domain-containing protein	L7TLT7	Rhizobium_phage	4.9e-111	47.5
WP_086047358.1\|832523_834590_+	hypothetical protein	E5RV10	Ralstonia_phage	3.8e-153	42.9
WP_031427788.1\|834742_834988_+	hypothetical protein	NA	NA	NA	NA
WP_086047359.1\|834977_835682_+	hypothetical protein	A0A2D0YMU1	Vibrio_phage	2.2e-52	50.0
WP_086047360.1\|835783_836629_+	hypothetical protein	F1D0G7	Vibrio_phage	8.2e-38	34.1
WP_062866725.1\|836639_836843_+	hypothetical protein	NA	NA	NA	NA
WP_086047361.1\|836943_837234_+	hypothetical protein	NA	NA	NA	NA
WP_029854317.1\|837253_837583_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0K0MDI0	Pseudoalteromonas_phage	4.8e-18	44.5
WP_062866726.1\|837582_838044_+	DUF3310 domain-containing protein	M4SQK7	Pseudoalteromonas_phage	1.5e-12	47.1
WP_062866727.1\|838043_838256_+	hypothetical protein	NA	NA	NA	NA
WP_029854322.1\|838260_838902_+	FAD-dependent thymidylate synthase	A0A291I996	Pseudomonas_phage	9.2e-82	65.1
WP_049877459.1\|838924_840808_+	anaerobic ribonucleoside-triphosphate reductase	A0A2I7R0M2	Vibrio_phage	4.0e-210	60.8
WP_029854327.1\|840788_840998_+	hypothetical protein	NA	NA	NA	NA
WP_029854329.1\|841070_841541_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0N7GFM7	Escherichia_phage	4.3e-36	49.0
WP_086047362.1\|841534_842149_+	deoxynucleoside kinase	A0A127AVX2	Bacillus_phage	3.9e-05	26.4
WP_154215838.1\|842242_842407_+	hypothetical protein	NA	NA	NA	NA
WP_062866731.1\|842409_842616_+	hypothetical protein	NA	NA	NA	NA
WP_031810172.1\|842618_844136_+	hypothetical protein	A0A0F7L8L5	uncultured_marine_virus	8.5e-102	40.0
WP_086047363.1\|844144_844840_+	hypothetical protein	G8EXK7	Cyanophage	3.3e-08	33.3
WP_086047364.1\|844946_846077_+	hypothetical protein	L7TJ83	Rhizobium_phage	2.5e-50	39.0
WP_015727771.1\|846132_846720_+\|tail	tail tubular protein A	A0A0P0UWD6	Pectobacterium_phage	9.5e-17	31.1
WP_086047365.1\|846725_849521_+	hypothetical protein	L7TLW2	Rhizobium_phage	4.5e-72	28.0
WP_086047366.1\|849520_849961_+	DUF2833 domain-containing protein	A0A1B1IW17	uncultured_Mediterranean_phage	3.2e-09	28.9

DBSCAN-SWA_2

966015 : 974545

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042765525.1\|966015_966381_+	phage protein	Q9MCC4	Vibrio_phage	5.1e-61	95.0
WP_157664328.1\|966450_967194_-	hypothetical protein	NA	NA	NA	NA
WP_157664329.1\|967313_967586_-	hypothetical protein	NA	NA	NA	NA
WP_017636215.1\|968404_969790_-	toxin	Q783T9	Vibrio_phage	2.0e-262	97.8
WP_005477634.1\|969794_970139_-	DUF2523 domain-containing protein	Q783U0	Vibrio_phage	5.0e-58	100.0
WP_162497052.1\|970140_971247_-	hypothetical protein	Q783U1	Vibrio_phage	2.2e-152	91.3
WP_029851175.1\|971824_972070_-	hypothetical protein	Q783U2	Vibrio_phage	6.3e-31	96.3
WP_005477619.1\|972075_972306_-	hypothetical protein	Q783U3	Vibrio_phage	1.6e-36	100.0
WP_053303056.1\|972309_972669_-	DUF1293 family protein	Q783U4	Vibrio_phage	7.7e-62	99.2
WP_086047405.1\|972672_973881_-	phage replication protein	Q783T8	Vibrio_phage	7.4e-242	98.5
WP_005477640.1\|973804_974020_-	hypothetical protein	A0A1W6UGD1	Vibrio_phage	3.1e-34	98.6
WP_069522566.1\|974176_974545_+	antirepressor	Q9MCC3	Vibrio_phage	4.8e-59	97.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP017889

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP017889_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP017889_1

2956697-2956943

Orphan

Consensus_repeat	Method
TAATGCCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP017889_1

>merge|NZ_CP017889|1|2956697-2956943|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAATTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>NZ_CP017889|1|1|2956697-2956943|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAG	GTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTT
TGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGT	GTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAA
TTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP017889.1\|WP_031777269.1\|2972668_2972980_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|224364
NZ_CP017889.1\|WP_005381064.1\|2973031_2974366_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP017889.1\|WP_086047048.1\|2947669_2947960_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
NZ_CP017889.1\|WP_005381009.1\|2948638_2949241_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP017889.1\|WP_005381010.1\|2948088_2948520_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NZ_CP017889.1\|WP_005381006.1\|2951549_2952578_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NZ_CP017889.1\|WP_025767645.1\|2974453_2974759_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP017889.1\|WP_054579417.1\|2971333_2972656_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
NZ_CP017889.1\|WP_017635577.1\|2949259_2950438_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP017889.1\|WP_005381001.1\|2954964_2956104_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
NZ_CP017889.1\|WP_005384506.1\|2952595_2953315_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP017889.1\|WP_062730828.1\|2975006_2976290_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200570
NZ_CP017889.1\|WP_005381007.1\|2950530_2951451_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880
NZ_CP017889.1\|WP_005381031.1\|2969456_2970455_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380494
NZ_CP017889.1\|WP_025768825.1\|2953518_2954595_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NZ_CP017889.1\|WP_025768824.1\|2957252_2958878_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP017889.1\|WP_005381029.1\|2968072_2969326_-\|HD-GYP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NZ_CP017889.1\|WP_005381002.1\|2954614_2954887_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP017889.1\|WP_005381046.1\|2970559_2971315_-\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007
NZ_CP017889.1\|WP_162497030.1\|2959870_2961307_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421

Protein	Function_ID	Function_description	E-value
NZ_CP017889.1\|WP_031777269.1\|2972668_2972980_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|224364	COG1447, CelC, Phosphotransferase system cellobiose-specific component IIA [Carbohydrate transport and metabolism].	6.82212e-37
NZ_CP017889.1\|WP_005381064.1\|2973031_2974366_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	7.08839e-153
NZ_CP017889.1\|WP_086047048.1\|2947669_2947960_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	9.04862e-59
NZ_CP017889.1\|WP_005381009.1\|2948638_2949241_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	3.88474e-123
NZ_CP017889.1\|WP_005381010.1\|2948088_2948520_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	4.01664e-66
NZ_CP017889.1\|WP_005381006.1\|2951549_2952578_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	1.81671e-08
NZ_CP017889.1\|WP_025767645.1\|2974453_2974759_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	3.05599e-45
NZ_CP017889.1\|WP_054579417.1\|2971333_2972656_-\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP017889.1\|WP_017635577.1\|2949259_2950438_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP017889.1\|WP_005381001.1\|2954964_2956104_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	8.90498e-147
NZ_CP017889.1\|WP_005384506.1\|2952595_2953315_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	1.04237e-109
NZ_CP017889.1\|WP_062730828.1\|2975006_2976290_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200570	cd10946, CE4_Mll8295_like, Putative catalytic NodB homology domain of uncharacterized Mll8295 protein encoded from Rhizobium loti and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase Mll8295 encoded from Rhizobium loti. Although its biological function still remains unknown, Mll8295 shows high sequence homology to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both Mll8295 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	3.33942e-70
NZ_CP017889.1\|WP_005381007.1\|2950530_2951451_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NZ_CP017889.1\|WP_005381031.1\|2969456_2970455_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380494	cd06270, PBP1_GalS-like, ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalS is a dimeric protein like GalR,and its major role is in regulating expression of the high-affinity galactose transporter encoded by the mgl operon, whereas GalR is the exclusive regulator of galactose permease, the low-affinity galactose transporter. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type 1 periplasmic binding protein-like fold. Hence, they are homologous to the periplasmic sugar binding of ABC-type transport systems.	2.30744e-113
NZ_CP017889.1\|WP_025768825.1\|2953518_2954595_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NZ_CP017889.1\|WP_025768824.1\|2957252_2958878_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.01442e-61
NZ_CP017889.1\|WP_005381029.1\|2968072_2969326_-\|HD-GYP-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	2.25733e-72
NZ_CP017889.1\|WP_005381002.1\|2954614_2954887_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	2.80095e-59
NZ_CP017889.1\|WP_005381046.1\|2970559_2971315_-\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	2.73111e-124
NZ_CP017889.1\|WP_162497030.1\|2959870_2961307_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0

>NZ_CP017889.1|WP_005381001.1|2954964_2956104_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIVFIAAALLMAGCSREFVEKIYDVNYEPTNRFANNLAELPGQFEKDTAALDALINSFSGNIQKRWGKKEIKYAGKSNYVKYIDNYLSRAEVDFRKGVITIETVSPTEPQKHLKDAIVTTLLTPDDPAHVDLFSSKGITLEGQPFLYKQVVDQDNKPIQWSWRANRFAEYLIANKIKTKNVDFKKAYYVEIPMVEDHFSTRSYQYADIVRRASKKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKKRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLREVRHPTSLEYSMISAYNGGTGGVLNTFHRSDRKRAMQDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSKQTL
>NZ_CP017889.1|WP_005381002.1|2954614_2954887_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIEGYTPPSE
>NZ_CP017889.1|WP_025768825.1|2953518_2954595_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAQEVASTYNGEFPLDIEKMNALPGIGRSTAAAILSSVYKQPHAILDGNVKRTLSRCFAVEGWPGQKKVENQLWEIAETHTPQTDVDKYNQAMMDMGAMVCTRSKPKCSLCPVADLCVAKQQGNVLDYPGKKPKKDKPIKQTRFVMLHHNTENGHEVWLEQRPQTGIWGGLFCFPQTEHVDAESDIELLLDQRGIQASNIKQKQTLITFRHTFSHYHLDITPILFDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETLPHELR
>NZ_CP017889.1|WP_005384506.1|2952595_2953315_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTMGIDFKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGITNLRVMCHDAVEVFEHMIPNGSLSTLQLFFPDPWHKKRHHKRRIVQLGFAEMVREKLIPNEGIFHMATDWENYAEHMIEVMNQAPGFENIAKDGDFVPRPDDRPLTKFEARGHRLGHGVWDIKYKRIA
>NZ_CP017889.1|WP_005381006.1|2951549_2952578_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAILASQGVDVTEIGSKDVGLPAALVFSCQEALTDEQARRIAASSIYYALFEVREDGLLRPVQAPVFNTFPESMSQILRYTGKTNEQFTRLMVNIGISASNTGSEQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINAKWVQEIQTFIVKFMKNGRFKHKVSKEKRTAGGKKVADGFVVEAAANKEDYNQGNLQFMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLNEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEEPYIGYLHRVDQSINRNIIVAVKP
>NZ_CP017889.1|WP_005381007.1|2950530_2951451_-|glutaminase-B
MKPTVEILTDILAEVRPLIGQGKVADYIPALAKVPSNKLGIAVYTNEGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWSRVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIVVADLLQTRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTISVWSPELDPSGNSLAGTKALELLSERIGRSIF
>NZ_CP017889.1|WP_017635577.1|2949259_2950438_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHSIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRISIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFELGHQKLAAAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPLSTIQETISWAIEMGYLSETPTHWQITEKGKLFLNDLLEAFMAEESEE
>NZ_CP017889.1|WP_005381009.1|2948638_2949241_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDFLKGAPGIYSARYAGESASDQENLEKLLAAMEGVPEAERTARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQVSQ
>NZ_CP017889.1|WP_005381010.1|2948088_2948520_+|DUF4426-domain-containing-protein
MSKWITALLISLLSLPSFADQFKNMKDIEVHYVAFNSTFLTPKVARSYDIKRNGYLAVVNISVLDRASLGKPALEAKIAGRAKNLIGQTQTLTFREVKEGNAIYYLAELPITHEETFTFDIDVKAGNKGSGKLKFTQKFYVEE
>NZ_CP017889.1|WP_086047048.1|2947669_2947960_+|YggU-family-protein
MSAAVWQDGEDIILKLYIQPKASRDKVVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKIAKGLVHIEKGELGRHKQIRIESPTQIPTEIKAIL
>NZ_CP017889.1|WP_025768824.1|2957252_2958878_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEKMAIEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMMFIAAPLDPQLHGTSFHDFRDGSGNSVGQLILDVLGHKTGQIVEYTWSQKQADGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWSTAQWQLVLCLIIAGSILSGLIISIRKMLHLLGGEPNDVRKAVQAVAQGDIQTSFDTVAPRGSIYRAVQDMSQSLATMVTNLEKSMHALRAELFAVESRSNTIADLTVSQQQSTAMIATAMTEMASSANHVANSASDTANNTDEADKQSQHTQKLIHNTVENIQGLASQLNTASKAVADLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQYMISNLQEGSRNAIHTMEICAETSESTVTESKNASEALQQIVTALESITTMSQQIATAAAEQTQVSDDIALRINLIEESGGQLNSVVTESQSSTQSLASLANELEGWVNKFSVKH
>NZ_CP017889.1|WP_162497030.1|2959870_2961307_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MMQQIKNETLKSVFKQWSSDEGIVVINPATEQELIRLKPSTLDELDDLIGQCKTEQVRWAKLSAKERSRRLRGWYQLLLDNAEDIATIITLEQGKPLAESKGEVMYGASFVEWFSEEAKRAYGEVIPAPTTDRRLSAIRQPVGVCAAITPWNFPIAMITRKAAPALAAGCGMLIKPSELTPLTAIAVVELAYQAGIPKELLSVVVSEQAAEFGQVLSTDPRIQKISFTGSTRVGKILMKQASDSVKAVSMELGGNAPFIVFEDADLDEAAEGLVASKFRNAGQTCVCTNRLYVHKNVKQAFIDKVLSKLSKLKLGNGLEKGVTLGPVITMASKHRLEAVIDQAVQEGASIANSPQRRPGRFMEPVLLGSVTQNMSIVQQELFGPVLPIITFENDYQVLEMANDTEYGLACYFYTNSLKRIVTFSEGLEYGMVGVNEGIISTEVAPFGGVKESGVGREGAKQGLDEYLETKYICLGGLS
>NZ_CP017889.1|WP_005381029.1|2968072_2969326_-|HD-GYP-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQEQVEMIRHLGVKFVYFNPEQSDAVPLPVDQRQADRVTNEASLDHETQKMWQEKQNRIEKLSAYRRRVIQCEKEFERSLARMRSVMTKIRNRPTAAVDEAKLLIEDIVEKLMCDDNVTLHLMNGKNEFEDIYFHSLNVAVISMMIGRAKGYSAAQLKELSFSALFHDIGKIKIPTAILRKQLPLTEPETNYLKLHTKYGVDLASQIEAFPEVARIVIAQHHELRDGSGYPKGLKGDEINEFAQIIAVANAFDNLCHTPIVSDQKIPYTALSHLYKNCKHLYKEENLNILIKFMGVFPPGTVVQLSNNMVGLVISVNASHLLFPNVLVYDPSVPRTQAPIIDLASKDIKIVNAIHPSKLPDKVKEYLNPRSRISYFFDSDE
>NZ_CP017889.1|WP_005381031.1|2969456_2970455_-|LacI-family-DNA-binding-transcriptional-regulator
MARIKDVAELAGVNRSTVSRIINGEGKFREETRKKVEQAMAQLNYRPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMEQVQTELDIHKKFLITAQGHHSAQGEKEAIQRFNDLRCDGYVLHSRYLSDDDLRELAKQPTPFVLLDRYVEGIEERCVTFNHHHASRIAVEHLLAGGHRKIACIAGPSQRHNSVLRKLGYIDAMKDAGIDIDESWCEEGNYGRQSGYDAMAAILQRHPDVTAVFSCSEEMTVGAMQYLHEHSISVPEQISLTSFDSVDLCESLYPTVSAVHFPISDMARVAVQTLMGLVKDQEVIDKPVFEAKLKIRKADRSLK
>NZ_CP017889.1|WP_005381046.1|2970559_2971315_-|chitin-disaccharide-deacetylase
MKVIFNADDFGLTRGVNNGIVKAHQQGVVHSTTMMVGMDAEQHALELARHNPDLKVGVHLRFTAGVPITKHRNLTNGRAHFINYDELWSKQDFETQVVYDEAKAQVEHFLSLGLELSHLDSHHHAHTHPQILPVIKEVANEYRVPLRGTGLCQESMTIRYIFTDEFYDQKVSLDGLMAHLLSLKADYDLVEVMCHPAEADQALILKSGYALQRELELQVLTSPILKEQLAHHGITVTDYSELVSTNQMVGV
>NZ_CP017889.1|WP_054579417.1|2971333_2972656_-|6-phospho-beta-glucosidase
MSREAIKLAIIGGGSSYTPELVEGVIKRLEYLPVRKIHFVDIESGAEKLEIIKGLAQRMVDKAGAKIEIKASFDRRAAIKDADFVMTQFRVGGLAARANDERIPIKYDVIGQETTGPGGFAKALRTIPVILDICKDIEELAPNAWMLNFTNPAGLVSEAVSKYTKVKSIGLCNVPVSMEMMIAEMMECEPKELQLEFAGLNHLVWVHKAWLNGEDITQTVLEKVGDGANFSMKNIWEEPWDPAFLKALGAIPCPYHRYFYQTDAMLAEEKQSADEKGTRAEQVMETENALFKLYQDPTLDHKPKELEERGGAYYSDASLNLVDSIYNNRNSIHVVNVLNNGAINGLPDDAVIECSAVIGSWGAKPLAVGELSNNIKGLLHQVKAYEQLTIEAAVEGNYDKALMALTNNPLVPDIGRAKSILDDILAVNAPYLPQFKLTTL
>NZ_CP017889.1|WP_031777269.1|2972668_2972980_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MEQELVVMEIICNAGEARSLSYEALRLSREQDFEAADEKLSQARECINKAHLIQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAQEMAVEIVALNKKISNK
>NZ_CP017889.1|WP_005381064.1|2973031_2974366_-|PTS-sugar-transporter-subunit-IIC
MKLYDAIIGAVEKHIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVGSFILIFAFPPFAEDTTFTFGRIWLDFATTHFDTIMMPYNMSMGIMTIFVSLGVAYSLAKAYKMDGITSAVLSLMSFLLIAAPAKDGALSMSHMGGTGIFTAVMCAFFSVELYRFMKKHNITIRMPEQVPPAIARSFEVLLPVLAIFITLYPLSLFVQTQYDMLIPDAVMAIFKPLISASNSLPAIIGALLLCQLLWFAGIHGAAIVVGLLSPIFLTNIGANIEAFVAGEPIPNVFTQPFWDFYIFIGGSGATLALVMLMSFSRSVHLKSIGRMSAVPGFFQINEPVIFGSPVVMNPTLFIPFVFAPVINATIAYFAVHVGFVGMGVATTPWTTPALIGASWGSGWTFAPVLLVIGLLILDLIIYFPFFKMFEKQMLEQELPTTKETKGDTQPSGEGVTA
>NZ_CP017889.1|WP_025767645.1|2974453_2974759_-|PTS-sugar-transporter-subunit-IIB
MKKILLCCSAGMSTSMLVKKMEQAAENKGIECKIDAMSVNAFEDAIKEYDVCLLGPQVRFQLEELRKTAQEHGKNIDAISPQHYGMMKGEEVLEQALELIN
>NZ_CP017889.1|WP_062730828.1|2975006_2976290_+|polysaccharide-deacetylase-family-protein
MKFNKLAIATLVSAALSQHSFAQTDSKGTIYLTFDDGPINASIDVIQVLNQEDIKATFYFNAWHLDGIGDENEDRSLEALKLALDTGHIVANHSYDHMVHNCVDEFGPNSAAECNATGDHQLNSYQDPVYDASMFTENLSVLAKYLPNITSYPNYKATEFARLPYTNGWRVTKDFKADGLCATSDNLKPWEPGYVCDTSNPSNSVKAAIEVQNILANNGYQTHGWDVDWAPENWGIEMPANSLTEAEAFLGYVDSALNTCAPTTIKPLNSKAQEFPCGTPLHADKVIVLTHEFLFEDGKRGMGATQNLPKLAKFIQLAKQAGYDFDTMDNYTPNWQVGHNYDAGDYVLHLGTVYQAVTNHTAQQDWAPSPTSSLWTNADPATNWTQNVSYKQGDVVTYQGLRYLVDVPHVSQADWTPNTQNTLFTAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP017889.1	2956389-2956425	0	1.0
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP017889.1	3291905-3291941	0	1.0
NZ_CP017889_1	1.2\|2956826\|75\|NZ_CP017889\|PILER-CR	2956826-2956900	75	NZ_CP017889.1	2956472-2956546	16	0.787

1. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to position: 2956389-2956425, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattc	Protospacer
*************************************

2. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to position: 3291905-3291941, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattc	Protospacer
*************************************

3. spacer 1.2|2956826|75|NZ_CP017889|PILER-CR matches to position: 2956472-2956546, mismatch: 16, identity: 0.787

cgtgtcggtggttcgattccgcctcgaggcaccatatctggtgcacttgcttcataagca	CRISPR spacer
cgtgtcggtggttcgattccgcctcgaggcaccatatttggtgcacttgcttcataagca	Protospacer
*************************************.**********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296499-296535	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103821-103857	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	KU052038	Escherichia phage SerU-LTIIb, partial genome	1164-1200	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	KU052038	Escherichia phage SerU-LTIIb, partial genome	3070-3106	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	LN997803	Escherichia coli phage phi467	15126-15162	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52078-52114	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52084-52120	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52089-52125	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52088-52124	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35428-35464	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13645-13681	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	MH494197	Escherichia phage CMSTMSU, complete genome	196772-196808	2	0.946
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1927-1963	3	0.919
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85817-85853	3	0.919
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	KY653118	Morganella phage IME1369_01, complete genome	698-734	4	0.892
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	LC494302	Escherichia phage SP27 DNA, complete genome	76611-76647	5	0.865
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17117-17153	5	0.865
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NC_027364	Escherichia phage PBECO 4, complete genome	207832-207868	5	0.865
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	NC_049942	Escherichia phage JLK-2012, complete sequence	23524-23560	5	0.865
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	52945-52981	6	0.838
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	MH383160	Escherichia phage UB, complete genome	272124-272160	6	0.838
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	MK327931	Escherichia phage vB_EcoM_G17, complete genome	77929-77965	6	0.838
NZ_CP017889_1	1.1\|2956743\|37\|NZ_CP017889\|PILER-CR	2956743-2956779	37	KM507819	Escherichia phage 121Q, complete genome	77938-77974	7	0.811

1. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

2. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatca	Protospacer
***********************************.

3. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

4. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

5. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

6. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

7. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

8. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

9. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

10. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagccggcaccaatc	Protospacer
*************************.******** **

11. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatc	Protospacer
******************************** * **

12. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatc	Protospacer
******************************** * **

13. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccagaa	Protospacer
**********************************

14. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccaaat	Protospacer
**********************************  .

15. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 4, identity: 0.892

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgactccggtagccggcaccatat	Protospacer
****************.********.********* .

16. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  .

17. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  .

18. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  .

19. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
caggtcgccagttcgattccggtagccggcaccatat	Protospacer
.*****.******************.********* .

20. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  .

21. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  .

22. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  .

23. spacer 1.1|2956743|37|NZ_CP017889|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 7, identity: 0.811

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcaattccggtagtcggcacaaaat	Protospacer
 * ***********.***************** *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

707555 : 714338

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383771.1\|707555_708695_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.5e-63	42.0
WP_031780851.1\|708712_709963_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	4.3e-99	48.5
WP_005381578.1\|710168_710618_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_053306529.1\|710625_711753_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.2e-45	34.8
WP_053306528.1\|711761_712415_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.9e-32	36.1
WP_005381573.1\|712588_713698_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-65	39.8
WP_005381572.1\|713867_714338_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	48.7

DBSCAN-SWA_2

1176204 : 1185973

Mycobacterium_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086046623.1\|1176204_1179252_+	cell division protein FtsK	A0A218M9A2	Mycobacterium_phage	1.3e-88	48.0
WP_017634949.1\|1179313_1179940_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_045368976.1\|1179946_1181296_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	4.9e-85	43.2
WP_005378225.1\|1181387_1182695_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.6e-91	42.8
WP_086046624.1\|1182898_1183801_+	DUF3380 domain-containing protein	A0A291LBS7	Pseudomonas_phage	1.3e-36	43.5
WP_054575142.1\|1183790_1184219_+	hypothetical protein	NA	NA	NA	NA
WP_033905078.1\|1184356_1184623_+	DksA/TraR family C4-type zinc finger protein	A0A1S6UBD1	Serratia_phage	2.8e-16	47.7
WP_025766890.1\|1184692_1185973_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	2.8e-21	26.4

DBSCAN-SWA_3

1350688 : 1404565

Vibrio_phage(22.22%)

terminase,tail,capsid,portal,integrase,tRNA

attL 1359004:1359019|attR 1397981:1397996

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005395892.1\|1350688_1352617_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	5.7e-127	37.3
WP_080276913.1\|1352620_1353172_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.5e-13	35.1
WP_005377932.1\|1353292_1353487_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_004727974.1\|1353527_1353881_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_005377919.1\|1354070_1354388_+	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_005377917.1\|1354754_1355564_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005377915.1\|1355556_1355742_-	hypothetical protein	NA	NA	NA	NA
WP_005377913.1\|1356012_1356801_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_064353837.1\|1357051_1359430_+	MMPL family transporter	NA	NA	NA	NA
1359004:1359019	attL	NA	NA	NA	NA
WP_025766823.1\|1359448_1360240_+	outer membrane lipoprotein-sorting protein	NA	NA	NA	NA
WP_086046656.1\|1360250_1361426_+	hypothetical protein	NA	NA	NA	NA
WP_005385470.1\|1361617_1362601_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.3e-38	39.9
WP_086046657.1\|1362619_1365025_+\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	2.3e-08	26.5
WP_005377901.1\|1365239_1366121_-	AEC family transporter	NA	NA	NA	NA
WP_005377899.1\|1366655_1366952_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.7e-12	38.9
WP_054728703.1\|1367073_1367853_-	hypothetical protein	NA	NA	NA	NA
WP_021707633.1\|1368168_1368819_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_054728706.1\|1368891_1370067_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_005377892.1\|1370210_1371098_-	cytidine deaminase	NA	NA	NA	NA
WP_005377888.1\|1371529_1372207_-	LrgB family protein	NA	NA	NA	NA
WP_005397786.1\|1372208_1372583_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_086046658.1\|1372638_1374060_-	exodeoxyribonuclease I	NA	NA	NA	NA
WP_086046659.1\|1374240_1375458_+\|integrase	site-specific integrase	K7P7J2	Enterobacteria_phage	3.3e-104	47.6
WP_086046660.1\|1375580_1376108_+	hypothetical protein	NA	NA	NA	NA
WP_086046661.1\|1376110_1376668_+	hypothetical protein	NA	NA	NA	NA
WP_086046662.1\|1376815_1377571_+	hypothetical protein	NA	NA	NA	NA
WP_086046663.1\|1377644_1378301_+	hypothetical protein	NA	NA	NA	NA
WP_162497034.1\|1378386_1379283_+	hypothetical protein	NA	NA	NA	NA
WP_086046665.1\|1379422_1380127_+	DUF4393 domain-containing protein	NA	NA	NA	NA
WP_086046666.1\|1380198_1380504_-	hypothetical protein	NA	NA	NA	NA
WP_020333055.1\|1380544_1380703_-	hypothetical protein	NA	NA	NA	NA
WP_086046667.1\|1380800_1381043_-	hypothetical protein	NA	NA	NA	NA
WP_025766807.1\|1381197_1381470_-	hypothetical protein	NA	NA	NA	NA
WP_157664331.1\|1381669_1382866_+	hypothetical protein	NA	NA	NA	NA
WP_086046669.1\|1382880_1383567_-	hypothetical protein	D4HTY2	Vibrio_phage	6.7e-22	42.7
WP_086046670.1\|1383672_1383927_+	hypothetical protein	NA	NA	NA	NA
WP_053807278.1\|1383966_1384515_+	hypothetical protein	NA	NA	NA	NA
WP_086046671.1\|1385484_1386216_+	ATP-binding protein	A0A1W6JP39	Morganella_phage	5.8e-32	37.8
WP_086046672.1\|1386216_1386798_+	hypothetical protein	NA	NA	NA	NA
WP_086046673.1\|1387064_1388300_+	ATP-binding protein	NA	NA	NA	NA
WP_050450732.1\|1388292_1388811_+	hypothetical protein	NA	NA	NA	NA
WP_031812313.1\|1389041_1389806_+	hypothetical protein	NA	NA	NA	NA
WP_031812312.1\|1389965_1390253_+	hypothetical protein	NA	NA	NA	NA
WP_086046674.1\|1390218_1390677_+	hypothetical protein	A0A2I7R3H9	Vibrio_phage	5.7e-17	36.7
WP_025766795.1\|1390718_1390904_+	hypothetical protein	M4M9I7	Vibrio_phage	4.0e-06	48.2
WP_086046675.1\|1391231_1392446_+\|integrase	tyrosine-type recombinase/integrase	A0A067ZJC5	Vibrio_phage	8.4e-52	31.5
WP_025632836.1\|1392894_1393464_+	hypothetical protein	B0ZSE9	Halomonas_phage	1.8e-25	37.5
WP_086046676.1\|1393474_1395409_+\|terminase	terminase	A2I2W6	Vibrio_virus	4.9e-211	57.9
WP_025632833.1\|1395402_1395930_+	hypothetical protein	NA	NA	NA	NA
WP_086046677.1\|1395929_1397489_+\|portal	phage portal protein	A0A1W6JT60	Escherichia_phage	5.1e-118	44.0
WP_086046678.1\|1397454_1399428_+\|capsid	phage major capsid protein	A0A1W6JT82	Escherichia_phage	3.0e-163	49.5
1397981:1397996	attR	NA	NA	NA	NA
WP_025632827.1\|1399487_1399679_+	hypothetical protein	NA	NA	NA	NA
WP_025766788.1\|1399671_1399950_+	ATP-binding sugar transporter from pro-phage family protein	NA	NA	NA	NA
WP_086046679.1\|1399946_1400579_+\|tail	phage tail protein	K7PMB7	Enterobacterial_phage	4.1e-26	35.1
WP_025766786.1\|1400568_1401015_+\|tail	phage minor tail U family protein	NA	NA	NA	NA
WP_086046680.1\|1401017_1401515_+\|tail	phage tail protein	Q687F6	Enterobacteria_phage	9.7e-39	51.7
WP_086046681.1\|1401517_1401997_+	hypothetical protein	NA	NA	NA	NA
WP_025632816.1\|1402020_1402353_+\|tail	phage tail protein	NA	NA	NA	NA
WP_086046682.1\|1402333_1404565_+	hypothetical protein	A0A1Q1PW43	Pseudoalteromonas_phage	8.0e-32	25.5

DBSCAN-SWA_4

1939431 : 1982389

Shigella_phage(33.33%)

transposase,tRNA,integrase

attL 1938628:1938642|attR 1980981:1980995

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1938628:1938642	attL	NA	NA	NA	NA
WP_054728583.1\|1939431_1940073_-\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA
WP_053304370.1\|1940215_1940761_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_053306980.1\|1941014_1941578_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_054728586.1\|1941721_1942135_-	RDD family protein	NA	NA	NA	NA
WP_086046813.1\|1942276_1942885_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_054728589.1\|1943028_1943424_-	DUF2007 domain-containing protein	NA	NA	NA	NA
WP_080996164.1\|1943984_1944317_-	hypothetical protein	NA	NA	NA	NA
WP_053350306.1\|1944502_1945024_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_157664344.1\|1945791_1946202_-	hypothetical protein	NA	NA	NA	NA
WP_157664343.1\|1946228_1946633_-	hypothetical protein	NA	NA	NA	NA
WP_054730937.1\|1946613_1947465_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.4e-55	44.3
WP_086046816.1\|1947960_1948437_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_072014875.1\|1948464_1948575_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_005377035.1\|1948571_1949081_-	N-acetyltransferase	NA	NA	NA	NA
WP_017821432.1\|1949226_1949709_-	hypothetical protein	NA	NA	NA	NA
WP_054730711.1\|1949859_1950348_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_086046817.1\|1950386_1950512_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_054730714.1\|1950508_1950979_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_086046818.1\|1951028_1951121_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_005377013.1\|1951156_1951459_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_005377012.1\|1951446_1951704_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_054730719.1\|1951907_1952465_-	hypothetical protein	NA	NA	NA	NA
WP_054730722.1\|1952579_1952831_-	hypothetical protein	NA	NA	NA	NA
WP_157664342.1\|1952844_1953075_-	hypothetical protein	NA	NA	NA	NA
WP_080996693.1\|1953110_1953221_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_033907128.1\|1953236_1953653_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_080731349.1\|1953682_1953808_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_005448158.1\|1953800_1954148_-	nucleic acid-binding protein	NA	NA	NA	NA
WP_085570176.1\|1954175_1954286_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_054730730.1\|1954293_1954638_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_086046819.1\|1954762_1954888_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_054730732.1\|1954887_1955154_-	hypothetical protein	NA	NA	NA	NA
WP_054730736.1\|1955314_1955992_-	hypothetical protein	NA	NA	NA	NA
WP_054730937.1\|1956054_1956906_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.4e-55	44.3
WP_054730962.1\|1957401_1957878_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_086047140.1\|1957905_1957995_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_086046820.1\|1958470_1958818_-	DNA-binding protein	NA	NA	NA	NA
WP_086046821.1\|1958845_1958977_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_086047141.1\|1958961_1959585_-	hypothetical protein	NA	NA	NA	NA
WP_045397058.1\|1959773_1960262_-	hypothetical protein	NA	NA	NA	NA
WP_086046822.1\|1960556_1960757_-	hypothetical protein	NA	NA	NA	NA
WP_086046823.1\|1961153_1961246_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_054730841.1\|1961270_1962173_-	DUF2569 domain-containing protein	NA	NA	NA	NA
WP_086046824.1\|1962381_1962933_-	hypothetical protein	NA	NA	NA	NA
WP_054730801.1\|1963049_1963433_-	hypothetical protein	NA	NA	NA	NA
WP_054730804.1\|1963546_1964461_-	hypothetical protein	NA	NA	NA	NA
WP_086046825.1\|1965048_1965174_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_086046826.1\|1965164_1965791_-	hypothetical protein	NA	NA	NA	NA
WP_086047142.1\|1965828_1965954_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_050550131.1\|1966036_1967008_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.9e-47	36.9
WP_054730813.1\|1967037_1967526_-	hypothetical protein	NA	NA	NA	NA
WP_079765356.1\|1967553_1967643_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_086046827.1\|1967843_1969193_+\|integrase	tyrosine-type recombinase/integrase	Q5QF66	Pseudomonas_virus	3.5e-30	26.4
WP_086046828.1\|1969330_1970173_+	hypothetical protein	NA	NA	NA	NA
WP_086047143.1\|1970190_1970964_+	hypothetical protein	NA	NA	NA	NA
WP_086046829.1\|1971152_1972043_+\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJJ6	Virus_Rctr41k	6.2e-20	24.7
WP_159066466.1\|1974206_1975118_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.2e-19	34.7
WP_086047144.1\|1978218_1979946_-	transporter	NA	NA	NA	NA
WP_086046831.1\|1980020_1981415_-	glutamate decarboxylase	NA	NA	NA	NA
1980981:1980995	attR	NA	NA	NA	NA
WP_086046832.1\|1982197_1982389_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

2876278 : 2893452

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383801.1\|2876278_2878861_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.9e-79	38.1
WP_017633543.1\|2879003_2879471_-	recombination regulator RecX	NA	NA	NA	NA
WP_005380874.1\|2879598_2880642_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	61.0
WP_017633544.1\|2880842_2881325_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.8e-26	48.1
WP_086047036.1\|2881409_2883971_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-30	23.2
WP_005380887.1\|2884053_2885040_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_054730358.1\|2885120_2886044_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005380892.1\|2886057_2886684_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-37	54.5
WP_005380894.1\|2886683_2887460_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-66	49.4
WP_054730361.1\|2887459_2888503_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|2888548_2889025_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_017821625.1\|2889039_2889747_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	9.1e-06	23.6
WP_005380907.1\|2889748_2890030_-	cell division protein FtsB	NA	NA	NA	NA
WP_086047037.1\|2890431_2891733_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	7.0e-137	60.6
WP_021034029.1\|2891811_2893452_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.1e-154	52.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP017890

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP017889

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection