CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021109	Bordetella genomosp. 9 strain AU17164 chromosome, complete genome	17 crisprs	DEDDh,cas14j,cas3,DinG,csa3	5	10	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021109_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_1

231981-232089

Orphan

Consensus_repeat	Method
CGCGCGGATCCGGCTCCGCCGGTCCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_1

>merge|NZ_CP021109|1|231981-232089|CRISPRCasFinder
CGCGCGGATCCGGCTCCGCCGGTCCGCTGCGTCGCCCCCTTAAGGGGGAAGCGCGCAGCGCTTCGGGGGTGGGCCTTCCCCCCGCGCGGATCCGGCTCCGCCGGTCCGC

>NZ_CP021109|1|1|231981-232089|CRISPRCasFinder
CGCGCGGATCCGGCTCCGCCGGTCCGC	TGCGTCGCCCCCTTAAGGGGGAAGCGCGCAGCGCTTCGGGGGTGGGCCTTCCCCC
CGCGCGGATCCGGCTCCGCCGGTCCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086071233.1\|222271_223984_+\|hydantoinase-B/oxoprolinase-family-protein	unknown	unknown	gnl\|CDD\|376810
NZ_CP021109.1\|WP_086071239.1\|235854_236589_-\|BON-domain-containing-protein	unknown	unknown	gnl\|CDD\|182907
NZ_CP021109.1\|WP_086055838.1\|227688_228171_-\|YajQ-family-cyclic-di-GMP-binding-protein	unknown	unknown	gnl\|CDD\|213038
NZ_CP021109.1\|WP_086071232.1\|220221_222279_+\|hydantoinase/oxoprolinase-family-protein	unknown	unknown	gnl\|CDD\|223223
NZ_CP021109.1\|WP_086071237.1\|233203_234214_-\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226630
NZ_CP021109.1\|WP_086071238.1\|234370_235210_-\|NAD(+)-diphosphatase	unknown	unknown	gnl\|CDD\|234699
NZ_CP021109.1\|WP_086071236.1\|228831_229665_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|180446
NZ_CP021109.1\|WP_086059156.1\|229825_230737_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377694
NZ_CP021109.1\|WP_086055846.1\|235321_235816_-\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP021109.1\|WP_086071231.1\|219164_220148_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP021109.1\|WP_086055843.1\|232141_232975_-\|sulfate-ABC-transporter-permease-subunit-CysT	unknown	unknown	gnl\|CDD\|182873
NZ_CP021109.1\|WP_086071242.1\|239149_239785_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_CP021109.1\|WP_086071241.1\|238187_239153_+\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223390
NZ_CP021109.1\|WP_086071235.1\|228297_228810_+\|DUF2127-domain-containing-protein	unknown	unknown	gnl\|CDD\|378298
NZ_CP021109.1\|WP_086071240.1\|237612_238128_-\|YraN-family-protein	unknown	unknown	gnl\|CDD\|173148
NZ_CP021109.1\|WP_086055836.1\|224046_224376_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086071243.1\|239813_240959_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|236733
NZ_CP021109.1\|WP_086059157.1\|236585_237191_-\|phosphoheptose-isomerase	unknown	unknown	gnl\|CDD\|237567
NZ_CP021109.1\|WP_086071234.1\|224526_227508_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086055841.1\|230911_231739_-\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086071233.1\|222271_223984_+\|hydantoinase-B/oxoprolinase-family-protein	gnl\|CDD\|376810	pfam02538, Hydantoinase_B, Hydantoinase B/oxoprolinase. This family includes N-methylhydaintoinase B which converts hydantoin to N-carbamyl-amino acids, and 5-oxoprolinase EC:3.5.2.9 which catalyzes the formation of L-glutamate from 5-oxo-L-proline. These enzymes are part of the oxoprolinase family and are related to pfam01968.	0
NZ_CP021109.1\|WP_086071239.1\|235854_236589_-\|BON-domain-containing-protein	gnl\|CDD\|182907	PRK11023, PRK11023, divisome-associated lipoprotein YraP.	2.05105e-46
NZ_CP021109.1\|WP_086055838.1\|227688_228171_-\|YajQ-family-cyclic-di-GMP-binding-protein	gnl\|CDD\|213038	cd11740, YajQ_like, Proteins similar to Escherichia coli YajQ. In Pseudomonas syringae, YajQ functions as a host protein involved in the temporal control of bacteriophage Phi6 gene transcription. It has been shown to bind to the phage's major structural core protein P1, most likely activating transcription by acting indirectly on the RNA polymerase. YajQ may remain bound to the phage particles throughout the infection period. Earlier, YajQ was characterized as a putative nucleic acid-binding protein based on the similarity of its (ferredoxin-like) three-dimensional topology with that of RNP-like RNA-binding domains.	5.7115e-89
NZ_CP021109.1\|WP_086071232.1\|220221_222279_+\|hydantoinase/oxoprolinase-family-protein	gnl\|CDD\|223223	COG0145, HyuA, N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	0
NZ_CP021109.1\|WP_086071238.1\|234370_235210_-\|NAD(+)-diphosphatase	gnl\|CDD\|234699	PRK00241, nudC, NAD(+) diphosphatase.	2.6834e-87
NZ_CP021109.1\|WP_086071237.1\|233203_234214_-\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|226630	COG4150, CysP, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	4.36818e-163
NZ_CP021109.1\|WP_086059156.1\|229825_230737_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|377694	pfam06719, AraC_N, AraC-type transcriptional regulator N-terminus. This family represents the N-terminus of bacterial ARAC-type transcriptional regulators. In E. coli, these regulate the L-arabinose operon through sensing the presence of arabinose, and when the sugar is present, transmitting this information from the arabinose-binding domains to the protein's DNA-binding domains. This family might represent the N-terminal arm of the protein, which binds to the C-terminal DNA binding domains to hold them in a state where the protein prefers to loop and remain non-activating. All family members contain the pfam00165 domain.	3.08617e-51
NZ_CP021109.1\|WP_086071236.1\|228831_229665_-\|oxidoreductase	gnl\|CDD\|180446	PRK06180, PRK06180, short chain dehydrogenase; Provisional.	0
NZ_CP021109.1\|WP_086071231.1\|219164_220148_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.23981e-136
NZ_CP021109.1\|WP_086055843.1\|232141_232975_-\|sulfate-ABC-transporter-permease-subunit-CysT	gnl\|CDD\|182873	PRK10971, PRK10971, sulfate/thiosulfate ABC transporter permease CysT.	1.14101e-122
NZ_CP021109.1\|WP_086071242.1\|239149_239785_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	4.23508e-51
NZ_CP021109.1\|WP_086071241.1\|238187_239153_+\|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase	gnl\|CDD\|223390	COG0313, COG0313, Predicted methyltransferases [General function prediction only].	3.07604e-109
NZ_CP021109.1\|WP_086071235.1\|228297_228810_+\|DUF2127-domain-containing-protein	gnl\|CDD\|378298	pfam09900, DUF2127, Predicted membrane protein (DUF2127). This domain, found in various hypothetical prokaryotic and archaeal proteins, has no known function.	8.33813e-33
NZ_CP021109.1\|WP_086071240.1\|237612_238128_-\|YraN-family-protein	gnl\|CDD\|173148	PRK14685, PRK14685, hypothetical protein; Provisional.	3.75018e-32
NZ_CP021109.1\|WP_086071243.1\|239813_240959_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|236733	PRK10672, PRK10672, endolytic peptidoglycan transglycosylase RlpA.	1.10488e-55
NZ_CP021109.1\|WP_086059157.1\|236585_237191_-\|phosphoheptose-isomerase	gnl\|CDD\|237567	PRK13936, PRK13936, phosphoheptose isomerase; Provisional.	9.98199e-117
NZ_CP021109.1\|WP_086055846.1\|235321_235816_-\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.20503e-38
NZ_CP021109.1\|WP_086055841.1\|230911_231739_-\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	1.0531e-126

>NZ_CP021109.1|WP_086055841.1|230911_231739_-|sulfate-ABC-transporter-permease-subunit-CysW
MRKPRNWRQWALIAIGVTGAFMLLVLPLILIFQQALSAGWGAVADNLGDPEMQHAIWLTLLATALTVPINVAFGILLAWCVTRYDFRGKQVLTTLVDIPYATSPVVAGLCYLVVYGMESAVGGWLSQHDIQLMFAWPGIVMVTVFVTSPFVARILIPLMQAQGADEEYAALTLGANGWQIFRRITLPNIKWALLYGTVITNARAVGEFGAVSVVSGAIRGQTVTLPLLIEQLSEDYKTVAAFTAAALLACMALLTMVIKTLMELGHRITMRGPAH
>NZ_CP021109.1|WP_086059156.1|229825_230737_+|AraC-family-transcriptional-regulator
MVALLLALAPQEGYNLTALPDVRILRSDRPLSRTPVLYDPGIVIVCQGSKRGFFRDQVYRYDEQHYLAVAVPVPFVMETDASRQRPLLAIYMHLNFQLAAELAIQIDRHGHRGPAAEPRSMMSSPMDDALKSSVLRFLQVLSDPLEASVLGPALVRELYFRVLTGAQGGAMRSALAMQGQFGKIGKALRLIHAAYAEPLSLTQLAGEAGMSVPTFHAHFKAITGMPPMQYVKSARLHQARLLMLRQSMTAAAACHAVGYESASQFNREFKRLFGLPPAEEARRMRHSFALPPPQPGSPYISSH
>NZ_CP021109.1|WP_086071236.1|228831_229665_-|oxidoreductase
MSSTKTLFITGVSSGFGRALAQEALAAGHRVVGTVRNAQARQSFDALSPAHAFSRILDVTDFAAIEGVIADVETHIGPIDVLVNNAGYGHEGVMEESPLEEMRRQFDVNVFGAVAMMKAVLPYMRERRRGHILNITSMGGFITMPGIAYYCGSKFALEGISEALGKEVRHLGIAVTAVAPGSFRTDWAGRSMVRTPRSISDYDGLFDPIRQARAEKSGKQLGDPIKAARAMLAVIDSDAPPAHLVLGSDALGLIREKLASYAAEIDTWEALSRSTDG
>NZ_CP021109.1|WP_086071235.1|228297_228810_+|DUF2127-domain-containing-protein
MFATDPTARPVSPREASARQRAQRVIALFEALKGLGALAASIGLLSLLHHDLRHIVFVIIGHFGLDPGGHYPEELLRLAALLQDTSVRTLVALAAAYVTLRLAEAYGLWRDRAWGEWLGALSGAIYVPFELRHLLHAPSALSAAVVLANVLIVAFLAWQLVRRRAPRAAA
>NZ_CP021109.1|WP_086055838.1|227688_228171_-|YajQ-family-cyclic-di-GMP-binding-protein
MPSFDVVSEVDKHELSNAVDQANRELATRFDFKGTDARFELEDYVVTQTAPSAFQLKQMLDILRGRLTARGIDPRSMDPAEPVVNLGGARQKITLKQGIEQPVAKKLIAAIKDAKLKVETQINGNKLRVTGKKRDDLQTVIALLRKTDVDLPLQFENFRD
>NZ_CP021109.1|WP_086071234.1|224526_227508_-|hypothetical-protein
MQVSGHGNTPPGSPPAAARTPGGAGAPLLGASVNSPPRAALARRDELPSRNTRPRLLRFFSGGPRRAAARALRAQEKLQASLERFVDRQSMRRIDDLTPKEGARLLKAVCGDIRQFETRARASMAAGGAASPAGDACGGAPLPTLDAVLAQCLGRLDASQLHLLYDDLASQPDISRDLIRRQEKALRPVAADFLDTMEQALVRELATRGGRALLDTLLEAAAGAKADPHTLDEALDQLYGIGLSLTSPCRTPAHVLSLMLDSLTDDELGVLAAQAWPDASIGDAHRPPGLLKGAPPGERCEDDASSSAASGNSRLDEAGREIWRQALRAQLREREDRIAVQTVRGAGRNGGVGGGGGRAITLGRMMQDIRDIYAGIDARVHALAGRLPTVTELHMRLRYEVLAIMLHHLPLPQRRTSLLALPVSELSSLRTHLDVAPDMSPLRPTVGAALEAVCDEMLHAVHQRTEDALAAVYEAIAREDRPAAAFRLVALAEAVQALNESHAAMGTRAPATLSYSVGRAVELMRTLVCPSAGQTPLRALSDRELGYLRAAIAPLRPFGLIIDKAALKAEIAARATPPKGLGAAMDALLVDMMREDVTPQRVLARLRDIADMLARLGDRRVQCGDEMNADEVADLTYGLVTEALERLDRRDAGARVRVLCGLAGEPPVDDALQDAWAALQQYAGEQRRDGMARLVRPMVILGFAMRIAAFLRHACSSNGLGVARTGTAPTRTDARLPAAIAGEFGVAWDPAAQAAHPCLQAEHHAEFARRLAGPPDAEALRMLPVMLPLPDGEPSWFYVSAAFARDVVHGPGTSIAVDGVDARGRRVRYRGFDASLQGEARRDAVGGALHALRSLARDAAPALTALLNGGALHAFRQALEAEPGGPPLRRPDGTRALLGPGAMGAAHFLVQRLPEGSYRIETTLVYRDCAGKPAPAAAQPQDRTQALPSPAWVKATYALAATAAGVPDGLAAQVDIRYRFDEGPSPGTPPDGA
>NZ_CP021109.1|WP_086055836.1|224046_224376_-|hypothetical-protein
MKLTDIPFGTTDWSAIAPTEHAGTTGKAIWRTRHFGDIRVRMVEYTAGYLADHWCSKGHILLCLAGSLDTELEDGRRFTLRPGMSYQVADGAEAHRSSTPTGATLFIVD
>NZ_CP021109.1|WP_086071233.1|222271_223984_+|hydantoinase-B/oxoprolinase-family-protein
MAELSRTDDGLADPIGMEVFCNRLLSITEDMNNTLVRASFSTNIKERKDCSVALFDAAGRLVAQGTQIPLHLGSLDGAMRAILDRHAIETIEDGDVFICNDPYLANGSHLPDINIVTPVFWEGRLRFFAANIAHHSDVGGPVPGSIAGGLNSIFAEGIRIPVARLARAGKVDEDLLNLICANTRDPEERLLDLRVQMATNRRGAAAMQGLIRQMGLDAVLQSVEDVIRYTRRRLLNRISELKQGSYTFHSDLDDDGLGGDPVRIQVTLTVHPDRLHFDFAGSGPQARGAMNLPVNALRASVYYAVKALLDPDIAPNAGLFEPIEIDAPLGTITNPEHPAAVGARSITAQKVAGAIFGAFRGLLPPEKIMASGNDCCPAIVFSGKWATRPGQFVYLETLGGGAGARYDSDGMDAIHVHMTNTSNLPVEALENEYPLLMDEYAMIPDSGGPGRMRGGLSIAKQIRALGPGIVFSARSDSHTVGVATGVDGGMDGRRARLIRNYGTPKQQEMFSKTANIVLEPGESVRIETPGGGGYGAPAQRAPERLQRDLLDGKVSEAAAREHYGFVPERG
>NZ_CP021109.1|WP_086071232.1|220221_222279_+|hydantoinase/oxoprolinase-family-protein
MYRIGIDVGGTFTDFTMIDETAGVVHFHKVPSTPDDPSRAIASGIEGLLDMHGVDPSQVSHVGHGTTVATNLIIERKGAQVGLITTRGFRDVLEIGRQTRPHLYDYSVGKPPVAVPRQFRIEVAERVQATGEVREPLDEQAVREAARHFARHGISAVTICFLHSYRNPVHEQRARDIVAEEMLGAYISLSSEVLPEFREYERLSTTVLNAAVGPRMASYLERFLLRVRELGIAHEPHTVHSNGGLMSIASVRQFPVRTCLSGPAAGVVGAAAVGRVIGSPNLVTFDVGGTSTDVSLICDGKPLFTSHRHVAGYPVKTPMVDIHVIGAGGGSIAWMDDAGALKVGPHSAGAVPGPVGYGRGGVEPTITDAEIVLQRLNPVSLLSGRMPVYAEQARQVIQEKVARPLNLGIEAAAEGILRIATANMSRAIRAVSTERGYDLSEFALFAFGGAGPLHAVEVAEECGIPRVIVPQEPGTMCARGILLSDISFDFVRSEIALATPQNWTRVAAIFESLRRQADEWLASEGVATGLRAAHCAIDARYEGQNFEVQVPLDDTAESGFQAFLDRFAQAHMREYGYDVDDRAIQIINCRVQATGQVIKAPLSPRKVEGTMAQARIGQRDAYFGATNGWLETPVYDRGRLPTGVAFQGPALVEEMSSTTVIGVGHSAVVDDYGNLIITLQGNANG
>NZ_CP021109.1|WP_086071231.1|219164_220148_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKARMLRRACGVLAGVALALSGTAASAAWPNDKIIRMVVPFAAGGSTDLIARKLAEGLGKTLGANVIVENRPGAGGTVGTDYVARQPADGYTILMGSVSTHGSAPCIYQHLPYDANKDFTPLAVVATIPNVIVLNKEVPAKDVQSFVKLAKQDPGRYTYASNGPGTSNHLASAFFTSVAGISMTHVPYRGSGPALIDLLGGQVNMMMDVIMTSYPYIKEGKLHALAVTSAQRSPMLPDVPTVAESGYPGFEAIVWFGMFAPANLPAPIADRLAKAIVDVQNGPEMKRYLESTGSQVSSVTGQAFAAMIKDDNAKWCKVVQQAKIRLD
>NZ_CP021109.1|WP_086055843.1|232141_232975_-|sulfate-ABC-transporter-permease-subunit-CysT
MPTFFKQNPTLPGFGLSFGVSSLFISLVILFPIAALLAYTSEMSAAQYWQAITDPRVVASYRVTLLGAAISTIVVVLFGLLLAWILVRYRFPGRLLLDSLVDLPFALPTAVAGLTLSVLLGPNGWIGQWFDQAGIKISYAFPGLVSAMIFTSLPFVVRSVQPVLEEIGPEYEEAAHTLGATDWQTTWRVLLPSLTPALFTGGSQAFIRSLGEFGAVVMIAGNIPFKTEITSLMIFVRVSEFDYAAASAIATVVLGASLLLLFGLHVLQGRLLPWGKA
>NZ_CP021109.1|WP_086071237.1|233203_234214_-|sulfate-ABC-transporter-substrate-binding-protein
MIKRLLATSLAATLMLGADAASAQQNLLNSSYDVARELFTAINPQFVEYWKQKTGETVNIEQSFGGTSRQAQAIIQGLKADTVTFNQVPDVDILAKRGLLAKDWQKRFPDNSSPYYSTIAFLVRKGNPKHIQGWDDLVRDDVKVVFPNPKTSGNARYTYLAAWLYAQKKFNGDEAKTRAFVGKLLHNVESFPTGGRGATVAFAQNNQGDAVLTFESEVRNIAASEEFKPLGLEVVVPKTSVLAEFPVAVVDKVVDAKGTRKLAEAYLQYQYSPEIQKLLASYNYRVRDPEVVKANANRFPQVELLDPQQLLGGWDKIQDTHFKGGGVLDQLLAGKS
>NZ_CP021109.1|WP_086071238.1|234370_235210_-|NAD(+)-diphosphatase
MADSTASSSSGIADAIVPPHGRVFAFRGSELLVREDGLSLPGDEVRGRIAEAVQWQSIGDYLGQPCVAAALKRDAAAPAGYVFKRLREMLNVLGEEGAGVASRAFQIAEWARTHRFCGACGTATVRVPEEYCMKCPRCGLSAYPRISPAMMVLVRWGDRILLARNASFVTGRYSALAGFVEAGESLEATVHREVYEEVGLRVRDLKYFRSQSWPFPHSLMLAFTAEYDGGDIRVDGQEIVDARWFGPDDDLPDIPPMDSIAGHLIRANLPQGKRPRGDR
>NZ_CP021109.1|WP_086055846.1|235321_235816_-|TlpA-family-protein-disulfide-reductase
MKKLLIAMVVAIAAGIAGWFVWRPVQAAPDVTFASIDGRKISMQDLRGKVVLVKFWATDCVTCIKQMPDTIADYNRYAPQGFQTVAVAMQYDPPNYVLNYAQTRKLPFTVALDTQGKAAQAFGDVRLTPTAFLIDKQGRIIKRYLGDYDPKAFHAEIEKALAAG
>NZ_CP021109.1|WP_086071239.1|235854_236589_-|BON-domain-containing-protein
MTLKTRMLAIPLAIALGASALSGCAPLVVGGAAAGAAVVVTDRRTSGTQVEDQNISFKVERNMSQKFGDTARVNASTYEGVVLLTGEVPNEAAKTQATSLAQGVENVKRVVNQLTVGPVASFTARSNDTWLGSKVRTELLNTKFVPSGTISITTDKGVVYLQGKVTQAEGDYAANAAAGVSGVTKVVKLFDIISREEALRLSGTNSSGTSAPASGATKPAPIETGGGSDSGSAPTGGAEAIPIK
>NZ_CP021109.1|WP_086059157.1|236585_237191_-|phosphoheptose-isomerase
MRAMTDMTTRMVSHFNDATATLQAARDVLAEPLAVAVELLFGALANNAKILACGNGGSAADAQHFVAELVGRFERERLPLAAVALNTDTAILTAVGNDYGYDEVFERQVNALGQPGDALLAISTSGNSPNVVRAVQAAQARDMHVIALTGKGGGVIGELMTPHDVHLCVPSDRTMRVQEAHIVLLHALCDGIDALLLGDPE
>NZ_CP021109.1|WP_086071240.1|237612_238128_-|YraN-family-protein
MPDDPSALPFEVARHAQAKRLRRRRRNRRGDDASPLPDAVADADQTLPAQSASQRRGGGYEDRALALLVRAGLQPLGRNLRCRAGEIDLALRDGWTLVLVEVRARRDDRFGGAAASVGHAKQARLIRAAHVLAPRLIARFWAGRPAAVRFDVVAFEGETPFWLRHAFSLER
>NZ_CP021109.1|WP_086071241.1|238187_239153_+|16S-rRNA-(cytidine(1402)-2'-O)-methyltransferase
MNENVPVPAAIDSGADARAPGGDAWRRVAERVAAQQWPAATLYVVATPIGNLGDLGLRAWQALARADVIAAEDTRESRTLLDAWGVATPLMAAHRHNEAAAAQAICERLARGERVALISDAGAPAVSDPGARIVREVRQAGYAVVPVPGPSAVIAALMASGVTSDENPAYVFAGFPPPKSAARQRWLAQWCALPAPVVMYESPHRLAATLADLAQVCGPARDVTIARELTKRFEEVATVPAGEAADWLQAQPHRGQGEFVVIAHPAPPAAADAQAADPATDALLDALLESVSVRDAARIAARVSGLPRDVLYARALARKPA
>NZ_CP021109.1|WP_086071242.1|239149_239785_+|methylated-DNA--[protein]-cysteine-S-methyltransferase
MIARGSRHPNGTGTAGPCVRVVDTPLGAMRLQAEGGALTGAWFLDQRDCPAMPEPAAEASPSPDAGGRDSRSAEDAVLDQAVRELAEYFAGRLRAFSLPMAPQGTPFQRRVWDALRDLDFGVLESYGALAQRCATPAAVRAVAQAVGRNPISIFIPCHRVVGADSALTGFGGGLHRKQALLALEGHAYASPVRQARRAQQDPRQGSLWDSP
>NZ_CP021109.1|WP_086071243.1|239813_240959_-|septal-ring-lytic-transglycosylase-RlpA-family-protein
MTFRHLRNLLLIALLAAVVAGCSSTGGRKRGGYYKDDGPGSNPPSNLDAIPDAEPRIEPLASGANRPYVVFGKRYVPDTSDRPFTQRGIASWYGKKFHGNATSIGEPYDMYAMTAAHPTMPIPSYARVTSAINGRTVIVRVNDRGPFHDNRIMDLSYAAAYKLGIIGPGSGEVTVQRILPDEIRRMVAQRNSGQATASSAGSAAASPVAAAVSAAPAPVSFTTAESGTPQALPIASSSEANARQAALNGFPTADGGAPSGPTPLPPPPQAQSLPAASPVAEASATATPLPQAAASRAMPAATGNGSVYLQLGAFSQPANAQSLAARVNGQLGAVGLPPATVEQSGQLYRVRVGPYADRNAAMSAVQTVADRTGILPSIATH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_2

385409-385602

Orphan

Consensus_repeat	Method
TGGCCGCCGGACATCGTGAAGTTGTC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP021109_2

>merge|NZ_CP021109|2|385409-385602|CRISPRCasFinder
CGGCCGCCTGTCATCGTGGCGAAGTCGCCGTTGGAAAACACGTCGACGATATGGCCGCCGGACATCGTGAAGTTGTCAAGCGCACCGCCCTGATCCAGCGAATCGATCTGGCCGCCCGACATCGTGAAGTTGTCGACCCCGTCGGCGGTACGAATGGCGCCGCGCACGGTGCCCCCGCGCATGTCGAAGTTGTC

>NZ_CP021109|2|2|385409-385602|CRISPRCasFinder
CGGCCGCCTGTCATCGTGGCGAAGTC	GCCGTTGGAAAACACGTCGACGATA
TGGCCGCCGGACATCGTGAAGTTGTC	AAGCGCACCGCCCTGATCCAGCGAATCGATC
TGGCCGCCCGACATCGTGAAGTTGTC	GACCCCGTCGGCGGTACGAATGGCGCCGCGCACG
GTGCCCCCGCGCATGTCGAAGTTGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086071311.1\|379545_381075_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP021109.1\|WP_086071319.1\|393600_394857_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369349
NZ_CP021109.1\|WP_086071310.1\|378969_379380_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086071320.1\|394992_396186_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
NZ_CP021109.1\|WP_086071309.1\|378306_378825_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_157664912.1\|371085_371856_-\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|372611
NZ_CP021109.1\|WP_086071307.1\|375180_376599_-\|TIGR03752-family-integrating-conjugative-element-protein	unknown	unknown	gnl\|CDD\|274765
NZ_CP021109.1\|WP_157664775.1\|391258_392299_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|366703
NZ_CP021109.1\|WP_086071306.1\|374768_375200_-\|TIGR03751-family-conjugal-transfer-lipoprotein	unknown	unknown	gnl\|CDD\|274764
NZ_CP021109.1\|WP_086071308.1\|376745_377690_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224144
NZ_CP021109.1\|WP_086071315.1\|387032_387449_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086071312.1\|381428_382004_-\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|379205
NZ_CP021109.1\|WP_086073469.1\|398309_399656_+\|chitin-binding-protein	unknown	unknown	gnl\|CDD\|237309
NZ_CP021109.1\|WP_157664776.1\|392346_393330_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|366154
NZ_CP021109.1\|WP_086071313.1\|382000_382468_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|200128
NZ_CP021109.1\|WP_086071305.1\|371889_374769_-\|conjugative-transfer-ATPase	unknown	unknown	gnl\|CDD\|274761
NZ_CP021109.1\|WP_086071316.1\|387694_390208_-\|response-regulator	unknown	unknown	gnl\|CDD\|274362
NZ_CP021109.1\|WP_112189128.1\|385884_387008_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|372671
NZ_CP021109.1\|WP_086073468.1\|390204_390909_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP021109.1\|WP_086071321.1\|396804_398244_+\|chitinase	unknown	unknown	gnl\|CDD\|226000

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086071311.1\|379545_381075_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	4.62811e-57
NZ_CP021109.1\|WP_086071319.1\|393600_394857_+\|hypothetical-protein	gnl\|CDD\|369349	pfam07399, Na_H_antiport_3, Putative Na+/H+ antiporter. This family consists of several hypothetical bacterial proteins of around 440 residues in length. The function of this family is unknown. Many members carry 11 or 12 transmembrane regions, suggesting that they might be transporters. One family member, UniProtKB:Q821X2 is classified by TCDB as being an NhaE type of Na+/H+ antiporter.	0
NZ_CP021109.1\|WP_086071320.1\|394992_396186_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	3.72624e-165
NZ_CP021109.1\|WP_157664912.1\|371085_371856_-\|thioredoxin-domain-containing-protein	gnl\|CDD\|372611	pfam13462, Thioredoxin_4, Thioredoxin.	1.47213e-14
NZ_CP021109.1\|WP_086071307.1\|375180_376599_-\|TIGR03752-family-integrating-conjugative-element-protein	gnl\|CDD\|274765	TIGR03752, conj_TIGR03752, integrating conjugative element protein, PFL_4705 family. Members of this protein family are found occasionally on plasmids such as the Pseudomonas putida toluene catabolic TOL plasmid pWWO_p085. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition. [Mobile and extrachromosomal element functions, Plasmid functions].	0
NZ_CP021109.1\|WP_157664775.1\|391258_392299_+\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	3.63052e-44
NZ_CP021109.1\|WP_086071306.1\|374768_375200_-\|TIGR03751-family-conjugal-transfer-lipoprotein	gnl\|CDD\|274764	TIGR03751, conj_TIGR03751, conjugative transfer region lipoprotein, TIGR03751 family. Members of this protein family are found occasionally on plasmids. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition. [Mobile and extrachromosomal element functions, Plasmid functions].	1.18381e-62
NZ_CP021109.1\|WP_086071308.1\|376745_377690_+\|AAA-family-ATPase	gnl\|CDD\|224144	COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only].	7.27441e-34
NZ_CP021109.1\|WP_086071312.1\|381428_382004_-\|PIN-domain-containing-protein	gnl\|CDD\|379205	pfam13470, PIN_3, PIN domain. Members of this family of bacterial domains are predicted to be RNases (from similarities to 5'-exonucleases).	4.72303e-12
NZ_CP021109.1\|WP_086073469.1\|398309_399656_+\|chitin-binding-protein	gnl\|CDD\|237309	PRK13211, PRK13211, N-acetylglucosamine-binding protein GbpA.	9.39832e-46
NZ_CP021109.1\|WP_157664776.1\|392346_393330_+\|glycosyltransferase	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	7.08418e-12
NZ_CP021109.1\|WP_086071313.1\|382000_382468_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|200128	TIGR01764, Probable_excisionase, DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376). [Unknown function, General].	1.97665e-15
NZ_CP021109.1\|WP_086071305.1\|371889_374769_-\|conjugative-transfer-ATPase	gnl\|CDD\|274761	TIGR03744, traC_PFL_4706, conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves. [Mobile and extrachromosomal element functions, Plasmid functions].	0
NZ_CP021109.1\|WP_086071316.1\|387694_390208_-\|response-regulator	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	7.13852e-80
NZ_CP021109.1\|WP_112189128.1\|385884_387008_-\|IS3-family-transposase	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	3.41481e-35
NZ_CP021109.1\|WP_086073468.1\|390204_390909_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.40508e-43
NZ_CP021109.1\|WP_086071321.1\|396804_398244_+\|chitinase	gnl\|CDD\|226000	COG3469, COG3469, Chitinase [Carbohydrate transport and metabolism].	1.01362e-155

>NZ_CP021109.1|WP_086071313.1|382000_382468_-|helix-turn-helix-domain-containing-protein
MTNTAQSKMTLPAEGEVKAAVQGQRALAAYLATQFETQHIQIFDDQKQAHEVELPTSALRLLVDILAELADGNAVKVVPVHAELTTQEAADLLNVSRPHFVRLLEDGVLPFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
>NZ_CP021109.1|WP_086071312.1|381428_382004_-|PIN-domain-containing-protein
MRHSSFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSRAIHDEWKRNLLTNRPDLTQAQVDRTSDLMDRAIPDALVEGYEALVAGLALPDPDDRHVLAAAIRCGASVIVTFNQRDFPTEMLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLREPAIDVDRYLDILLRQGLVQTTRTLATYRTIL
>NZ_CP021109.1|WP_086071311.1|379545_381075_+|GGDEF-domain-containing-protein
MTRHLLGQSRRFDMAGLVFGGAVTLALLISLLGAAALYQMRRDILASNKEAGANLALTLERSISRTLQVHDLAIAGVVTSLQDPAVMSLPPILRQRALFDVAINAEDMGSLFASDAQGNVQLDSQQWPPRSLNVADRDYFQAHHRDPEAGLYVSRPFQGRLQPSDTFLALSRRLVSPDGSFAGVVSGSLRLSYFRKLFNGVSLGGGGTITLVRTDGTIVMRRPYDDAVIGRDMSNSAVFPPILRGSHGTFVGTTPIDGVRRLYSYHRTPQFPLVVVVGRAMTDVLAPWYRRVWTFGGIIAAVDVFIIALAAMLARQWRRRQAIEDHLRHMVATDGLTGLGSRRALDDVTDREWRRAHREKQPLSLLMIDVDHFKQFNDLYGHMAGDDALAAVGRCIQQHIRRPGDYAGRYGGEEFAVLLPGTDAAGAALIAEHIRQAVERLHLAHAGSPLGSLTVSIGTVTDGADWNGGRHFPDVRAFLRAGDEALYQAKRAGRNRTVGSGVHAPAIPA
>NZ_CP021109.1|WP_086071310.1|378969_379380_+|hypothetical-protein
MQLSVAQAAYLANACAADDPLSVLRVLGLDVSTLQTLPPRPWADMAARTCSVSYRGRLPTDVLRAMLLRGETWDPWCPHLAYLLDEAPLSLLVLALEETSRYHDVPIKCLWRNLARLVVSCQSRRLADWPALVNAG
>NZ_CP021109.1|WP_086071309.1|378306_378825_+|hypothetical-protein
MKIPVDRLMEEHRTFEYSLTNMPIRVMVSHYIAFCRDKRKRPEFFCWPGIWMAASKATAEHRSLFLAHLSLFQDREDTNKIFPRAMPGKSPDNLRRLVNGFYSSMLVFDLARQWVVAPGPFRYDFSWLTGESDNAELVTSAKRQFVQFYGVDPDSFDLIDGVNVQTVDKSDG
>NZ_CP021109.1|WP_086071308.1|376745_377690_+|AAA-family-ATPase
MKPDASGFRAASEAVIKEEREKNHHLLANDLERLLYGDQANFGKNARKLQSLPSVPTNKDNGLALLEERAVIREEKDIILSDASQSALDEILMEHNRADVLRSYGLQPAQKLLFCGPPGCGKTLAAEVIAHSLSMPLVLVRLDSIISSFLGETAANLRKVFDYVATHPVVALFDEFDALTKDRGDSADHGELKRSVNAVLQMMDGYRGESILIATTNYETLLDKAVWRRFDEVVRFEMPNLEQIKRLLALKLSGVRRNFEPDDGQVASVFKGMSHADIERVLRRAVKEMILSGREFLEKSHIDNALAREYRYKS
>NZ_CP021109.1|WP_086071307.1|375180_376599_-|TIGR03752-family-integrating-conjugative-element-protein
MRSNPLLKWLLIPMALLLVFVGARLFSGSDAAPGKQDVSGQLTPEEMKALGIAGDTPRDTIATLVAQVKQLRTELQTALSDNRQHKAENERLRTREGAIDQRIQNALDSERRRLEQERTQAASDRQQTQGLMQELQRRLDGLSGKGDAADLPIGLGLDGHDGGPLTDGGMRWIEPADARPDPKGGSSSLRLPAFPSSFGPASPELSAAAEAVGDRTAQAVGGTTQAVYTVPTNATLMGSVAMTALIGRIPIDGTVNDPFPFKVLIGADNLAANGIEIPDVAGAVVSGTASGDWTLSCVRGQVRSITFVFTDGTIRTVPEDDGKRNQSQNSTSLLDGLGWISDPYGIPCVSGERRSNAQQYLGSQALITAAGAGAASLIKSDNGSVAVVASNNGSLGTVGISGNEAMGRILAGGVRDMADWVNKLYGQAFAAVYVQPGARVAVHLEQPIAIDHDAKGRRVNHLMGEVHAPDLD
>NZ_CP021109.1|WP_086071306.1|374768_375200_-|TIGR03751-family-conjugal-transfer-lipoprotein
MRRTWIDRPLVLLAAAVLAGCATSSEKLLPRGEHTMLDIWQHETGGYSGGQAGRLLLDARQDLRRPLTDAGTLAAPARNAAYTRTAANEIQRQFHRLPNPDLVMYVFPHLAGTDPVPVPGYSTVFPLYQRVQYAMPGERLEDY
>NZ_CP021109.1|WP_086071305.1|371889_374769_-|conjugative-transfer-ATPase
MGWRLPWPRRPAPRPVQADIEPDAWTRHVDRLAAHGIDAPGAALGSNHRRPATRADHAALYDVAPSFADLLPWVEYLPATRCMLLEDGQSVAAFFELQPIGTEGRETAWLWQARDALENALQDSFDELDENPWVVQLYAQDEADWDHYLRTLGAYLHPRAQGSAFSEFYLRFFGHHLRAIAKPGGLFEDTTVTRLPWRGQTRRVRMVVYRRTPDATSVRRGQSPEQALATICDRLVGGLANAGVKARRLGAADIHDWLLRWFNPNPGALGSTAEDRERFYALARYPEDREEGEIELASGDFAQRLFFGQPRSDVARGLWFFDGMPHRAIVMDRLRSPPATGHVTGETRKGGDAMNALFDQMPEDTVMCLTLVATPQDVLEAHLNHLARKAVGETLASEQARQDVQQARGLIGSAHKLYRGTLAFYLRGRDMAQLDARGLQLVNVMLNAGLQPVREEDEVAPLNTYLRWLPCLFDPAADKRQWYTQLMFAQHAANLGPVWGRSQGTGHPGITFFNRGGGTITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNILNQVTAIYRPRLFIVEAGNSFGLFGDFAARLGLSVHRVKLAPGAGVSLAPFADAWRLVDTPGQVQTLDADALDEDGDTHPADDGDDQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAQRCVEQARTVLTRDVRDALRERARDANLPDARRARLLEMADAMDMLCQGADGEMFDRPGTPWPEADITIVDLATFAREGYNAQLSIAYISLINTVNNIAERDQFLGRPIINVTDEGHIITRNPLLAPYVVKITKMWRKLGAWYWLATQNIDDLPKAAEPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFSEGVILSKSMEVLFRAVPPSLYLALAQTEPEEKAERYQLMRQYGIGELDAAFKVAEKIDQARGIASPPLSLPK
>NZ_CP021109.1|WP_157664912.1|371085_371856_-|thioredoxin-domain-containing-protein
MPSRSQALRKRAGRLPRLPWVVAGILVAGLLGWLLYRTPGAPTPRTEPEVAQAHPAGPPWRHGPADARFTLTLYADLECPFCKAYYPTLVAWIDAHPEASLRWHHLPLAMHDPEASRLARVAECAGEAQGHEAFFGAIAWLYQNTRGDGQGLPTDQAWPGLTTAIQACLDSDRSAAIVRAQADEALRSGINATPTVRLEDSLTGGSLLLHGPIDGDALLSALDLVASDASRAPGPTHAADAALSGDTRTPAMTTIR
>NZ_CP021109.1|WP_112189128.1|385884_387008_-|IS3-family-transposase
MKKRFTEEQIIGVLKEAEAGLKPAELCRKHGISEATYYNWKAKFGGMTVSEAQRLKELEQENNKLKRLLAESMLDNAALKDLLSRKLASPQAKREAVQVLMTERAMGVTRACGLVGISRSLFHYESRRRVDDEALTGRMMAIAAQKRRYGYRRIHVLLQREGWLANHKRIWRLYSKAGLSVRKRRRKRIAAVERKPLSLPTGPNQSWSMDFVSDGLAYGRRFRCLNVVDDYTRECLVIEVDTSLPGLRVKQVLERLKEMRGLPASITVDNGPEFAGKVLDAWAYEAGVTLSFIRPGKPVENAYIESFNGRFRDECLNEHWFVSMRHARQLIEEWRIEYNTERPHSSLGYLTPAQFAQGHEQKEFLTSDSTCASY
>NZ_CP021109.1|WP_086071315.1|387032_387449_-|hypothetical-protein
MKLRRIAAAIRVLCRPQSLTPVLCLLSIARPEAALATCDIFNPATGQTVTCGTGAPNPATTPLAAAPASTDVTVNVLPSAGIAVGDTTAVAVNAQSRVTNQGSISSTGAASIGVSLGADSTLTNAAGDLLPAISTLTM
>NZ_CP021109.1|WP_086071316.1|387694_390208_-|response-regulator
MTLVAASSRDPGSCSHYLILAVFLSFCLALMPSRSAAQSQALFSPEEMAWIKANPVVRTAVDPNFRPVEYMDDGVHKGLSAGYLEAISRLTGLKFEPVPGMAWGKARAALEAHQVDLLPAVSYEHSPRNLDNRILVTSPYFVAATIVVTRERGPVVFDARRLAGQTVATKGGGAFESALRTGYPEIKVLPLASAEAVLAAVLDGTADAAIGTDLMLLPTMRRMYFGQLHVSGTLAELPVQLSMGVRRDLPLLASIVDKSLNALTAKQTDVIVDRWIEGADYGEPTMRAVLQYYAPHALALAAIVLAIALLAGFAWRAKLAANRSERAKAMFLAVMGHEIRTPMQTILSSVELLRRTRLDAEQSKLTTSAVTASEALLSLLDDVLQFSKLEAGKVTPEMVATPIWTWATQSVDMLRRRAEDKGLHLTLALKCPPELQLKIDPTRLRQVLLNLLSNAIKFTERGAITVSVIYQAGKLQPGKRAATMNRRGTLTLEVHDTGIGMTPAQLRRVFEPFEQADQSTTRRFGGTGLGLAICKELVTLMGGTIGVRSEPNVQTVFTVTVPVEVCDRVRLTEGTAPASQADLTTAEEATNPVADSLAPDSLIERARILVVDDHEAVRDSIGRQLQTLGCRATMAASASEALALFDPTQFDMVLLDCNLPDLDGYTLAERIRLKETKQGGHTPIIAISALSDAEHQERCFASGMDGVLSKPVRMRQLAQMMEMWCDLDLGEEFEMPAPEPFQRDGDSLHALFQQTMRDDVRMLRHCIRESDWRETARQAHRIKGAALTVAMGEIADAAELIESLARGLARGDASRADTERLKELLGTLERASSNLPS
>NZ_CP021109.1|WP_086073468.1|390204_390909_-|response-regulator-transcription-factor
MTLSAETAIGVVILDDHPVVRSGYEHQLAGCPDIRLLGSFSSGKALLDWLRKQAAENFPSRTVLVLDYELGPDEVDGLSLIQSLHARYPQFRLLIGSSHAGEATVQLTRRVGALGFYDKRKDLSELANAIRTVAAGKPYPSPEAGERPAVVQPVVEPIGDTDEGERLQAYFPQLTKKEHEVLRCYLQGMTVSEIAAKLQRSIKTVSTQKQSAFRKLGVHSDMELARLRQEIGKI
>NZ_CP021109.1|WP_157664775.1|391258_392299_+|peptidoglycan-DD-metalloendopeptidase-family-protein
MRNKTNSRVLARIRAWRSAACIAVLLTAFAGGAVLHHVGSKVGASAPELSPLLPVEELPEWSDESVPFGEDERLHIKSGLITGGIAASLARARVPQSAINQALALASTRAPDGAEMLRFKIAYAVREYAVEEVTPRLVALQIGDGEASIAAVRYPLRGDGEPTYYDFHGNPWGPTSFAWPVARSRASSPFGGRIHPVLGVAKFHRGVDLAAPQGTPVMASAPGTVTFVGNVRGYGNLVALRHANGLESYYAHLHAIASTVGVGTRVAQRDVIGTVGATGTATGPHLHFEIRQHGRPLDPITLMPSRPRSDPDFSRDLRKVRAHFAPEGVAMHRFVRLYSQDTSRRI
>NZ_CP021109.1|WP_157664776.1|392346_393330_+|glycosyltransferase
MPIASILIPAVKPTYLERAIRSALLQSLRDIEILVGDDTPDGSLAHVVERFHDSRLRYFHHGHQNAKQNAAALWRRANSPYVKWLHDDDVLLPLSVEVLVEALRAHPDSRLAFHGRVFIDDTGAVCWCPGSPIADGDTVAITRAELSRSLVGRLYNWVGELSNVMLTRDRDEAAYLFDYRGWPIDCLQDVAMYLNAAEDAPIIGVGGVYGAYRQHDGQMSNYASPYFPAILYEWELMVRGEAASKGLSRKRLVEAKERLIAHYRLHARLYPEIAPLMHGADEIDRLPAAQLLQSTRFAENLLSARTAIQARIAQACGRDSNLSRQYA
>NZ_CP021109.1|WP_086071319.1|393600_394857_+|hypothetical-protein
MNQAVGFIGAAIFALALLHTVFAHRVDALGTRYPRHAGLFHLLGEVEVVFAVWALILAIAMTALIGPAPTIAYLESRQFVEPLFVFAIMVIAASRPILDGVSGLVFALARLLPVRRETAVVWLSLTAIPLLGSFITEPAAMTLAAMILRDRLFTTDVGARWKYLALGVLFVNISIGGTLTAYAAPPVLMVAAAWGWDSWFMLTQFGWKAAIAVMINATALSWLIGPRLSTARRETSAGAADRVPFAVTLIHLGFLCLVVATAHHPAVFLSLLLFFLGFVHAYRRYQSPLILKESLLVTVFLGGLVVLGGLQQWWLQPLVASMNSLGLYAGALGLTAVMDNAAITYLGSLIVGIEDPAKYMLVAGAVAGGGLTVIANAPNPAGVAIVRAGFDNGAVRLGQLLLAALPPTAVATGAFLAL
>NZ_CP021109.1|WP_086071320.1|394992_396186_+|sodium/glutamate-symporter
MLQLDIYETLVAAALVLLAGRLLVAKLSFLRAFNIPEPVAGGLVIAAILAIARAGADVSVQFDTSMQTPFMLAFFATLGLSADLNNLRKGGKVIFVFLAVVVGLLVLQNVIGVGIATALGLNPYIGILAGSVTLSGGHGTGVAWGETFQNQYHVALAPELAIACATFGLVLGGLIGGPVARHLLRKVTVPSTDKTDSEPMHFEHPQAVRLITAPSLVETLALILVCLSAGHALSATFSTTALALPTFVWTLFVGVLLRNVLAALKYDVFDRALAVLGNVSLSMFLAMALMSLRLWELSSLALPVLLILVAQTVAMAAFAVFVTFRVMGRNYDAAVLAAGHCGFGLGATPTAIANMQAVTDRFGPSHLAFLIVPMVGAFFIDIANAVVIKLFLSLSLT
>NZ_CP021109.1|WP_086071321.1|396804_398244_+|chitinase
MLDPRVIQQYKNSIRDAASPMPDISGKTILVGFWHNWPAQPGQGYQQGRFAEMALTDIPPQYNVVAVAFMKGSGIPTFRPYNVTDSEFRRQIGILNSQDRAVLISLGGADAHIELHSGQEEALAYKIIELVETYGFDGLDIDLEQQAIAAAENRTVIPAALRMVREHYAKEGKHFIISMAPEFPHLRITKDYVPYIKALEDLYDFIAPQYYNQGGDGVWVDHLNKFVTQENDALKEEFLYHLTDCLIHGTQDFTPIPANRLAIGLPSNVDAAGNGYVIDPQHVVNALTRLKNAGNPIRGLMTWSVNWDNGQNRSGTPYNWEFVTRYGFVSSGEDGGGERPSAPANLTSPAHSETGIDLRWDPSTGEYPIQFYSVYRDGRIIGRSQTTRYADEGLSPGSEYRYFVTATDSKGNVSPNSATLTTSTLPGAAPQWREDQWYDRGAIVAFAGSQYTCVQEHTSNQYWKPSLATMLWQKLARGR
>NZ_CP021109.1|WP_086073469.1|398309_399656_+|chitin-binding-protein
MTTIRRNIPRHGHVFSPESRAVFAYLNGDLVENDQNSLEAGKFFPATEGNLTDPIAPTDIKNNPPPADGQIASAGWPYARLLDEPGTHWRKHKVRAGQPLTVSWNYSAAHVTRRWVYFMTKRGWDPQQKLTRASFEDKPFFTVELRAQPYWEHTDALWPPSPTVHDVVLPNREGYHVMLAIWEVANTGAAFYQVIDLDFEASGGGGERPNPPSQVQAEVVASTAADLTWSAATGGQPIAYYTVHRDGSVLARVDAPFRNYHDGSLAADTEYTYFISATDVDGNQSLPSHTVVIRTPGSGEDIPPTPPRDLHSMETTASSVHLMWGGSSGSAGIKNYLVYRNGRQIGTTEPSRLEYTDSGLAANTEYRYFVAALDNQGRLSVPSNVLTVKTRGDGGAIPEWAPNVPYEVGDKVTYSGRTYQCLQAHPSNSGWTPVDTINILWKEVAVRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_3

567680-567784

Orphan

Consensus_repeat	Method
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_3

>merge|NZ_CP021109|3|567680-567784|CRISPRCasFinder
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGGGAGGGAAAGGCCCACCCCCGAAGCGCTGACGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGG

>NZ_CP021109|3|3|567680-567784|CRISPRCasFinder
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGG	GAGGGAAAGGCCCACCCCCGAAGCGCTGA
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086056008.1\|565554_566160_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	unknown	unknown	gnl\|CDD\|223813
NZ_CP021109.1\|WP_086056017.1\|576339_577659_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_CP021109.1\|WP_086056007.1\|565035_565539_-\|pantetheine-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234674
NZ_CP021109.1\|WP_086056012.1\|571926_572466_+\|6,7-dimethyl-8-ribityllumazine-synthase	unknown	unknown	gnl\|CDD\|234606
NZ_CP021109.1\|WP_086071425.1\|568413_570315_-\|CYTH-and-CHAD-domain-containing-protein	unknown	unknown	gnl\|CDD\|143624
NZ_CP021109.1\|WP_086071422.1\|556344_558279_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP021109.1\|WP_086056011.1\|570691_571873_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	unknown	unknown	gnl\|CDD\|237587
NZ_CP021109.1\|WP_086073481.1\|558278_559289_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|235136
NZ_CP021109.1\|WP_086059185.1\|573976_574483_+\|phosphatidylglycerophosphatase-A	unknown	unknown	gnl\|CDD\|368021
NZ_CP021109.1\|WP_086056004.1\|562908_563292_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|281474
NZ_CP021109.1\|WP_086056006.1\|564559_564811_-\|YfhL-family-4Fe-4S-dicluster-ferredoxin	unknown	unknown	gnl\|CDD\|235941
NZ_CP021109.1\|WP_086071428.1\|575160_575982_-\|orotidine-5'-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|234651
NZ_CP021109.1\|WP_086056009.1\|567875_568385_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP021109.1\|WP_086071427.1\|574479_575019_+\|CinA-family-protein	unknown	unknown	gnl\|CDD\|334938
NZ_CP021109.1\|WP_086073482.1\|559492_560200_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378136
NZ_CP021109.1\|WP_086071424.1\|563299_564535_-\|benzoate/H(+)-symporter-BenE-family-transporter	unknown	unknown	gnl\|CDD\|281578
NZ_CP021109.1\|WP_086071426.1\|572978_573944_+\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|235583
NZ_CP021109.1\|WP_086073483.1\|566596_567625_+\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP021109.1\|WP_086056013.1\|572449_572938_+\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP021109.1\|WP_086071423.1\|560323_562912_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|236772

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086056008.1\|565554_566160_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	gnl\|CDD\|223813	COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair].	2.49603e-57
NZ_CP021109.1\|WP_086056017.1\|576339_577659_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	7.40997e-115
NZ_CP021109.1\|WP_086056007.1\|565035_565539_-\|pantetheine-phosphate-adenylyltransferase	gnl\|CDD\|234674	PRK00168, coaD, phosphopantetheine adenylyltransferase; Provisional.	8.51412e-102
NZ_CP021109.1\|WP_086056012.1\|571926_572466_+\|6,7-dimethyl-8-ribityllumazine-synthase	gnl\|CDD\|234606	PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional.	3.14396e-66
NZ_CP021109.1\|WP_086071425.1\|568413_570315_-\|CYTH-and-CHAD-domain-containing-protein	gnl\|CDD\|143624	cd07756, CYTH-like_Pase_CHAD, Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain. This subgroup belongs to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily. Members of this superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). A number of proteins in this subgroup also contain a C-terminal CHAD (Conserved Histidine Alpha-helical Domain) domain which may participate in metal chelation or act as a phosphor-acceptor. The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup have not been characterized.	1.39392e-53
NZ_CP021109.1\|WP_086071422.1\|556344_558279_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.8795e-87
NZ_CP021109.1\|WP_086056011.1\|570691_571873_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	gnl\|CDD\|237587	PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II.	0
NZ_CP021109.1\|WP_086073481.1\|558278_559289_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|235136	PRK03598, PRK03598, putative efflux pump membrane fusion protein; Provisional.	8.37542e-108
NZ_CP021109.1\|WP_086059185.1\|573976_574483_+\|phosphatidylglycerophosphatase-A	gnl\|CDD\|368021	pfam04608, PgpA, Phosphatidylglycerophosphatase A. This family represents a family of bacterial phosphatidylglycerophosphatases (EC:3.1.3.27), known as PgpA. It appears that bacteria possess several phosphatidylglycerophosphatases, and thus, PgpA is not essential in Escherichia coli.	1.75041e-48
NZ_CP021109.1\|WP_086056004.1\|562908_563292_+\|hypothetical-protein	gnl\|CDD\|281474	pfam03476, MOSC_N, MOSC N-terminal beta barrel domain. This domain is found to the N-terminus of pfam03473. The function of this domain is unknown, however it is predicted to adopt a beta barrel fold.	9.49218e-14
NZ_CP021109.1\|WP_086056006.1\|564559_564811_-\|YfhL-family-4Fe-4S-dicluster-ferredoxin	gnl\|CDD\|235941	PRK07118, PRK07118, Fe-S cluster domain-containing protein.	1.06178e-07
NZ_CP021109.1\|WP_086071428.1\|575160_575982_-\|orotidine-5'-phosphate-decarboxylase	gnl\|CDD\|234651	PRK00125, pyrF, orotidine 5'-phosphate decarboxylase; Reviewed.	8.84472e-136
NZ_CP021109.1\|WP_086056009.1\|567875_568385_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.61906e-23
NZ_CP021109.1\|WP_086071427.1\|574479_575019_+\|CinA-family-protein	gnl\|CDD\|334938	pfam02464, CinA, Competence-damaged protein. CinA is the first gene in the competence-inducible (cin) operon, and is thought to be specifically required at some stage in the process of transformation. This Pfam family consists of putative competence-damaged proteins from the cin operon. Some members of this family have nicotinamide mononucleotide (NMN) deamidase activity.	6.16313e-61
NZ_CP021109.1\|WP_086073482.1\|559492_560200_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|378136	pfam09209, DUF1956, Domain of unknown function (DUF1956). Members of this family are found in various prokaryotic transcriptional regulator proteins. Their exact function has not, as yet, been identified.	7.64043e-19
NZ_CP021109.1\|WP_086071424.1\|563299_564535_-\|benzoate/H(+)-symporter-BenE-family-transporter	gnl\|CDD\|281578	pfam03594, BenE, Benzoate membrane transport protein.	2.07934e-114
NZ_CP021109.1\|WP_086071426.1\|572978_573944_+\|thiamine-phosphate-kinase	gnl\|CDD\|235583	PRK05731, PRK05731, thiamine monophosphate kinase; Provisional.	8.40588e-126
NZ_CP021109.1\|WP_086073483.1\|566596_567625_+\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	1.91382e-169
NZ_CP021109.1\|WP_086056013.1\|572449_572938_+\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	1.69931e-52
NZ_CP021109.1\|WP_086071423.1\|560323_562912_+\|AsmA-family-protein	gnl\|CDD\|236772	PRK10833, PRK10833, putative assembly protein; Provisional.	2.95023e-23

>NZ_CP021109.1|WP_086073483.1|566596_567625_+|signal-recognition-particle-docking-protein-FtsY
MAAAATRVPGEPVLPTPPEPAADAAPAGPAPEAEPATGKRSWLQRLKQGLSRTGQSLGGLFVGVKVDENLFEELETALIMADAGMEATESLLTALRARVKKERIEDAGKVREALRQILADHLRPLERRFDVHRAKPLVIMIAGVNGAGKTTSIGKLANTFQRQGASVLLAAGDTFRAAARQQLMEWGARNNVTVIAQEGGDPAAVAFDAVNAGRARGTGVVMVDTAGRLPTQLHLMEELKKIRRVIGKADPAAPHEVLLVVDGNTGQNVLAQIRAFDAAINLTGLVVTKLDGTAKGGTLAAVAAGTQGVRPVPVYWIGVGEGLEDLQPFVADEFAAALLGMG
>NZ_CP021109.1|WP_086056008.1|565554_566160_-|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD
MTNKYIRIVGGQYRRTPIAVVDAPGLRPTPDRVRETLYNWLSHLWGGEFGGKSVLDLFAGSGALGFEAASRGVAHVQMVERDRQALAALRALRDKLGATQVRIHAGDALETLRRMDASRYDLVLLDPPFGQGWLPRLWPLLPGILNEDALIYAESESELEPAEQFEILRKDRAGAVHYALLRFAAMQKTINNPRFGEVTHL
>NZ_CP021109.1|WP_086056007.1|565035_565539_-|pantetheine-phosphate-adenylyltransferase
MIIAVYPGTFDPLTRGHEDLVRRAAALFDEVVVGVAHSRNKKPFFTIDERVAIAREVLGHYPNVRVESFGGLLKDFVREQNGRVIVRGLRAVSDFEYEFQMAGMNRHLLPDVETLFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLHEKARQHREQSWPR
>NZ_CP021109.1|WP_086056006.1|564559_564811_-|YfhL-family-4Fe-4S-dicluster-ferredoxin
MALKITEECINCDVCEPQCPNEAISMGEDYYVIDPDKCTECVGHYDEPQCKVVCPVECIEIHPQWHEGQEQLMAKYRRLTGRA
>NZ_CP021109.1|WP_086071424.1|563299_564535_-|benzoate/H(+)-symporter-BenE-family-transporter
MPDPSTNTDATTAGHRAASGGLTLRGDTSLSAVVAGVVAVLVSFGGTAVLMVQAGHAAGLDAARIGSWLGAICLALGLGGVYLSLRTRLPIVLAWSTPGAALLITALPGIPFGEAVGAFAVAAALALVCGMLGWIDPIARRIPPQIASAMLAGVLLNFGIGVFSAMSKHAVLVLPMALTYLLFKRYAARYAILAVLAMGLAVAATQGLLRFDSADWRLTEFVWTTPVLTWRGIVSLAIPLFVVGMASQNLPGLAVLQAAGYGDVPASRIIAVSGGVGLIAAPFGAHSVTLAAIIAAVCAGKESHPDPSRRYVAAVTYGVLYVMLGAAAGAVAVFFQALPPALIAALAGLALLAPIMGGMAAAMRDEEGREAALITLLATASGMSFLGVGSAFWGLAAGLIAHAIMTARRAR
>NZ_CP021109.1|WP_086056004.1|562908_563292_+|hypothetical-protein
MSAIYHPVAQCGGLDDPRAADYDRRWLLVNSGGQWVTRQACPAIADIAVELRFGYLVLRAPGMLRIDVPLDVIEDDDSVRTAVLVGEQAVDVVDEGELAAAWVSNYTGIPCRLMKVHPDMGPVHWPE
>NZ_CP021109.1|WP_086071423.1|560323_562912_+|AsmA-family-protein
MKTWIKRISIGLAVALAVVIAGLIVFVLTFDPNTYKDRLQTWVQQRYHRTLTIDGEIEATLFPRLGVTLQGVSLSEPDSTETFAAVDSARMAVAIWPLLSRNVVVDHATFSGVRARLVRDRQGRLNFQDLLGGPAGEKQAPAQPGRETEGRSGAFGIDIAGLNINDGEIQLRDDATGQALTVSQLNAKTGRMRASEPFDVSLSAHVEGDKPRLNADLSAQGVAMLDPDARRYAVRKLDLKATGLLPRANARNVSLRGDLHYDERARAVEASTLEFVFQGDVEDVQGGTASVDASLAAEHLRVDPQQQTVQAAKAALRAKGTLPKGPFEFAADAPALDISPAAATGSGLAARLRLSGNEGLDIRLALNDLSGNSANLAVADARLSAELKRGERSWMFDLASPLAVDTAKRSATLAAVNGQALIAGPGLPAGGLRIPYTGAAGVDMAREAADLKLNAQTEGGKLAVTASAAQLKKKPSLRFTLDADAVDLDKLIPPAQAAAKPAKDAGTPPPAAEKPQAPATQSSNAGADANAGSKAGADKTSHAADAPAKGEGGGAPKAAPGSDADLSALVGPTAHGTIKVGRLTGRGVAVENLSATLQLAQGRLEISPLNAVLYGGKLAGGASLDAAHGNAVATRFTLDGVSIGPLLTAITKRSSLTGVGSVAANLTTRGVHGETMRDNLGGTLQLRLRDGAIKGFDAAGALRDLKQALLGGRQDGPADVPADAGRETVFSRMDADFALAAGVATIKRLDVVSPVLRVSQGEPAVIDLPKGRIDVVANVKIADSPPPYADVKELRGVVVPVRVAGPYDALRYRVDWRAVAGGALSQALQRALGGKSEERQRDDSRQDTIRDLGRILKGITGK
>NZ_CP021109.1|WP_086073482.1|559492_560200_+|helix-turn-helix-transcriptional-regulator
MPPRTPAHASIPLRARADGEATRASIIEAAGQLFAERGYADTTSKAICERARTNIAAVNYHFGSRDDLYLALLREVHTHVMGMPFLREIAASRRPAEEKLRLFLQGLVEAIVDSGSWHTRLWAREILSPSPLLSRVMREEALPKFQVLSGIVSQITGLAPGTPALTCCSLSVLAPCLVLLVLDRRIESPVQALFQQPAAELAAQMHALALHGLKAVARPRRQGGARPARSAHAQR
>NZ_CP021109.1|WP_086073481.1|558278_559289_-|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MKKKILVVAVVVAAIALTGWILHRPSTDPNRLTLYGNVDIRQISLAFDGSDRIAEMRVEEGDAVRAGQVLARLDTRTLALQLAQARADVDMREQSLLRLRNGTRPEEIQQAQAQVAAAQADADLAARQLKRLRAVAGGTAGRAVSQEDLDSAAARLRVAQAQLESRQQELRLARVGPRKEDIAEAAAALEAARSQAALLQHRLDLAELRAPRDAVVRARLLEPGDMASPQRPVYTLAIRDPKWVRAYIDEPDLGRIRMGMAARVYTDSHPDEPIDGKVGYISSVAEFTPKSVQTETLRTSLVYEIRVLVDDPQDRLRLGMPATVRIELPPSGRAPA
>NZ_CP021109.1|WP_086071422.1|556344_558279_-|ABC-transporter-ATP-binding-protein
MDRDSGVAVMARDVGKRFQVKAPKRIVQALRGVTLQAGRGTVTALVGPDGAGKTTFLRLIAGLMRADEGDLQVLGHDAGRDPQAVQNRISYMPQRFGLYADLSVHENLDLYADLHGVPMDGRRERYARLLEMTDLTRFTGRLAGKLSGGMKQKLGLACTLVRSPDLLLLDEPTVGVDPLSRRELWEIIDRMVRDETLTVLVATAYLDEAERCAQVHVLHEGRLLAQGTPAEISAHAQGLCYVVAPAPDEAPRRRQARLLDRADLVVDAVPRGGDVRFILRPGADIAALGEDAANAEPSPARLEDGFMMLLRMRAADAQRGHEASPHGHEDREMAADALDDSAMRHASATQTANAALASASTAGRNGGQDPASPVIEVKDLVRKFGDFTAVDRTTFSVSRGEIFGLLGPNGAGKTTTFRMLCGLLPASGGSARVAGMDLRTARAQARARIGYVSQAFALYGDLTALENLRFFGGAYGLYGARLRTRIDAVTEQFALRGQLDQAAGRLAGGIKQRLAMAVGLLHEPEILFLDEPTSGADPLARRAFWRRITALADTGTTIVITTHFMEEAEYCDRIVIQDAGQLLALGTPAAVRAQAGATPERRMTMEEAFIGIVEHGRSRMNGQAGNAAPSGQAGAMRPAAETSP
>NZ_CP021109.1|WP_086056009.1|567875_568385_+|GNAT-family-N-acetyltransferase
MNSVRLNRVVRGDAAELIAANAASRGYHLPWVRPFTDMAGFDSWFQRSLTGPNVSLVAREAASSRIVGVINLNEIVGGGFQSAYLGYYGMVEFRRKGLMTQALREAIRFAFVDLGLHRLEANIQPANAASLALVKRLGFQKEGFSPQYLFIEGAWRDHERWALRADMPY
>NZ_CP021109.1|WP_086071425.1|568413_570315_-|CYTH-and-CHAD-domain-containing-protein
MSEQELKLHVPEASRAGVERELRQAGAERLPLHAMYFDTPDRELARARIAIRLRREGRNWVQTLKTPGSNAITRVEMNHARPGPILDLSVYAGTEVHEALADLKGPLGLRYETDVTRLVRKTRTRQGTVEIAYDVGVLRAGDLELPIREVEFELVSGRAAAIFGVARNWLARYGLVLDPRSKSERGDALARLSQTLAQPGLTEASRSAAIAQFWGPRPARPIRLTPEMTAPQGLAAVAAECLDQIARNAAMLAEVDTLDVYGAGQPEHVHQLRVGIRRLRSAWRLFRGWAQLPPADIQAEVRDYFSAFGANRDQDVLKESIIPALEKAGMPTFDMPDEEAPPVAARETASGAAFQGWLLRALEWSLDVGPADETARPPIDAASASIAASARPAAGHVVVPVRGHRDDGGEPLSIGTPEAALAGTSSMCETAAATGGDDASGKNGDSAAPANGNGQSGANGPRGAWAAHTTKASNGADGASRDASMAASGAIQPTIIPLQPPRAPRTVAMLLARRLRKWHAHVLREGRRFAELDIPSRHDLRKRAKRLRYGLSFAESLLPPHKTRDYRRRLAAVQDVLGEINDLAVAHDLYRQWSSRHPQAWFALGWISARQEKLIAEAEHAFAKLGQAKKFWK
>NZ_CP021109.1|WP_086056011.1|570691_571873_+|3,4-dihydroxy-2-butanone-4-phosphate-synthase
MSAHPSPVALAPDAESFGISPVTEIIAELRAGRIVILVDEEDRENEGDLVMAAEFVTPEAINFMVTHGRGLVCLTLTEERCRQLDLPLMASRNGTRFGTNFTVSIEAAEGVETGISAADRARTIRAAVARDAKPSDLVQPGHIFPVRAVPGGVLVRAGHTEAGCDLTAMAGLTPAAVICEILKPDGTMARLPDLVEFAKVHGLKIGTIADLIQYRSEHESIVQRLGARAMRTPWGEFQAVAYRDTATQSIHLALVHGAIDPQRETLVRVHEPASVLDVLDIGASQHSWGVAQALQAIAAAPAGVLVLMNCQGEGEHLASQIAAWTAPADDARGATQSGDRLGLRTYGIGAQILRDLNVGQMKLLARPRKMPSMAGFSLSITGYDCDPPASPVR
>NZ_CP021109.1|WP_086056012.1|571926_572466_+|6,7-dimethyl-8-ribityllumazine-synthase
MNPYTLTPDLNGEGLHIGIVRARFNEEIGQAELDACLQELEKLGVDERDVMVVTVPGALELGVTLARMAETYEFDALIALGAVIRGETYHFEIVSNEMAAAITRITVETGIPIANGVLTTDTDEQAEARAPGKGRDCAQVAVEMANLIAALEPEPDDEDEEEDEDDEDYEDEEDDDDRR
>NZ_CP021109.1|WP_086056013.1|572449_572938_+|transcription-antitermination-factor-NusB
MTTAADHAAQTRANARSARRRAREFALQGVYAWLLRGGEGTQDAGEIDAHLRDADDFSEADAQWFKTLLHGVLREAPQLREQFTPFIDRPLNELSPVEHGILLIGSYELMHHVEVPYKVAINEAVELAKSFGGTDGFKFVNGVLDKLAAVVREQEVRAAARR
>NZ_CP021109.1|WP_086071426.1|572978_573944_+|thiamine-phosphate-kinase
MASEFDLIDRYFKRRTPDGMLGVGDDCALFGVPAGMKVATSTDLLIEGRHFFPDVDPRALGHKSLAVNVSDLAAMGARPIGCLLGLALPQPREDWLSAFAEGFHGMADAAGCPLIGGDTTGNPGALAISVTVFGAVRAEAALRRDAARVGDDIWVSGTLGEADIAYRLMSGQMPPDDGLLACVRQALEWPQPRFALGQALAGIAHAAIDISDGLLQDLGHILKASRVGARLRMADMPVSPALAGVPAARLRHAVLAGGDAYELCFTAPGDRADAVRAAAARAGVAVTRIGSVEAGTGVTVLDAQGIPMTDLPAGFDHFRSP
>NZ_CP021109.1|WP_086059185.1|573976_574483_+|phosphatidylglycerophosphatase-A
MRDRSRVAYPAFSWICGSANRFIAFGLGSGLLRPASGTWGTLLAWLLWLPAARWLSDPALGLLIALSLAYGCWACHRVGRELGQPDHVGMVWDEMAAFWLVLWLTPNGWLAQACAFVLFRAFDIGKPPPIRYFDARMKNGIGVMWDDLLAAAYTLLVMAIAVRMGAFR
>NZ_CP021109.1|WP_086071427.1|574479_575019_+|CinA-family-protein
MTSFDSHVLSLASALGKELSRRGWMMGTAESCTGGLVAGAVTAIAGSSGWFDRGFVTYSNEAKAVDLQVSPDTLNLYGAVSEPVAQEMASGVLLASTTARVAVSTTGIAGPEGGTPGKPVGMVCFGFAIRAGDGITTRAATQVFQGDRTQVREHAVAFALLGLLETIGAKLEQPAPTLA
>NZ_CP021109.1|WP_086071428.1|575160_575982_-|orotidine-5'-phosphate-decarboxylase
MNFKEKLDRAWQVSGSLLTVGLDPDVNRLPRELAGQPDAILRFCRDIVDATAPFACSFKPQIAYFAANRAEDQLEALCAHIRERHPGLPIVLDAKRGDIGSTAEQYAREAFERYRADCVTVSPYMGLDSVEPYLRWRDRGVFVLCRTSNPGGSDLQFLKTEGGDPLYLHVAGLVADKWNAHGQCGLVVGATYPAELAAVRARVGDDVPLLVPGIGAQGGDVNATVNNARNAQGTGILINSSRAILYASNGDDWREAAAQAAKRLRDEINAVRA
>NZ_CP021109.1|WP_086056017.1|576339_577659_-|FAD-dependent-oxidoreductase
MSARSSSTPAHRVVIVGGGAGGLELAARLGRAHGPAHVTLVDERPFHIWKPSLHEAAAGTLDIHQEGLSYLMLAHLCHFSFVLGRMQRVDRANRMVGVQPVVDASGKAIIPERALPYDTLVLAVGSVANFYNTPGAAEHAITLDSTDNAEEFRLTLLKAMVQVDQAKVHDPTARLNIVIVGGGATGVELAVELHEASHVVGAYGLPSFQPERDLTITLIEGASRILAPLPERLSRAAAQRLAELGIKVHTGRRVAEVTANSVKTDDGAVFDAHLCLWAAGIQGPPILRGLQLPMNRIGQLEVNDRLETQDPRILAFGDCAAAPWTGHGTVPARAQAAHQQAAYLARKIGARIRQQPEPATGYVYKDYGSLVSLGQGAGVGSLMGKLAGRGLFVSGTLARFMYMSLHLMHHRALLGLWRTACLALGRVLLRRTRPRVKLH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_4

575045-575153

Orphan

Consensus_repeat	Method
GAGGAGGAAGCGCGGTAGCGCTGCGGGGGTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_4

>merge|NZ_CP021109|4|575045-575153|CRISPRCasFinder
GAGGAGGAAGCGCGGTAGCGCTGCGGGGGTGGACCGCCGCGGGGATCCGGCTTTGCCGGTCGCCGCGTCGCCCCCTAGAGGGGGAAGCGCGGTAGCGCTGCGGGGGTGG

>NZ_CP021109|4|4|575045-575153|CRISPRCasFinder
GAGGAGGAAGCGCGGTAGCGCTGCGGGGGTGG	ACCGCCGCGGGGATCCGGCTTTGCCGGTCGCCGCGTCGCCCCCTA
GAGGGGGAAGCGCGGTAGCGCTGCGGGGGTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086056008.1\|565554_566160_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	unknown	unknown	gnl\|CDD\|223813
NZ_CP021109.1\|WP_086056017.1\|576339_577659_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_CP021109.1\|WP_086056013.1\|572449_572938_+\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP021109.1\|WP_086071428.1\|575160_575982_-\|orotidine-5'-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|234651
NZ_CP021109.1\|WP_086071425.1\|568413_570315_-\|CYTH-and-CHAD-domain-containing-protein	unknown	unknown	gnl\|CDD\|143624
NZ_CP021109.1\|WP_086071429.1\|577676_578072_-\|diacylglycerol-kinase	unknown	unknown	gnl\|CDD\|260133
NZ_CP021109.1\|WP_086071432.1\|583132_583888_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187626
NZ_CP021109.1\|WP_086059185.1\|573976_574483_+\|phosphatidylglycerophosphatase-A	unknown	unknown	gnl\|CDD\|368021
NZ_CP021109.1\|WP_086056022.1\|581040_581652_+\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|225632
NZ_CP021109.1\|WP_086056019.1\|578249_578966_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP021109.1\|WP_086056009.1\|567875_568385_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP021109.1\|WP_086071433.1\|583919_584783_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP021109.1\|WP_086071427.1\|574479_575019_+\|CinA-family-protein	unknown	unknown	gnl\|CDD\|334938
NZ_CP021109.1\|WP_086056021.1\|580052_581027_+\|DctP-family-TRAP-transporter-solute-binding-subunit	unknown	unknown	gnl\|CDD\|270390
NZ_CP021109.1\|WP_086071430.1\|578962_579991_+\|L-idonate-5-dehydrogenase	unknown	unknown	gnl\|CDD\|176194
NZ_CP021109.1\|WP_086056011.1\|570691_571873_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	unknown	unknown	gnl\|CDD\|237587
NZ_CP021109.1\|WP_086056012.1\|571926_572466_+\|6,7-dimethyl-8-ribityllumazine-synthase	unknown	unknown	gnl\|CDD\|234606
NZ_CP021109.1\|WP_086071426.1\|572978_573944_+\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|235583
NZ_CP021109.1\|WP_086073483.1\|566596_567625_+\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP021109.1\|WP_086071431.1\|581689_583096_+\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086056008.1\|565554_566160_-\|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD	gnl\|CDD\|223813	COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair].	2.49603e-57
NZ_CP021109.1\|WP_086056017.1\|576339_577659_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	7.40997e-115
NZ_CP021109.1\|WP_086056013.1\|572449_572938_+\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	1.69931e-52
NZ_CP021109.1\|WP_086071428.1\|575160_575982_-\|orotidine-5'-phosphate-decarboxylase	gnl\|CDD\|234651	PRK00125, pyrF, orotidine 5'-phosphate decarboxylase; Reviewed.	8.84472e-136
NZ_CP021109.1\|WP_086071425.1\|568413_570315_-\|CYTH-and-CHAD-domain-containing-protein	gnl\|CDD\|143624	cd07756, CYTH-like_Pase_CHAD, Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain. This subgroup belongs to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily. Members of this superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). A number of proteins in this subgroup also contain a C-terminal CHAD (Conserved Histidine Alpha-helical Domain) domain which may participate in metal chelation or act as a phosphor-acceptor. The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup have not been characterized.	1.39392e-53
NZ_CP021109.1\|WP_086071429.1\|577676_578072_-\|diacylglycerol-kinase	gnl\|CDD\|260133	cd14264, DAGK_IM, Integral membrane diacylglycerol kinase. This mostly bacterial family of homo-trimeric integral membrane enzymes, the products of the dgkA gene, catalyzes the ATP-dependent phosphorylation of diacylglycerol to phosphatidic acid. Escherichia coli DAGK participates in the membrane-derived oligosaccharide cycle (MDO cycle) by recycling lipids to restore phosphatidylglycerols that were used up in the biosynthesis of MDOs. DAGK also recycles diacylglycerols that are produced during the biosynthesis of lipopolysaccharides (LPS) back to phospholipids. DAGK is not the main source of phosphatidic acid in de-novo biosynthesis of glycerophospholipids. Escherichia coli DAGK has low activity as an undecaprenol kinase.	8.17902e-45
NZ_CP021109.1\|WP_086071432.1\|583132_583888_+\|SDR-family-oxidoreductase	gnl\|CDD\|187626	cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs. Human DHRS6, and similar proteins. These proteins are classical SDRs, with a canonical active site tetrad and a close match to the typical Gly-rich NAD-binding motif. Human DHRS6 is a cytosolic type 2 (R)-hydroxybutyrate dehydrogenase, which catalyses the conversion of (R)-hydroxybutyrate to acetoacetate. Also included in this subgroup is Escherichia coli UcpA (upstream cys P). Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Note: removed : needed to make this chiodl smaller when drew final trees: rmeoved text form description: Other proteins in this subgroup include Thermoplasma acidophilum aldohexose dehydrogenase, which has high dehydrogenase activity against D-mannose, Bacillus subtilis BacC involved in the biosynthesis of the dipeptide bacilysin and its antibiotic moiety anticapsin, Sphingomonas paucimobilis strain B90 LinC, involved in the degradation of hexachlorocyclohexane isomers...... P).	1.12404e-114
NZ_CP021109.1\|WP_086059185.1\|573976_574483_+\|phosphatidylglycerophosphatase-A	gnl\|CDD\|368021	pfam04608, PgpA, Phosphatidylglycerophosphatase A. This family represents a family of bacterial phosphatidylglycerophosphatases (EC:3.1.3.27), known as PgpA. It appears that bacteria possess several phosphatidylglycerophosphatases, and thus, PgpA is not essential in Escherichia coli.	1.75041e-48
NZ_CP021109.1\|WP_086056022.1\|581040_581652_+\|TRAP-transporter-small-permease	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	4.89741e-37
NZ_CP021109.1\|WP_086056019.1\|578249_578966_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	1.02725e-57
NZ_CP021109.1\|WP_086056009.1\|567875_568385_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.61906e-23
NZ_CP021109.1\|WP_086071433.1\|583919_584783_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	9.41381e-103
NZ_CP021109.1\|WP_086071427.1\|574479_575019_+\|CinA-family-protein	gnl\|CDD\|334938	pfam02464, CinA, Competence-damaged protein. CinA is the first gene in the competence-inducible (cin) operon, and is thought to be specifically required at some stage in the process of transformation. This Pfam family consists of putative competence-damaged proteins from the cin operon. Some members of this family have nicotinamide mononucleotide (NMN) deamidase activity.	6.16313e-61
NZ_CP021109.1\|WP_086056021.1\|580052_581027_+\|DctP-family-TRAP-transporter-solute-binding-subunit	gnl\|CDD\|270390	cd13672, PBP2_TRAP_Siap, Substrate-binding domain of a sialic acid binding Tripartite ATP-independent Periplasmic transport system (SiaP); the type 2 periplasmic-binding protein fold. This subfamily represents the periplasmic-binding component of TRAP transport system SiaP, a sialic acid binding virulence factor. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	9.07192e-130
NZ_CP021109.1\|WP_086071430.1\|578962_579991_+\|L-idonate-5-dehydrogenase	gnl\|CDD\|176194	cd08232, idonate-5-DH, L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to 6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate. L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH. This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	6.88802e-163
NZ_CP021109.1\|WP_086056011.1\|570691_571873_+\|3,4-dihydroxy-2-butanone-4-phosphate-synthase	gnl\|CDD\|237587	PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II.	0
NZ_CP021109.1\|WP_086056012.1\|571926_572466_+\|6,7-dimethyl-8-ribityllumazine-synthase	gnl\|CDD\|234606	PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional.	3.14396e-66
NZ_CP021109.1\|WP_086071426.1\|572978_573944_+\|thiamine-phosphate-kinase	gnl\|CDD\|235583	PRK05731, PRK05731, thiamine monophosphate kinase; Provisional.	8.40588e-126
NZ_CP021109.1\|WP_086073483.1\|566596_567625_+\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	1.91382e-169
NZ_CP021109.1\|WP_086071431.1\|581689_583096_+\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	7.63717e-133

>NZ_CP021109.1|WP_086071427.1|574479_575019_+|CinA-family-protein
MTSFDSHVLSLASALGKELSRRGWMMGTAESCTGGLVAGAVTAIAGSSGWFDRGFVTYSNEAKAVDLQVSPDTLNLYGAVSEPVAQEMASGVLLASTTARVAVSTTGIAGPEGGTPGKPVGMVCFGFAIRAGDGITTRAATQVFQGDRTQVREHAVAFALLGLLETIGAKLEQPAPTLA
>NZ_CP021109.1|WP_086059185.1|573976_574483_+|phosphatidylglycerophosphatase-A
MRDRSRVAYPAFSWICGSANRFIAFGLGSGLLRPASGTWGTLLAWLLWLPAARWLSDPALGLLIALSLAYGCWACHRVGRELGQPDHVGMVWDEMAAFWLVLWLTPNGWLAQACAFVLFRAFDIGKPPPIRYFDARMKNGIGVMWDDLLAAAYTLLVMAIAVRMGAFR
>NZ_CP021109.1|WP_086071426.1|572978_573944_+|thiamine-phosphate-kinase
MASEFDLIDRYFKRRTPDGMLGVGDDCALFGVPAGMKVATSTDLLIEGRHFFPDVDPRALGHKSLAVNVSDLAAMGARPIGCLLGLALPQPREDWLSAFAEGFHGMADAAGCPLIGGDTTGNPGALAISVTVFGAVRAEAALRRDAARVGDDIWVSGTLGEADIAYRLMSGQMPPDDGLLACVRQALEWPQPRFALGQALAGIAHAAIDISDGLLQDLGHILKASRVGARLRMADMPVSPALAGVPAARLRHAVLAGGDAYELCFTAPGDRADAVRAAAARAGVAVTRIGSVEAGTGVTVLDAQGIPMTDLPAGFDHFRSP
>NZ_CP021109.1|WP_086056013.1|572449_572938_+|transcription-antitermination-factor-NusB
MTTAADHAAQTRANARSARRRAREFALQGVYAWLLRGGEGTQDAGEIDAHLRDADDFSEADAQWFKTLLHGVLREAPQLREQFTPFIDRPLNELSPVEHGILLIGSYELMHHVEVPYKVAINEAVELAKSFGGTDGFKFVNGVLDKLAAVVREQEVRAAARR
>NZ_CP021109.1|WP_086056012.1|571926_572466_+|6,7-dimethyl-8-ribityllumazine-synthase
MNPYTLTPDLNGEGLHIGIVRARFNEEIGQAELDACLQELEKLGVDERDVMVVTVPGALELGVTLARMAETYEFDALIALGAVIRGETYHFEIVSNEMAAAITRITVETGIPIANGVLTTDTDEQAEARAPGKGRDCAQVAVEMANLIAALEPEPDDEDEEEDEDDEDYEDEEDDDDRR
>NZ_CP021109.1|WP_086056011.1|570691_571873_+|3,4-dihydroxy-2-butanone-4-phosphate-synthase
MSAHPSPVALAPDAESFGISPVTEIIAELRAGRIVILVDEEDRENEGDLVMAAEFVTPEAINFMVTHGRGLVCLTLTEERCRQLDLPLMASRNGTRFGTNFTVSIEAAEGVETGISAADRARTIRAAVARDAKPSDLVQPGHIFPVRAVPGGVLVRAGHTEAGCDLTAMAGLTPAAVICEILKPDGTMARLPDLVEFAKVHGLKIGTIADLIQYRSEHESIVQRLGARAMRTPWGEFQAVAYRDTATQSIHLALVHGAIDPQRETLVRVHEPASVLDVLDIGASQHSWGVAQALQAIAAAPAGVLVLMNCQGEGEHLASQIAAWTAPADDARGATQSGDRLGLRTYGIGAQILRDLNVGQMKLLARPRKMPSMAGFSLSITGYDCDPPASPVR
>NZ_CP021109.1|WP_086071425.1|568413_570315_-|CYTH-and-CHAD-domain-containing-protein
MSEQELKLHVPEASRAGVERELRQAGAERLPLHAMYFDTPDRELARARIAIRLRREGRNWVQTLKTPGSNAITRVEMNHARPGPILDLSVYAGTEVHEALADLKGPLGLRYETDVTRLVRKTRTRQGTVEIAYDVGVLRAGDLELPIREVEFELVSGRAAAIFGVARNWLARYGLVLDPRSKSERGDALARLSQTLAQPGLTEASRSAAIAQFWGPRPARPIRLTPEMTAPQGLAAVAAECLDQIARNAAMLAEVDTLDVYGAGQPEHVHQLRVGIRRLRSAWRLFRGWAQLPPADIQAEVRDYFSAFGANRDQDVLKESIIPALEKAGMPTFDMPDEEAPPVAARETASGAAFQGWLLRALEWSLDVGPADETARPPIDAASASIAASARPAAGHVVVPVRGHRDDGGEPLSIGTPEAALAGTSSMCETAAATGGDDASGKNGDSAAPANGNGQSGANGPRGAWAAHTTKASNGADGASRDASMAASGAIQPTIIPLQPPRAPRTVAMLLARRLRKWHAHVLREGRRFAELDIPSRHDLRKRAKRLRYGLSFAESLLPPHKTRDYRRRLAAVQDVLGEINDLAVAHDLYRQWSSRHPQAWFALGWISARQEKLIAEAEHAFAKLGQAKKFWK
>NZ_CP021109.1|WP_086056009.1|567875_568385_+|GNAT-family-N-acetyltransferase
MNSVRLNRVVRGDAAELIAANAASRGYHLPWVRPFTDMAGFDSWFQRSLTGPNVSLVAREAASSRIVGVINLNEIVGGGFQSAYLGYYGMVEFRRKGLMTQALREAIRFAFVDLGLHRLEANIQPANAASLALVKRLGFQKEGFSPQYLFIEGAWRDHERWALRADMPY
>NZ_CP021109.1|WP_086073483.1|566596_567625_+|signal-recognition-particle-docking-protein-FtsY
MAAAATRVPGEPVLPTPPEPAADAAPAGPAPEAEPATGKRSWLQRLKQGLSRTGQSLGGLFVGVKVDENLFEELETALIMADAGMEATESLLTALRARVKKERIEDAGKVREALRQILADHLRPLERRFDVHRAKPLVIMIAGVNGAGKTTSIGKLANTFQRQGASVLLAAGDTFRAAARQQLMEWGARNNVTVIAQEGGDPAAVAFDAVNAGRARGTGVVMVDTAGRLPTQLHLMEELKKIRRVIGKADPAAPHEVLLVVDGNTGQNVLAQIRAFDAAINLTGLVVTKLDGTAKGGTLAAVAAGTQGVRPVPVYWIGVGEGLEDLQPFVADEFAAALLGMG
>NZ_CP021109.1|WP_086056008.1|565554_566160_-|16S-rRNA-(guanine(966)-N(2))-methyltransferase-RsmD
MTNKYIRIVGGQYRRTPIAVVDAPGLRPTPDRVRETLYNWLSHLWGGEFGGKSVLDLFAGSGALGFEAASRGVAHVQMVERDRQALAALRALRDKLGATQVRIHAGDALETLRRMDASRYDLVLLDPPFGQGWLPRLWPLLPGILNEDALIYAESESELEPAEQFEILRKDRAGAVHYALLRFAAMQKTINNPRFGEVTHL
>NZ_CP021109.1|WP_086071428.1|575160_575982_-|orotidine-5'-phosphate-decarboxylase
MNFKEKLDRAWQVSGSLLTVGLDPDVNRLPRELAGQPDAILRFCRDIVDATAPFACSFKPQIAYFAANRAEDQLEALCAHIRERHPGLPIVLDAKRGDIGSTAEQYAREAFERYRADCVTVSPYMGLDSVEPYLRWRDRGVFVLCRTSNPGGSDLQFLKTEGGDPLYLHVAGLVADKWNAHGQCGLVVGATYPAELAAVRARVGDDVPLLVPGIGAQGGDVNATVNNARNAQGTGILINSSRAILYASNGDDWREAAAQAAKRLRDEINAVRA
>NZ_CP021109.1|WP_086056017.1|576339_577659_-|FAD-dependent-oxidoreductase
MSARSSSTPAHRVVIVGGGAGGLELAARLGRAHGPAHVTLVDERPFHIWKPSLHEAAAGTLDIHQEGLSYLMLAHLCHFSFVLGRMQRVDRANRMVGVQPVVDASGKAIIPERALPYDTLVLAVGSVANFYNTPGAAEHAITLDSTDNAEEFRLTLLKAMVQVDQAKVHDPTARLNIVIVGGGATGVELAVELHEASHVVGAYGLPSFQPERDLTITLIEGASRILAPLPERLSRAAAQRLAELGIKVHTGRRVAEVTANSVKTDDGAVFDAHLCLWAAGIQGPPILRGLQLPMNRIGQLEVNDRLETQDPRILAFGDCAAAPWTGHGTVPARAQAAHQQAAYLARKIGARIRQQPEPATGYVYKDYGSLVSLGQGAGVGSLMGKLAGRGLFVSGTLARFMYMSLHLMHHRALLGLWRTACLALGRVLLRRTRPRVKLH
>NZ_CP021109.1|WP_086071429.1|577676_578072_-|diacylglycerol-kinase
MTPTPQHSPYKSTGGVRRIFNALRYSMQGLRAAIRYEAAFRQELVLAILLIPAAFWLGRSVLEVFILIMSVVLVLVAELLNSAVEALADALSVEMHPLLGRAKDLGSAAVLLLLIFTVAVWVAVAIGRFLL
>NZ_CP021109.1|WP_086056019.1|578249_578966_+|FadR-family-transcriptional-regulator
MPFQAIEPRRLYRQIADQLRALIESGEFPVGTRLPPERDLALKMGVSRPSVREALIALEVEGLVEVRMGSGIYVRARGEDGQGSVIAESPLDTILARQLIEGELAAQAAQTMRARDVVGLREALDVMREEAASGNIPARGDRLFHVRIAQASDNSVLLRLVGELYDERHNPLAVQLGNYFENADSWAAAIAEHERVVDAIQAGDSNGARAAMREHLAKSHDRLTANWSPPRGDRRVLQ
>NZ_CP021109.1|WP_086071430.1|578962_579991_+|L-idonate-5-dehydrogenase
MSLACKIHGARDLRLEPDLPAALGPHDVEVRLGAAGICGSDLHYFLHGRVGAFVIREPLIPGHEASGVVLRVGDAVTRVSPGMKVAINPSHPCGRCDYCRAGRDNLCSNMRFLGSASVYPHVQGMFRERFVMGERQLTPVDEDISLGELACAEPLSIGLHGVRRAGEMMGRTVLVTGGGTIGCMTVLAARLAGAARIIVCDIADRPLEMARTVGADETVRSDRAGAGELADAADIAIEAAGSPAALATCLTATRRGGRIVQVGTLPGEGLHFPANAIMARELDYVGAFRAGPEFDWAVTYLRTRKVDVRPLMSAQLPLDQAAAAFELAADRSRSTKVQLVCD
>NZ_CP021109.1|WP_086056021.1|580052_581027_+|DctP-family-TRAP-transporter-solute-binding-subunit
MKQGQAVKMLFAALAFAVSAGATAQTKLKWAHVYETSEPFHTQSVWAAQEIEKRTNGRYHIDVYPASQLGKENDINQGLTLGTVDMIISGSSFAAKSFPRIGVTYYPYTFRDPQHLLAYTKSAIYRELAEGYEKKSGNHIVATTYYGTRQTTSNRRVQKCSDMQGLKMRVPDVPAYLAMPRACGANTSPIAFAEVYLALQNGTVEAQENPLTTIEAKKFYEVQKYIALTAHIVDHLNTIISGQLWKKLSPEDRKIFAEVSQEAAERASKEIIAREQQLVEEFKKKGLTVDTVDVADFRKTVLEKVPFKQYGYEKSDWEKIQAVQ
>NZ_CP021109.1|WP_086056022.1|581040_581652_+|TRAP-transporter-small-permease
MATDAHVREAGVSEPRTAQHASSVESIVSSFEEADHQEVDLSGHTFEDWICLALFWVMALLVFLQFFTRYVLNDSFAWTEELATYSLIGVVFIGAAMCVRLCRHIQVDLLYRYLPRPVGRLFSTVIDIARTVFFGYVAWLVWRYIQLVGDEPMTTIEWNKAYVYWLALFGFVLMFGRSLQVTMTNWRQGYSNLERPEAYDKAD
>NZ_CP021109.1|WP_086071431.1|581689_583096_+|TRAP-transporter-large-permease
MWILICSFLLMMIVGVPVAVSMAGASLLYLLVSGDVPDVVVAQRMIAGVESFPLLAVPFFILAGNLMNVAGITGRIYNFAVALVGWMRGGLGHVNIVGSVVFAGMSGTAIADAAGLGTIEIKAMKDHGYNTEFAVGVTAASATLGPIIPPSLPFVIYGMMANVSIGSLFLAGVIPGAVLTLLMMFTVAYYARKNNWGGDVGFDLRRLGEATLEVVIVLAFPFSIWVMTQAGVSTNWAAIIAFAVLLVLDWRFNFSAVMALMAPVILIGGMTLGWFTPTEAAVAAVMWALFLGLVRYRTMTLRTLAKATFDTIETTASVLFIVTAASVFAWLLTTTQAAQALTDAILSVTHNKWVFLMLANVLILIVGCFIDTIAAITILVPILLPIVLKLGIDPIHFGLIMTLNLMIGLLHPPLGMVLFVLARVAKLSVERTTVAILPWLAPLFLALIAITYVPEITLWLPRALGMGN
>NZ_CP021109.1|WP_086071432.1|583132_583888_+|SDR-family-oxidoreductase
MGQRLAGKSAFVTAAGQGIGRATAEAFLREGARVIAADINPTGLSALAELPHCTVCELDITDAAAVRDAVKAAGAVDVLFNGAGYVHAGTILESTEDELTFAVDLNVRAMMRLIQGFLPGMAARGRGSIINMASVAGSVKAVPNRFVYSTTKAAVVGLTKSVAIDFVGKGVRCNAICPGTVESPSLRDRIAAQARQTGLTPQEVEASFVARQPMGRLGRPEEIAALAVYLASDESAFTTGTVQVIDGGWSN
>NZ_CP021109.1|WP_086071433.1|583919_584783_+|fumarylacetoacetate-hydrolase-family-protein
MKLMRYGAKGAEKPAMLDRDGKVRDLSGVVPDITADLLTPQGLAPLAKVDPSSLPLVSEPGRIAPPWRGMGKFICIGLNYADHAAESGLPIPAEPVIFMKTTSCVVGCNDPVVLPQDSVKTDWEVELGVVIGATARYVSEADALKHVAGYCVVNDVSEREYQIERGGTWDKGKGCDTFGPVGPWLVTADEVPDVQNLGMWLEVNGKRMQNGNTRTMIFNVAQVVSYVSRFMTLYPGDLISTGTPPGVGLGMKPPVYLKDGDEMRLGIEGLGEQRQRVHAWNPELIDG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_5

719118-719221

Orphan

Consensus_repeat	Method
GCGTCGCCCCCTTCGAGGGGGAGGCGCGTTAGCGCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_5

>merge|NZ_CP021109|5|719118-719221|CRISPRCasFinder
GCGTCGCCCCCTTCGAGGGGGAGGCGCGTTAGCGCTTCGGGGGTGGGCTTTCCCTCCGGTCCGCCAGCGTCGCCCCCTTCGAGGGGGAAGCGCGTTAGCGCTTC

>NZ_CP021109|5|5|719118-719221|CRISPRCasFinder
GCGTCGCCCCCTTCGAGGGGGAGGCGCGTTAGCGCTTC	GGGGGTGGGCTTTCCCTCCGGTCCGCCA
GCGTCGCCCCCTTCGAGGGGGAAGCGCGTTAGCGCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086056116.1\|712908_713898_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP021109.1\|WP_086073493.1\|714834_715725_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP021109.1\|WP_086073495.1\|720917_721673_+\|DUF899-domain-containing-protein	unknown	unknown	gnl\|CDD\|377584
NZ_CP021109.1\|WP_086071508.1\|713985_714672_-\|RraA-family-protein	unknown	unknown	gnl\|CDD\|223756
NZ_CP021109.1\|WP_086071509.1\|716025_716505_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP021109.1\|WP_086071512.1\|718448_718901_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380362
NZ_CP021109.1\|WP_086056123.1\|720381_720702_+\|DUF4148-domain-containing-protein	unknown	unknown	gnl\|CDD\|379321
NZ_CP021109.1\|WP_086073496.1\|727274_728153_-\|glycine-betaine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270329
NZ_CP021109.1\|WP_086071510.1\|716536_717031_+\|Ohr-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|274649
NZ_CP021109.1\|WP_086071513.1\|721727_722075_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP021109.1\|WP_086071515.1\|723841_724651_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227773
NZ_CP021109.1\|WP_086056115.1\|711960_712854_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP021109.1\|WP_086056130.1\|728300_729017_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP021109.1\|WP_086056129.1\|726607_727261_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224095
NZ_CP021109.1\|WP_086071511.1\|717037_718102_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP021109.1\|WP_086071516.1\|724647_725250_-\|DUF1326-domain-containing-protein	unknown	unknown	gnl\|CDD\|227875
NZ_CP021109.1\|WP_086056128.1\|725453_726611_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP021109.1\|WP_086071507.1\|709098_710847_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NZ_CP021109.1\|WP_086056114.1\|710843_711929_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP021109.1\|WP_086071514.1\|722128_723796_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|372629

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086056116.1\|712908_713898_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	5.72178e-124
NZ_CP021109.1\|WP_086073493.1\|714834_715725_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	5.42889e-68
NZ_CP021109.1\|WP_086073495.1\|720917_721673_+\|DUF899-domain-containing-protein	gnl\|CDD\|377584	pfam05988, DUF899, Bacterial protein of unknown function (DUF899). This family consists of several uncharacterized bacterial proteins of unknown function.	1.08583e-102
NZ_CP021109.1\|WP_086071508.1\|713985_714672_-\|RraA-family-protein	gnl\|CDD\|223756	COG0684, MenG, Demethylmenaquinone methyltransferase [Coenzyme metabolism].	3.54437e-48
NZ_CP021109.1\|WP_086071509.1\|716025_716505_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	6.96687e-30
NZ_CP021109.1\|WP_086071512.1\|718448_718901_-\|cupin-domain-containing-protein	gnl\|CDD\|380362	cd02234, cupin_BLR7677-like, Bradyrhizobium japonicum BLR7677 and related proteins, cupin domain. This family includes bacterial and fungal proteins homologous to BLR7677, a Bradyrhizobium japonicum protein of unknown function. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.20153e-44
NZ_CP021109.1\|WP_086056123.1\|720381_720702_+\|DUF4148-domain-containing-protein	gnl\|CDD\|379321	pfam13663, DUF4148, Domain of unknown function (DUF4148).	1.35606e-05
NZ_CP021109.1\|WP_086073496.1\|727274_728153_-\|glycine-betaine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270329	cd13611, PBP2_YehZ, Substrate-binding domain YehZ of an osmoregulated ABC-type transporter; the type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein YehZ of Clostridium sticklandii is predicted to be involved in uptake of compatible solutes such as choline, L-proline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. YehZ belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.55015e-137
NZ_CP021109.1\|WP_086071510.1\|716536_717031_+\|Ohr-family-peroxiredoxin	gnl\|CDD\|274649	TIGR03561, organ_hyd_perox, peroxiredoxin, Ohr subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein Ohr, or organic hydroperoxide resistance protein. [Cellular processes, Detoxification].	1.82496e-41
NZ_CP021109.1\|WP_086071513.1\|721727_722075_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	1.66713e-30
NZ_CP021109.1\|WP_086071515.1\|723841_724651_-\|hypothetical-protein	gnl\|CDD\|227773	COG5486, COG5486, Predicted metal-binding integral membrane protein [Function unknown].	6.74111e-63
NZ_CP021109.1\|WP_086056115.1\|711960_712854_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.14132e-32
NZ_CP021109.1\|WP_086056130.1\|728300_729017_-\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	6.17189e-65
NZ_CP021109.1\|WP_086056129.1\|726607_727261_-\|ABC-transporter-permease	gnl\|CDD\|224095	COG1174, OpuBB, ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism].	4.03457e-71
NZ_CP021109.1\|WP_086071511.1\|717037_718102_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.83595e-76
NZ_CP021109.1\|WP_086071516.1\|724647_725250_-\|DUF1326-domain-containing-protein	gnl\|CDD\|227875	COG5588, COG5588, Uncharacterized conserved protein [Function unknown].	8.47381e-71
NZ_CP021109.1\|WP_086056128.1\|725453_726611_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	3.055e-155
NZ_CP021109.1\|WP_086071507.1\|709098_710847_+\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	5.12585e-93
NZ_CP021109.1\|WP_086056114.1\|710843_711929_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	9.86992e-150
NZ_CP021109.1\|WP_086071514.1\|722128_723796_-\|AAA-family-ATPase	gnl\|CDD\|372629	pfam13538, UvrD_C_2, UvrD-like helicase C-terminal domain. This domain is found at the C-terminus of a wide variety of helicase enzymes. This domain has a AAA-like structural fold.	2.22713e-07

>NZ_CP021109.1|WP_086071512.1|718448_718901_-|cupin-domain-containing-protein
MPKIAGFTFALLAAGALLGQQALAASPAAAHAAHSGAAPAAPQAIVTPLMTRDMPDFPGKEAEMITVEYPPGAVDPIHRHDAHAFVYVLEGKIVMQVKGADPVTLTPGQTFYEGPNDIHIVGRNASQSQPAKFVVLLIKNKGAPALIPVQ
>NZ_CP021109.1|WP_086071511.1|717037_718102_-|LysR-family-transcriptional-regulator
MDNISSSSDGAGSPAGAIAAQGALSFPVAPGARADALAASFATSYAGVVAFIAVAAEGSFAKAGDRLGIGRSAVSRSVQKLEDQLGIRLFVRTTRSTSLTREGERFYANCHAGVERIVQALDDMRELREGPPSGRLRVSAAVGFGRKIVGPLLKDFRTAYPDIAVELLLDDRPTDFTSDGVDVSFRNGRMEDSQIIARQLVPMQMLLCASPAYIAAHGQPDRIEDLAHHRCVNFRLPSGRVYEWEFKVGGHIRRFAPQAPQAMLAFNDPDLVLQAVLDGEGIAQMAGYQIRDHLRDGTLTACLPQYAPDDRGHYICYLSRQHLPSRIRVFVDFMTTHIRALDLHTTESFLKPAS
>NZ_CP021109.1|WP_086071510.1|716536_717031_+|Ohr-family-peroxiredoxin
MNTPQPPPVEALAKYRGEAFRPLYTGTVTVSGGAAAHGRASGIARSDDGALDVALRLPLELGGPGGGSNPEQLFAAAFAACFHGGLSLLAARDGLQTCDASVRARVTFGRDPADGLYALTACIDIRLPGLDRAVADELVRNTERLCPYSKMARQGIHIVVALTG
>NZ_CP021109.1|WP_086071509.1|716025_716505_+|carboxymuconolactone-decarboxylase-family-protein
MSQRINAFAKSPELFKKYIEFSTLVKSSAIEAPLLHLIDIRASQMNGCGFCLDMHVKEAKIHGERELRLHHVAIWRESQLFSDRERAALAWTEVLTRLPEHGVPDEIYESVRAHFSEKELSDLSFAIMAINGWNRLNVGFRTPPGSADKAYGLDKANLE
>NZ_CP021109.1|WP_086073493.1|714834_715725_-|LysR-family-transcriptional-regulator
MNLRHLQFFVVLAETRNFTRAAQRLHVAQPALSQQIRTLEDRLGAALIDRRTRPLRLTEAGTFFLAEARQILSQYERASSAARDIGEGRRGWLGIGFTRSAMYSVLPPALKQFSRTHPGVELKLYEMLAEEHAAALKEHRIHIGIGRQAEPIPGCATQVLLQEKLMAVLPADHPLAKRPRLRVQHLAELPFVFYPKHPNARFPRLVESLCRDAGFTPRVAHQAYEIQTAIALVAAGLGVTLVGESVARHGRADVVYLPLSGASAAALTTLTATWRQDDDSPALADFLSVLLPAGRQ
>NZ_CP021109.1|WP_086071508.1|713985_714672_-|RraA-family-protein
MQPTAPAAGIPASRPIPSGYAELSTAEVSDALDRLGLPGSALGIASVSAAQRLLGRAYTVRYAPADVQPGTVGDYIDDVPAGAVVVLDNGGRTDCTVWGGILTEVASRRGIAGTVINGVCRDADAAAQFSYPLFSRGRFMRTGKDRVQVDEVNGDVSLGDVRVRPGDILLGDGDGVVVVPQAREDEVLALALRTRDAEQAIVDSVRAGMSLTQARQAHGYHTLQRRGR
>NZ_CP021109.1|WP_086056116.1|712908_713898_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKPRLSNALHTALAATPLALAMIAAAPSAQAAPYPCQNLKIVSPYPPGGTTDILARLIAPSLQGDLGVPVIVENRGGASSNIGTEYVARAEPDGCTVLLGNNTGIVINRNLYKLRLDPVEALRPVAEVAAMPLVLYVNPKVPAKTLPELVGLLQKSGTYSFASGGSGSPQHLAGELFRLATGADLLHIPYKGQGPAMMDVVGGQVQMAFETTAALSPQAKAGRVVPLATTGATRAAGFTDIPTMTEAGFKNFVITNWYGVFAPAGTPPALVTQLHAAVAKALANPEVAGKLAELGSEKVGGSPEEFAAFVASEVPRWEEVVKRSNAKVD
>NZ_CP021109.1|WP_086056115.1|711960_712854_+|LysR-family-transcriptional-regulator
MEIYQIRAFVKVARLGNLTRAAEALCLTQPAVTAQIKALEQSLGVALFDRNAGRLTLAKAGEVLLPTAEALLALGNQLRSEARGLQGALHGVLDLGVPSEQPDFLRLGELASEVTQRLPLIELKTHVLPTVQLSEQVMAGRLTAALAVAARPPLGLQWTPLRSVHYRIALPHEQAEAVKRGGWRELAQLPWLDGPAGSHAHLLLREMFERHGLAPRVVMQNDDHANLDALVRAGAGCALLREEIAMAGAAAGDFVVWGNARAAATLGFVLAPERAGEPLLVALESVMQKIWLGGPAA
>NZ_CP021109.1|WP_086056114.1|710843_711929_+|ABC-transporter-ATP-binding-protein
MKKVSVECRGISLSYGRTEVLKDLNLHIEPGEFFALLGPSGSGKSTLLRLIAGFNQHSQGQLLVDGKDMTGVPPWRRNIGMVFQNYALWPHMTVRDNVAFGLVERRVPRAEIRERTDAALALVGLSQYAGRRPNELSGGQQQRVALARTIVIEPQVLLLDEPLSNLDKKLRVQMRRELLALQRRLGITTIFVTHDQEEAMTTADRMAVLDRGVLQQIGAPHTLFDFPVNGFVANFVGTMNVLEGAVKERTSHSVTLAVDGVGDLQMPVHGEVPAAARLAASFRPHVVQIDMAGGNTDARYLWLPGVVQASEFQGEFTRYQVQVGERTITADQSHLAGLSIFPVGAPVTVGVEPAQIRLLAA
>NZ_CP021109.1|WP_086071507.1|709098_710847_+|iron-ABC-transporter-permease
MSLNLASSKGPAVVAACVIAFLAAFLIVPVATVFHAAFVNADGSITAGHFRAFFNQPLMQEAFYNSLYVAVWSTLIASVLAIPLAYFTVRFQFRGALLIQTLGILPLIMPPFVGAVAMQLIFGRSGSVNLLLGDWFDINLPLMEGLNSVIFVEALHYFPFILMNLVVALRNIDGAMEEAAFNLGSRGFRLFRRIIFPLALPGYVAGASLVFVKVFDDLGTPLVLGTTNMLAPQAYLRITQVGLEDPLGYVISVIIIAFSIASLWLSARVLKGKDYSTLQKGGAGIQKRRLRRGEAVLAYGWIILVLLLVLSPHIGVLLLSFASVWSFAPLPDGYTLAHYATVFQDSGGMIANTLLYCGLAAGIDVVLGTAIAYLLLRTRLPGRHWLDWLASAALAVPGIVLAIGLLRTFRHVELPFMATTLTSSWVIIMIAYSVRRLPYALRSCVAALQQINVSLEEAAQSLGANRWRTVRRVVVPLMAGGMLAGFVTSFITAAVELSATIMLVTRESQAPMSYGIYLYMQSASGRGPGAALGVLAVIAVAVGTYVSHVLVARTGARRPDRVEETLALDPQNAPATRRLETT
>NZ_CP021109.1|WP_086056123.1|720381_720702_+|DUF4148-domain-containing-protein
MKARSIVSTLVLSLAAIGAAQAQTTPFQGVYGKTYSNVTREQVVEELRAARAAGLTGNQDPDNQPFTPQKATPAANANIAVQPSRDEQSLAQLKFGDIDNMPFQGS
>NZ_CP021109.1|WP_086073495.1|720917_721673_+|DUF899-domain-containing-protein
MQAPPVVPREAWEAAWEQMLAKEKALTRARDALAAERRRMPWMAVEKSYAFDGPAGQASLLDLFDGRRQLIVYRAFFEPGVFGWPDHACRGCSMVADQVAHVSHLNARDTTLVFVSRAGQGDIARLKARMGWQMPWFTITDGFDADFGVDEWHGTNVFYRDGDRVYRTYFVNNRGDEQMGGTWNYLDITPLGRQETWEDSPPGYPQTPPYKWWNWHDSYVAGAPPDKKWVEVSDAGEAAFRKQGERGEPPL
>NZ_CP021109.1|WP_086071513.1|721727_722075_-|GFA-family-protein
MKYEGSCHCGRVRFEVEGDIASAMSCNCSMCQRKAALMWFVPRSAMRLLTPEQDLGTYTFNKHVIKHRFCPNCGIHPYGEGAQPSGEAMAAINLRCIDGLDLASIPVKHFDGRSI
>NZ_CP021109.1|WP_086071514.1|722128_723796_-|AAA-family-ATPase
MAHIIPDGWESQQRSGPAQRELETLARLKAGLPDDYTVYHAVHWTNVEGRHAIYGEIDFVIVNRAGELLVIEQKSGALDETPEGLAKRHGGKTQLIPVQMARTAENLRAKLARTLDGAEVRLDYLLYCPDHRVVAPTTAGLSPERIVDAGRRDRLCAVIREILPAGDPAPAAVRVDRFLRDIIRLEIDVSALIGQARTMVTRLAGGLAHWARQLDIEPYRLRVTGTAGSGKTQLALAEYRDAIEQGKRPLYVCFNRPLADHFNRIAPAGGLACSFHMLCDRLVRAAGGAPDFSQPDAFGRLVDQAESLPVSPDFLFDTVIVDEGQDFDARWRDMVLRLAKPDARVLWLEDPMQNLYGNTPPDLPGWVRLRAQSNFRSPRPVVGFLQTILPDDVRIDAQAPVTDADVELISYHDEESLARAVKLGIRKCYSAGFRQEDVAVLSYHGHKSSQVLAKDRLGPHLLRRFTGEYDLFGQPVYSSGDVLAESVYRFKGQSVPAVVFAEIDFQELDERAIRKLFVGATRATLKLVLVAAEPAAAVLREKLGVGLAQDDGALT
>NZ_CP021109.1|WP_086071515.1|723841_724651_-|hypothetical-protein
MNGAAAAASRPRQRRIFLPILAALIALSWAALWAWARSPYGRYLDHGDWTATGPAAYLCRAIPAGDIVVPAVLYGVAWILMTAAMMLPTVLPLFDIFGRLTARRRDRGRLLVLLGLGYMTVWAAFGALAHGLHAAVLALLARAPVLAWNGWLIGVACIALAGAFQFSRLKYRCLDSCRTPLSFVIRHWRGGSGARQAFVLGAHHGLFCVGCCWALMLLMFAVGMGSLGWMLLLASAMAIEKNLSWGARIRAPLGAALLALAVVMVAARL
>NZ_CP021109.1|WP_086071516.1|724647_725250_-|DUF1326-domain-containing-protein
MSYHLEGRLLEVCNCNVLCPCWIGEDPDNGTCDTIVAWRIDKGTVDDVDVGGNTIAAVAHVPGNILQGNWKAAIYVDDQASPEQEAALLKVYTGQAGGPIADLVQLVGEVVSVERAPIRFTVAEGKGELQIGDDYYAKLEPYLGATGAQTTLTDTIFSTVPGAPVFVGKAPRYRSRNDALGIDVDIKDHNALQSTFVFDA
>NZ_CP021109.1|WP_086056128.1|725453_726611_-|ABC-transporter-ATP-binding-protein
MIELDRLTKTYIQKDGKPFNAVDAVSLNVEEGEICVFLGPSGCGKTTTLKMINRLIQPTSGRVLINGQDTMALNEVELRRHIGYVIQQIGLFPNMTIEENITVVPRLLGWDKKRCRERAAELMAMVALDPKIYMKRYPRELSGGQQQRIGVIRALAADPPVLLMDEPFGAVDPINRESIQNEFFQMQRDLKKTVIMVSHDIDEAIKLGDKVAVFRRGKLVQFDHPDTLLAHPHDEFVAAFVGQDATLKRLLLVKAGDAATQPGTARMDTPLAEAYRMMEENDDRHLTIVDEHNQALGFVQRRVARSGQGVCGEHLRPFSASVGPDDNLRIVLSRMYQFNSSWMPVLDANNAYIGEVTQDSIADYLSSGRSRHATGQKPPAWQAAA
>NZ_CP021109.1|WP_086056129.1|726607_727261_-|ABC-transporter-permease
MTLFDYLSANWAELLELTLEHIWLVGSAVGFAILVGVPAGIFISRHEWLASPLLGVATVVLTLPSIALFGLMIPLLSRFGAGIGAVPAVIAVFLYSLLPIMRNTYLALHNVSPGIKEAGIGIGMTFWQRLRLVDLPLAVPVILGGVRTAVVMNIGVMTIAAVIGAGGLGTLILRAIGQSNMMKLLVGAVLVSLLAIVADFALQGLQRLLTSKGVQKP
>NZ_CP021109.1|WP_086073496.1|727274_728153_-|glycine-betaine-ABC-transporter-substrate-binding-protein
MCALMCALLPLCAAHAADTLRVGGKNFTEQYVLAQITADYLRQKGYSVDVRAGLGSTLMRSAQENGQLDIVWEYTGTAALVYNKIPDAVKLDPQALYEKVREADAPHGLVWLDPARLNNTYALGVPQQIAREWDVKTISQLVEKLRADNGRKHIFAMDAEFANRADGLKPLQALYGMKFDRSELKQMDPGLVYTALHNNQVTVGLIYTTDGRVRGFNIVALEDDRHYFPNYNATPVVRREVLDRHPDLARHLNALAAVLDNDVMLDMNKQVDIDGRSVRDVAADFLRTHKLP
>NZ_CP021109.1|WP_086056130.1|728300_729017_-|ABC-transporter-permease
MNIRLAKSAAMAAIIALAVLLLAHAIGEQALRQYSGDLRYYIGRHLILVGYSMALALIVGIPAGVLLSRRCAARYAERLMQVFNVGNTIPSLAVLAIALGVFGIGEPPAITALFLASLLPIVRNTYEGVKNVPAAMLEAARGIGMTPWQALVRVELPNALPIIIGGVRTALAINVGTAPLAYLIGADSLGTLIFPGIYLNNTPQMLIGAAATTALALILDGIVAGASRYALAWRGRLA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_6

1411334-1411450

Orphan

Consensus_repeat	Method
CGCCCCCTTGAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_6

>merge|NZ_CP021109|6|1411334-1411450|CRISPRCasFinder
CGCCCCCTTGAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCCACACCCTCGGCTTTGCCGGTCCGCAGGCGCGCCCCCTTGAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCC

>NZ_CP021109|6|6|1411334-1411450|CRISPRCasFinder
CGCCCCCTTGAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCC	ACACCCTCGGCTTTGCCGGTCCGCAGGCG
CGCCCCCTTGAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086056682.1\|1408845_1409559_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP021109.1\|WP_086071878.1\|1418659_1419073_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	unknown	unknown	gnl\|CDD\|274370
NZ_CP021109.1\|WP_086056679.1\|1406226_1407093_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP021109.1\|WP_086071875.1\|1414099_1415266_-\|2-methylcitrate-synthase	unknown	unknown	gnl\|CDD\|183463
NZ_CP021109.1\|WP_086073542.1\|1416482_1417472_-\|malate-dehydrogenase	unknown	unknown	gnl\|CDD\|235468
NZ_CP021109.1\|WP_086071874.1\|1412628_1414080_-\|bifunctional-2-methylcitrate-dehydratase/aconitate-hydratase	unknown	unknown	gnl\|CDD\|181845
NZ_CP021109.1\|WP_086056691.1\|1419075_1419459_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	unknown	unknown	gnl\|CDD\|239574
NZ_CP021109.1\|WP_086071873.1\|1412182_1412575_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086071876.1\|1415318_1416212_-\|methylisocitrate-lyase	unknown	unknown	gnl\|CDD\|183086
NZ_CP021109.1\|WP_086056681.1\|1408076_1408859_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP021109.1\|WP_086071871.1\|1410603_1411236_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|172475
NZ_CP021109.1\|WP_086071869.1\|1405040_1406210_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380559
NZ_CP021109.1\|WP_086071870.1\|1409562_1410369_+\|N-acyl-homoserine-lactonase-family-protein	unknown	unknown	gnl\|CDD\|293815
NZ_CP021109.1\|WP_086056675.1\|1402522_1403491_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP021109.1\|WP_086071872.1\|1411473_1412100_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP021109.1\|WP_086056674.1\|1400878_1402303_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143432
NZ_CP021109.1\|WP_086071877.1\|1417756_1418539_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP021109.1\|WP_086071868.1\|1403674_1404058_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086056692.1\|1419462_1421241_+\|succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|180814
NZ_CP021109.1\|WP_086056680.1\|1407093_1408080_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086056682.1\|1408845_1409559_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.37827e-119
NZ_CP021109.1\|WP_086071878.1\|1418659_1419073_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	gnl\|CDD\|274370	TIGR02970, Succinate_dehydrogenase_cytochrome_b556_subunit, succinate dehydrogenase, cytochrome b556 subunit. In E. coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase, a TCA cycle enzyme, are SdhC and SdhD. This family is the SdhC, the cytochrome b subunit, called b556 in bacteria and b560 in mitochondria. SdhD (see TIGR02968) is called the hydrophobic membrane anchor subunit, although both SdhC and SdhD participate in anchoring the complex. In some bacteria, this cytochrome b subunit is replaced my a member of the cytochrome b558 family (see TIGR02046). [Energy metabolism, TCA cycle].	2.14948e-34
NZ_CP021109.1\|WP_086056679.1\|1406226_1407093_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	8.93478e-68
NZ_CP021109.1\|WP_086071875.1\|1414099_1415266_-\|2-methylcitrate-synthase	gnl\|CDD\|183463	PRK12351, PRK12351, methylcitrate synthase; Provisional.	0
NZ_CP021109.1\|WP_086073542.1\|1416482_1417472_-\|malate-dehydrogenase	gnl\|CDD\|235468	PRK05442, PRK05442, malate dehydrogenase; Provisional.	0
NZ_CP021109.1\|WP_086071874.1\|1412628_1414080_-\|bifunctional-2-methylcitrate-dehydratase/aconitate-hydratase	gnl\|CDD\|181845	PRK09425, prpD, bifunctional 2-methylcitrate dehydratase/aconitate hydratase.	0
NZ_CP021109.1\|WP_086056691.1\|1419075_1419459_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	gnl\|CDD\|239574	cd03494, SQR_TypeC_SdhD, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. E. coli SQR, a member of this subfamily, reduces the high potential quinine, ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. SdhD and SdhC are the two transmembrane proteins of bacterial SQRs. They contain heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	4.49236e-30
NZ_CP021109.1\|WP_086071876.1\|1415318_1416212_-\|methylisocitrate-lyase	gnl\|CDD\|183086	PRK11320, prpB, 2-methylisocitrate lyase; Provisional.	0
NZ_CP021109.1\|WP_086056681.1\|1408076_1408859_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	1.19801e-108
NZ_CP021109.1\|WP_086071871.1\|1410603_1411236_-\|glutathione-S-transferase	gnl\|CDD\|172475	PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional.	4.68492e-58
NZ_CP021109.1\|WP_086071869.1\|1405040_1406210_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380559	cd06336, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in transport of amino acids, peptides, or inorganic ions. This group includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. Members of this group are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, their ligand specificity has not been determined experimentally.	8.75925e-144
NZ_CP021109.1\|WP_086071870.1\|1409562_1410369_+\|N-acyl-homoserine-lactonase-family-protein	gnl\|CDD\|293815	cd07729, AHL_lactonase_MBL-fold, quorum-quenching N-acyl-homoserine lactonase, MBL-fold metallo-hydrolase domain. Acyl Homoserine Lactones (also known as AHLs) are signal molecules which coordinate gene expression in quorum sensing, in many Gram-negative bacteria. Quorum-quenching N-acyl-homoserine lactonase (also known as AHL lactonase, N-acyl-L-homoserine lactone hydrolase, EC 3.1.1.81) catalyzes the hydrolysis and opening of the homoserine lactone rings of AHLs, a reaction that can block quorum sensing. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.54636e-80
NZ_CP021109.1\|WP_086056675.1\|1402522_1403491_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.26961e-147
NZ_CP021109.1\|WP_086071872.1\|1411473_1412100_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	1.72483e-45
NZ_CP021109.1\|WP_086056674.1\|1400878_1402303_-\|aldehyde-dehydrogenase	gnl\|CDD\|143432	cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like. Uncharacterized aldehyde dehydrogenase from Candidatus pelagibacter (DhaS) and other related sequences are present in this CD.	0
NZ_CP021109.1\|WP_086071877.1\|1417756_1418539_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.0582e-64
NZ_CP021109.1\|WP_086056692.1\|1419462_1421241_+\|succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|180814	PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed.	0
NZ_CP021109.1\|WP_086056680.1\|1407093_1408080_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.2059e-67

>NZ_CP021109.1|WP_086071871.1|1410603_1411236_-|glutathione-S-transferase
MSIELFTWNTPNGRKISVALEEMGLPYTVRTVDIRNGEQHRPEFLRISPNNRIPAIVDPDGPEGKPVSVFESGAILLYLGEKTGKFLPAKLADRIPVLEWLMWQMGGFGPMPGQAHHFLGLENEDDKRYGAKRYVDETRRLYGVLDRRLAQVEFVAGPISVADFAIVGWAWRHERHKVDLADFPNVKRWYETMMARPATRRGFEVKLDSL
>NZ_CP021109.1|WP_086071870.1|1409562_1410369_+|N-acyl-homoserine-lactonase-family-protein
MAGSLPAYEVFALRYARMPRQRRDNFLGGDPHDGSMPMDFFVWLIRGADTVVLVDTGFNAAAAARRRRELLRCPVESLGTLGVRAEDVAHVILTHLHYDHAGNLDRLPRATFHVQDAEVEYATGRCMCHGALRHAYEADDVVTLVRRVYEDRVVFHDGDSGLMPGIGLLKIGGHTKGLQAVQVHTRRGWVVLASDASHYYENMGAGRPFPIVYNTADMLSGYARLRQAADSDDHIVPGHDPLVLARYPAMANEPDIVALHEPPSRQRQ
>NZ_CP021109.1|WP_086056682.1|1408845_1409559_+|ABC-transporter-ATP-binding-protein
MPMLEVDDLTVRYGNLAAVRAISFAVEAGQIVALIGANGAGKSSTLKAIMGLAPVSQGAIRMDGEDVARRPSSARVSSGVALSPEGRRLFGRMTVLDNLLTGAHAVRSRTATRRRLDEIYALFPRVHERRGQLAGSLSGGEQQMVAIGRALMAQPRLLMLDEPSLGIAPKIVGEIAQAIQRINQETGISIVLVEQNARLALRLAHQAYALANGEIVRAGAGAELLADPFVQKAYLGV
>NZ_CP021109.1|WP_086056681.1|1408076_1408859_+|ABC-transporter-ATP-binding-protein
MTAPLLDVQAVSRTFGGLAALRDVSFQVQPGEIVGLIGPNGAGKTTAFNVISGTLPPTAGRVLFEGADLSGGPPSRVVAAGLARTFQSTSTYPSATVADNVARGLLSRLRGSSVRLLAGRRDGLLAPAQMHQEVDAILAMLDLQPWRDAAAGALPYGVQKRLGIAIALAARPRMLLLDEPAAGLNHEECNELGRVLRKLHDEHGLTLLLVEHHMALVMSLCHRIVVLVQGEKIAEGSPQEIRQHPAVIEAYLGAPDYAHA
>NZ_CP021109.1|WP_086056680.1|1407093_1408080_+|branched-chain-amino-acid-ABC-transporter-permease
MKSTSQALDGASFARTLSGRGAPWLLGLLGVAALVPWFCGPFVLHLAVLVCLNAVVVSGLALIARTGQLSLGHAAFVAIGAYAAVLCQRLLGLPWLAACAVGVGAALVAAAALGWVIVRLRGVYFVLVTFAFGELVRLALLDWAPLTGGANGLANIPAVRIAGFAFDQRATFYALALVVVAGSILAMRAVFRRPIGQAIDAVAENPQLAESTGLSVRRIQLLAFACGSALAALGGVLQAGYVGYISPESFNTGISIGYIIMLVIGGRASIWGPLIGAMVLTPLPELFRGAVQTQHIFYGAALILILKFLPQGLAGLGGLTARAKEARP
>NZ_CP021109.1|WP_086056679.1|1406226_1407093_+|branched-chain-amino-acid-ABC-transporter-permease
MDWTLLAGQATINGLIVGLLYLLMAVGFTLVFGVMRMVNFAHGEFYMLGTFAAYFLMTHGGMSFLPTLAITFVLAVAGGAVVEWGVLRSFRRDELNGMIATLGLAMILQNLALMLFGPDPLSMPAIARGAMRFGKIVVPASRVYVVGFALLTLALLYGFLRYSKPGRALRAVVEDFEIASAQGIRARIYYPLGFGLGVGLAAVSGALMAPLFSVSPFVGATPLLKAFIVVILGGLGSLPGAAVAALALGLTESYASLFLSGSAADMLIFVIVIAMLVVRPAGLIGRGN
>NZ_CP021109.1|WP_086071869.1|1405040_1406210_+|ABC-transporter-substrate-binding-protein
MKVTTTTALLVACAAFAAGAARADETLKIGALVTLSGPGASWGQGMRNAAELAADQVNANGGLEVGGKKYRVSVVAYDDKYQANEAVTVANRLVFEDKVQYIIGPVGSAPVLAIQPITEKNKVIVLTLGFTAKALGPDKAYTFRPNVTTAEVAQPQIDWLVKTQGVSKVGALFPNDETGQQIASDLEAAYKKAGASLSAKEFFERDRVDFVPMLTRMMARGIDAIELDGNSPATAGLIVKQARELGFDGKIVRTGGPATQEIINVAGAQAAEGMFVHTPIDPNLPSTKAYAERYAAKYKQAMNGFSPAFYDGTQLLFEAMRRAGTVTDTARVRDEMEKLSDVDGVLGKLSWTGKAMYGIDHQLNAPFYVAEVKAGKEVVRARCTVEGCR
>NZ_CP021109.1|WP_086071868.1|1403674_1404058_+|hypothetical-protein
MYEQPNPSEQDLVHRFSAAARHYARPRDLDADILVQFGAAPVIVRVRSGAVADVAAPHAPLASWDFAIRGSVRGWQALWQAMPAPGWHDIFALTKRGEFAIEGRLQPLMAHLQFVKDLLAAPREGRA
>NZ_CP021109.1|WP_086056675.1|1402522_1403491_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRSKWMRACLLAAGLLAANAHADSYPDKPVTMVVPYPAGGATDVVARAVAEKLTGVWKQSVIVENRAGAGTTIGASYVARAAGDGYTLFMTTSAHTISGHLYPKLPYDPVKDFAPITLVTKVPLVLVVNPAVPAKSLQDFLAYLKQDGSNVNFASPGTGTAQHLSGELFKIATHANLTHVPYRGDAPAFTDLVGGQVQMMLATITSALPLIESGKLRALAVANDKRVPALASVPTFGEAGMPGFEAATWFGLLAPASIPPERVARIHDDVARIVDTPDMRKRIQDLGGEVVNSTPQAFAEFMRAEQDKWGRAVKASGATASN
>NZ_CP021109.1|WP_086056674.1|1400878_1402303_-|aldehyde-dehydrogenase
MLIGGAWVTAQADAFASVDPATGSQNYLISAATAEHVDAAVDAAWRAVRQPAWRDMLPHQRAAILRRIADGMEREAELFARLQMIENGKVWKECQAQVASAAATFRYYAGVCETVCGEVTPPRGNYLSMTRYEPYGVVAAITPWNSPLTMEAQKVAPALAAGNAVILKPSEVTSSPALELGRLALEAGVPAGILNVITGTGAVAGKRLVEHPGVRMVSFTGGTASGRAIARVAADKLMPVALELGGKSPHIVFADADLDAAVEGVAGGIFEGSGQSCVAGSRLYVQRAVADRFLEKLVARANAIKLDLPQAAGAQMGPIASFTHREKIESMVESARRDGAQVLTGAERPGDAALQPGAYYRPTILAGLSRDALVVREEIFGPVLCALPFDDEDDLIAQANDSVYGLASGVWTGDYRRAWRVATALEAGTVWINTYKQLSISTPFGGFKQSGIGREKGINGVRLYQQAKGIYFGL
>NZ_CP021109.1|WP_086071872.1|1411473_1412100_-|glutathione-S-transferase
MIKIWGRVNSVNVQKVLWCCDELSLPYERIDAGLHFGRNNEPDYLAKNPNGKVPTLEDDGFVLWESNSIIRYLAMQYGAASGIYPDEPKLRASVDRWMDWVLSTLQPVERHVFWGMVRTPPEQRDMAAIQSFADEAGKLWLMIDAHLQGRRFMEGDRFTLADIVLGAYCRRFIGLDGIARPQTPALQSWYDGLQQRPAFQRHIAPALT
>NZ_CP021109.1|WP_086071873.1|1412182_1412575_-|hypothetical-protein
MNSTIYVYALTTAFNIFVACAAVAAISLAAIWFFKLDRINDTLRHPLLQHRPFREYPRAIQAGIFLDYFLRLLFPRARKGLFGQANRNLAHVDPAHVPMAIKWPIMGLWAGCWIGLAAMITVWALLLVRH
>NZ_CP021109.1|WP_086071874.1|1412628_1414080_-|bifunctional-2-methylcitrate-dehydratase/aconitate-hydratase
MSTHISNVRPEPDQVLVDIADYVLNYEIKSDLAYETARNCLIDTLGCGLEALEYPACRKLLGPIVPGTIVPNGAKVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVGAGKPPLTMRKVLTAMIKAHEIQGCIALENSFNKVGLDHVVLVKVASTAVVAEMLGLSREEIINAVSLAWVDGQSLRTYRHAPNAGSRKSWAAGDATSRAVRLALIARTGEMGYPSVLTAKTWGFYDVSFKGQPFKFQRPYGSYVMENVLFKISYPAEFHSQTAVECAMQLHREMAAQGKRVEDIKKITIRTHEACIRIIDKKGPLNNPADRDHCIQYMVAVPLIFGHLTAADYEDAFASDPRIDALRDKIECVEDPAFTRDYHDPDKRSIANALTIEFNDGTRLGEVVCEYPIGHKRRRQEGIPLLEAKFRTNLARQFPARQQNRILDVSLDQKKLEAMPVHEYVDLYVI
>NZ_CP021109.1|WP_086071875.1|1414099_1415266_-|2-methylcitrate-synthase
MTTSDQDTQQPGFKPKKSVALSGVVAGNTALCTVGRSGNDLHYRGYDILDIADTSEFEEIAFLLVHGKLPNAAELKAYKRKLRALRGLPAQLQVALEALPASSHPMDVMRTAVSVLGCVLPEKDDHNLPGARDIADRLMACLGSALLYWYHYSHNGRIIDVETDDDSIGGHFLHLLHGETPSDEWVKAMHTSLILYAEHEFNASTFTCRVVAGTGSDMYSAIAGGIGALRGPKHGGANEVAFEVQSRYETPDEAEADIRRRVENKEVVIGFGHPVYTVSDPRNKVIKEIARNLSRQNGSMKLFDIAERIETVMADAKKMFANLDWYSAVSYHMMGVPTAMFTPLFVIARTAGWSAHIIEQRIDNKIIRPTANYVGPEDRKFVPLDKRK
>NZ_CP021109.1|WP_086071876.1|1415318_1416212_-|methylisocitrate-lyase
MSRPSSPGARFRQALVEESPLQIIGAINANHALLAKRAGYRAIYLSGGGVAAGSLGLPDLGINTLDDVLTDVRRITDVCDLPLLVDIDTGFGPSAFNIARTVKSLIKFGAAACHIEDQVGAKRCGHRPGKEIVSTEEMVDRVKAAADARTDTDFYLIARTDAIASHGVEAAIDRACRCVEAGADAIFAEAAYDLPTYDRFVKAVKVPVLANITEFGKTPLFTVDELKSVGVGMVLYPLSAFRAMNKAAEAVYTAIRRDGHQKNVLDLMQTRDELYDRIGYHEFESRLDALFQQQKSK
>NZ_CP021109.1|WP_086073542.1|1416482_1417472_-|malate-dehydrogenase
MSKPALRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKGVMMELDDCAFPLLQEMTAHSDPRTAFKDADIALLVGARPRGPGMERKDLLTVNAQIFTAQGRALNEVAKRDVKVLVVGNPANTNAYIAMKSAPDLPAENFTAMLRLDHNRALSQLAAKSGKAVADIEKLIVWGNHSPTMYPDIRFATVGGQSLAKLINDDAWNRDVFIPTVGKRGAAIIDARGLSSAASAANAAIDHVRDWVLGSNGKWVTMGVPSDGSYGIPEGIIYGVPVTTENGKYTRVTGLEIDAFSRERMDLTLKELLEERDGVKDLLK
>NZ_CP021109.1|WP_086071877.1|1417756_1418539_+|GntR-family-transcriptional-regulator
MADPRPETPTRTKGAAGQGGASAAFSPLYRQIKELLVQSLDRGEWKPGELIPSEIDLAARFQVSQGTVRKAVDELAAEHVLLRRQGKGTFVATHHEARVRYRFLRLASDEGAEAERAESRILECRRVRATAEIARALELRAGETVVAIRRLLTFGGIPTVLDDIYLPGSVFRRLTLELLTANKAPLYGFLESEFGVSMIRADEKLRAVGATTEAAAALNVAPGTPLLQVDRTSYTYGDRPMEIRRGLYLTDRYHYRNSLN
>NZ_CP021109.1|WP_086071878.1|1418659_1419073_+|succinate-dehydrogenase,-cytochrome-b556-subunit
MSDSAAKPRPQFRNISIPQILSYRLPLPGKVSILHRISGALLFLCLPLVLLPLLAASVGSPESFASVAGIAGNPIVKLILLVLIWGYLHHFCAGIRYLVLDLHKGIEKAQAQKSAGVVLGVSLALTVVFGLKLFGAW
>NZ_CP021109.1|WP_086056691.1|1419075_1419459_+|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein
MAVSKNYGAKRLVVGAHYGTLDFIAQRITAIILALYTIVLLVGILIMPGFTYENWKALFAFHVFALPLGQMLATLAFVSLIWHAWIGVRDIWMDYVRPVGVRLLMQVLTILWLVGSLVYFAQIIWRL
>NZ_CP021109.1|WP_086056692.1|1419462_1421241_+|succinate-dehydrogenase-flavoprotein-subunit
MVAVMNSLPRRQFDVVVVGAGGAGMRCSLQLAQAGLSVAVLSKVFPTRSHTVAAQGGVSASLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPSAVYEMEHFGMPFDRNPDGTIYQRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVASRTQFFVEWMALDLLRSESGDIVGVTALEMETGEIYILEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQDMEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPDGSYVVLKLDHLGAETINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQMGGIPTNYHGQVVTWQNGESKVVNGLYAIGECAAVSVHGANRLGTNSLLDLIVFGRATGNHIVASHPERQHSHQKVSQASLDASLDRVNKLESRTSGEKTQDVANAIRMSMQRHCGVFRTLELLNEGVTQIEELAKQADHIAFKDKSKVFNTARVEALELANMTEVARATIKSAANRTESRGAHALNDHPTRDDENWLKHTLWYSEGGRLDYKPVQMKPLTVESFPPKARTF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_7

1416301-1416392

Orphan

Consensus_repeat	Method
CCGCCGGTCCGCCAGCGTCGCCCCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_7

>merge|NZ_CP021109|7|1416301-1416392|CRISPRCasFinder
CCGCCGGTCCGCCAGCGTCGCCCCCTTGAGGGGGAAGCGCGTTAGCGCTTCGGGGGTGGGTTTTCCCCGCCGGTCCGCCAGGGTCGCCCCCT

>NZ_CP021109|7|7|1416301-1416392|CRISPRCasFinder
CCGCCGGTCCGCCAGCGTCGCCCCCT	TGAGGGGGAAGCGCGTTAGCGCTTCGGGGGTGGGTTTTCC
CCGCCGGTCCGCCAGGGTCGCCCCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086056695.1\|1422587_1423892_+\|citrate-(Si)-synthase	unknown	unknown	gnl\|CDD\|180164
NZ_CP021109.1\|WP_086056682.1\|1408845_1409559_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP021109.1\|WP_086071878.1\|1418659_1419073_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	unknown	unknown	gnl\|CDD\|274370
NZ_CP021109.1\|WP_086056692.1\|1419462_1421241_+\|succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|180814
NZ_CP021109.1\|WP_086071875.1\|1414099_1415266_-\|2-methylcitrate-synthase	unknown	unknown	gnl\|CDD\|183463
NZ_CP021109.1\|WP_086073542.1\|1416482_1417472_-\|malate-dehydrogenase	unknown	unknown	gnl\|CDD\|235468
NZ_CP021109.1\|WP_086071874.1\|1412628_1414080_-\|bifunctional-2-methylcitrate-dehydratase/aconitate-hydratase	unknown	unknown	gnl\|CDD\|181845
NZ_CP021109.1\|WP_086056691.1\|1419075_1419459_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	unknown	unknown	gnl\|CDD\|239574
NZ_CP021109.1\|WP_086056681.1\|1408076_1408859_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP021109.1\|WP_086071879.1\|1424029_1424479_-\|DUF2214-family-protein	unknown	unknown	gnl\|CDD\|378336
NZ_CP021109.1\|WP_086071873.1\|1412182_1412575_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086071876.1\|1415318_1416212_-\|methylisocitrate-lyase	unknown	unknown	gnl\|CDD\|183086
NZ_CP021109.1\|WP_086056693.1\|1421254_1421971_+\|succinate-dehydrogenase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|235652
NZ_CP021109.1\|WP_086071872.1\|1411473_1412100_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP021109.1\|WP_086071871.1\|1410603_1411236_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|172475
NZ_CP021109.1\|WP_086056680.1\|1407093_1408080_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP021109.1\|WP_086071870.1\|1409562_1410369_+\|N-acyl-homoserine-lactonase-family-protein	unknown	unknown	gnl\|CDD\|293815
NZ_CP021109.1\|WP_086071877.1\|1417756_1418539_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP021109.1\|WP_086056694.1\|1422307_1422568_+\|succinate-dehydrogenase-assembly-factor-2	unknown	unknown	gnl\|CDD\|225489
NZ_CP021109.1\|WP_086056697.1\|1424719_1427026_-\|NADP-dependent-malic-enzyme	unknown	unknown	gnl\|CDD\|235976

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086056695.1\|1422587_1423892_+\|citrate-(Si)-synthase	gnl\|CDD\|180164	PRK05614, gltA, citrate synthase.	0
NZ_CP021109.1\|WP_086056682.1\|1408845_1409559_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.37827e-119
NZ_CP021109.1\|WP_086071878.1\|1418659_1419073_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	gnl\|CDD\|274370	TIGR02970, Succinate_dehydrogenase_cytochrome_b556_subunit, succinate dehydrogenase, cytochrome b556 subunit. In E. coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase, a TCA cycle enzyme, are SdhC and SdhD. This family is the SdhC, the cytochrome b subunit, called b556 in bacteria and b560 in mitochondria. SdhD (see TIGR02968) is called the hydrophobic membrane anchor subunit, although both SdhC and SdhD participate in anchoring the complex. In some bacteria, this cytochrome b subunit is replaced my a member of the cytochrome b558 family (see TIGR02046). [Energy metabolism, TCA cycle].	2.14948e-34
NZ_CP021109.1\|WP_086056692.1\|1419462_1421241_+\|succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|180814	PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed.	0
NZ_CP021109.1\|WP_086071875.1\|1414099_1415266_-\|2-methylcitrate-synthase	gnl\|CDD\|183463	PRK12351, PRK12351, methylcitrate synthase; Provisional.	0
NZ_CP021109.1\|WP_086073542.1\|1416482_1417472_-\|malate-dehydrogenase	gnl\|CDD\|235468	PRK05442, PRK05442, malate dehydrogenase; Provisional.	0
NZ_CP021109.1\|WP_086071874.1\|1412628_1414080_-\|bifunctional-2-methylcitrate-dehydratase/aconitate-hydratase	gnl\|CDD\|181845	PRK09425, prpD, bifunctional 2-methylcitrate dehydratase/aconitate hydratase.	0
NZ_CP021109.1\|WP_086056691.1\|1419075_1419459_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	gnl\|CDD\|239574	cd03494, SQR_TypeC_SdhD, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. E. coli SQR, a member of this subfamily, reduces the high potential quinine, ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Members of this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. SdhD and SdhC are the two transmembrane proteins of bacterial SQRs. They contain heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	4.49236e-30
NZ_CP021109.1\|WP_086056681.1\|1408076_1408859_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	1.19801e-108
NZ_CP021109.1\|WP_086071879.1\|1424029_1424479_-\|DUF2214-family-protein	gnl\|CDD\|378336	pfam09980, DUF2214, Predicted membrane protein (DUF2214). This domain, found in various hypothetical bacterial proteins, has no known function.	4.5924e-50
NZ_CP021109.1\|WP_086071876.1\|1415318_1416212_-\|methylisocitrate-lyase	gnl\|CDD\|183086	PRK11320, prpB, 2-methylisocitrate lyase; Provisional.	0
NZ_CP021109.1\|WP_086056693.1\|1421254_1421971_+\|succinate-dehydrogenase-iron-sulfur-subunit	gnl\|CDD\|235652	PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed.	2.42792e-172
NZ_CP021109.1\|WP_086071872.1\|1411473_1412100_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	1.72483e-45
NZ_CP021109.1\|WP_086071871.1\|1410603_1411236_-\|glutathione-S-transferase	gnl\|CDD\|172475	PRK13972, PRK13972, GSH-dependent disulfide bond oxidoreductase; Provisional.	4.68492e-58
NZ_CP021109.1\|WP_086056680.1\|1407093_1408080_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.2059e-67
NZ_CP021109.1\|WP_086071870.1\|1409562_1410369_+\|N-acyl-homoserine-lactonase-family-protein	gnl\|CDD\|293815	cd07729, AHL_lactonase_MBL-fold, quorum-quenching N-acyl-homoserine lactonase, MBL-fold metallo-hydrolase domain. Acyl Homoserine Lactones (also known as AHLs) are signal molecules which coordinate gene expression in quorum sensing, in many Gram-negative bacteria. Quorum-quenching N-acyl-homoserine lactonase (also known as AHL lactonase, N-acyl-L-homoserine lactone hydrolase, EC 3.1.1.81) catalyzes the hydrolysis and opening of the homoserine lactone rings of AHLs, a reaction that can block quorum sensing. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.54636e-80
NZ_CP021109.1\|WP_086071877.1\|1417756_1418539_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.0582e-64
NZ_CP021109.1\|WP_086056694.1\|1422307_1422568_+\|succinate-dehydrogenase-assembly-factor-2	gnl\|CDD\|225489	COG2938, COG2938, Uncharacterized conserved protein [Function unknown].	1.64034e-19
NZ_CP021109.1\|WP_086056697.1\|1424719_1427026_-\|NADP-dependent-malic-enzyme	gnl\|CDD\|235976	PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed.	0

>NZ_CP021109.1|WP_086071876.1|1415318_1416212_-|methylisocitrate-lyase
MSRPSSPGARFRQALVEESPLQIIGAINANHALLAKRAGYRAIYLSGGGVAAGSLGLPDLGINTLDDVLTDVRRITDVCDLPLLVDIDTGFGPSAFNIARTVKSLIKFGAAACHIEDQVGAKRCGHRPGKEIVSTEEMVDRVKAAADARTDTDFYLIARTDAIASHGVEAAIDRACRCVEAGADAIFAEAAYDLPTYDRFVKAVKVPVLANITEFGKTPLFTVDELKSVGVGMVLYPLSAFRAMNKAAEAVYTAIRRDGHQKNVLDLMQTRDELYDRIGYHEFESRLDALFQQQKSK
>NZ_CP021109.1|WP_086071875.1|1414099_1415266_-|2-methylcitrate-synthase
MTTSDQDTQQPGFKPKKSVALSGVVAGNTALCTVGRSGNDLHYRGYDILDIADTSEFEEIAFLLVHGKLPNAAELKAYKRKLRALRGLPAQLQVALEALPASSHPMDVMRTAVSVLGCVLPEKDDHNLPGARDIADRLMACLGSALLYWYHYSHNGRIIDVETDDDSIGGHFLHLLHGETPSDEWVKAMHTSLILYAEHEFNASTFTCRVVAGTGSDMYSAIAGGIGALRGPKHGGANEVAFEVQSRYETPDEAEADIRRRVENKEVVIGFGHPVYTVSDPRNKVIKEIARNLSRQNGSMKLFDIAERIETVMADAKKMFANLDWYSAVSYHMMGVPTAMFTPLFVIARTAGWSAHIIEQRIDNKIIRPTANYVGPEDRKFVPLDKRK
>NZ_CP021109.1|WP_086071874.1|1412628_1414080_-|bifunctional-2-methylcitrate-dehydratase/aconitate-hydratase
MSTHISNVRPEPDQVLVDIADYVLNYEIKSDLAYETARNCLIDTLGCGLEALEYPACRKLLGPIVPGTIVPNGAKVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGILATADWLSRNAVGAGKPPLTMRKVLTAMIKAHEIQGCIALENSFNKVGLDHVVLVKVASTAVVAEMLGLSREEIINAVSLAWVDGQSLRTYRHAPNAGSRKSWAAGDATSRAVRLALIARTGEMGYPSVLTAKTWGFYDVSFKGQPFKFQRPYGSYVMENVLFKISYPAEFHSQTAVECAMQLHREMAAQGKRVEDIKKITIRTHEACIRIIDKKGPLNNPADRDHCIQYMVAVPLIFGHLTAADYEDAFASDPRIDALRDKIECVEDPAFTRDYHDPDKRSIANALTIEFNDGTRLGEVVCEYPIGHKRRRQEGIPLLEAKFRTNLARQFPARQQNRILDVSLDQKKLEAMPVHEYVDLYVI
>NZ_CP021109.1|WP_086071873.1|1412182_1412575_-|hypothetical-protein
MNSTIYVYALTTAFNIFVACAAVAAISLAAIWFFKLDRINDTLRHPLLQHRPFREYPRAIQAGIFLDYFLRLLFPRARKGLFGQANRNLAHVDPAHVPMAIKWPIMGLWAGCWIGLAAMITVWALLLVRH
>NZ_CP021109.1|WP_086071872.1|1411473_1412100_-|glutathione-S-transferase
MIKIWGRVNSVNVQKVLWCCDELSLPYERIDAGLHFGRNNEPDYLAKNPNGKVPTLEDDGFVLWESNSIIRYLAMQYGAASGIYPDEPKLRASVDRWMDWVLSTLQPVERHVFWGMVRTPPEQRDMAAIQSFADEAGKLWLMIDAHLQGRRFMEGDRFTLADIVLGAYCRRFIGLDGIARPQTPALQSWYDGLQQRPAFQRHIAPALT
>NZ_CP021109.1|WP_086071871.1|1410603_1411236_-|glutathione-S-transferase
MSIELFTWNTPNGRKISVALEEMGLPYTVRTVDIRNGEQHRPEFLRISPNNRIPAIVDPDGPEGKPVSVFESGAILLYLGEKTGKFLPAKLADRIPVLEWLMWQMGGFGPMPGQAHHFLGLENEDDKRYGAKRYVDETRRLYGVLDRRLAQVEFVAGPISVADFAIVGWAWRHERHKVDLADFPNVKRWYETMMARPATRRGFEVKLDSL
>NZ_CP021109.1|WP_086071870.1|1409562_1410369_+|N-acyl-homoserine-lactonase-family-protein
MAGSLPAYEVFALRYARMPRQRRDNFLGGDPHDGSMPMDFFVWLIRGADTVVLVDTGFNAAAAARRRRELLRCPVESLGTLGVRAEDVAHVILTHLHYDHAGNLDRLPRATFHVQDAEVEYATGRCMCHGALRHAYEADDVVTLVRRVYEDRVVFHDGDSGLMPGIGLLKIGGHTKGLQAVQVHTRRGWVVLASDASHYYENMGAGRPFPIVYNTADMLSGYARLRQAADSDDHIVPGHDPLVLARYPAMANEPDIVALHEPPSRQRQ
>NZ_CP021109.1|WP_086056682.1|1408845_1409559_+|ABC-transporter-ATP-binding-protein
MPMLEVDDLTVRYGNLAAVRAISFAVEAGQIVALIGANGAGKSSTLKAIMGLAPVSQGAIRMDGEDVARRPSSARVSSGVALSPEGRRLFGRMTVLDNLLTGAHAVRSRTATRRRLDEIYALFPRVHERRGQLAGSLSGGEQQMVAIGRALMAQPRLLMLDEPSLGIAPKIVGEIAQAIQRINQETGISIVLVEQNARLALRLAHQAYALANGEIVRAGAGAELLADPFVQKAYLGV
>NZ_CP021109.1|WP_086056681.1|1408076_1408859_+|ABC-transporter-ATP-binding-protein
MTAPLLDVQAVSRTFGGLAALRDVSFQVQPGEIVGLIGPNGAGKTTAFNVISGTLPPTAGRVLFEGADLSGGPPSRVVAAGLARTFQSTSTYPSATVADNVARGLLSRLRGSSVRLLAGRRDGLLAPAQMHQEVDAILAMLDLQPWRDAAAGALPYGVQKRLGIAIALAARPRMLLLDEPAAGLNHEECNELGRVLRKLHDEHGLTLLLVEHHMALVMSLCHRIVVLVQGEKIAEGSPQEIRQHPAVIEAYLGAPDYAHA
>NZ_CP021109.1|WP_086056680.1|1407093_1408080_+|branched-chain-amino-acid-ABC-transporter-permease
MKSTSQALDGASFARTLSGRGAPWLLGLLGVAALVPWFCGPFVLHLAVLVCLNAVVVSGLALIARTGQLSLGHAAFVAIGAYAAVLCQRLLGLPWLAACAVGVGAALVAAAALGWVIVRLRGVYFVLVTFAFGELVRLALLDWAPLTGGANGLANIPAVRIAGFAFDQRATFYALALVVVAGSILAMRAVFRRPIGQAIDAVAENPQLAESTGLSVRRIQLLAFACGSALAALGGVLQAGYVGYISPESFNTGISIGYIIMLVIGGRASIWGPLIGAMVLTPLPELFRGAVQTQHIFYGAALILILKFLPQGLAGLGGLTARAKEARP
>NZ_CP021109.1|WP_086073542.1|1416482_1417472_-|malate-dehydrogenase
MSKPALRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDEKAQKALKGVMMELDDCAFPLLQEMTAHSDPRTAFKDADIALLVGARPRGPGMERKDLLTVNAQIFTAQGRALNEVAKRDVKVLVVGNPANTNAYIAMKSAPDLPAENFTAMLRLDHNRALSQLAAKSGKAVADIEKLIVWGNHSPTMYPDIRFATVGGQSLAKLINDDAWNRDVFIPTVGKRGAAIIDARGLSSAASAANAAIDHVRDWVLGSNGKWVTMGVPSDGSYGIPEGIIYGVPVTTENGKYTRVTGLEIDAFSRERMDLTLKELLEERDGVKDLLK
>NZ_CP021109.1|WP_086071877.1|1417756_1418539_+|GntR-family-transcriptional-regulator
MADPRPETPTRTKGAAGQGGASAAFSPLYRQIKELLVQSLDRGEWKPGELIPSEIDLAARFQVSQGTVRKAVDELAAEHVLLRRQGKGTFVATHHEARVRYRFLRLASDEGAEAERAESRILECRRVRATAEIARALELRAGETVVAIRRLLTFGGIPTVLDDIYLPGSVFRRLTLELLTANKAPLYGFLESEFGVSMIRADEKLRAVGATTEAAAALNVAPGTPLLQVDRTSYTYGDRPMEIRRGLYLTDRYHYRNSLN
>NZ_CP021109.1|WP_086071878.1|1418659_1419073_+|succinate-dehydrogenase,-cytochrome-b556-subunit
MSDSAAKPRPQFRNISIPQILSYRLPLPGKVSILHRISGALLFLCLPLVLLPLLAASVGSPESFASVAGIAGNPIVKLILLVLIWGYLHHFCAGIRYLVLDLHKGIEKAQAQKSAGVVLGVSLALTVVFGLKLFGAW
>NZ_CP021109.1|WP_086056691.1|1419075_1419459_+|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein
MAVSKNYGAKRLVVGAHYGTLDFIAQRITAIILALYTIVLLVGILIMPGFTYENWKALFAFHVFALPLGQMLATLAFVSLIWHAWIGVRDIWMDYVRPVGVRLLMQVLTILWLVGSLVYFAQIIWRL
>NZ_CP021109.1|WP_086056692.1|1419462_1421241_+|succinate-dehydrogenase-flavoprotein-subunit
MVAVMNSLPRRQFDVVVVGAGGAGMRCSLQLAQAGLSVAVLSKVFPTRSHTVAAQGGVSASLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPSAVYEMEHFGMPFDRNPDGTIYQRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVASRTQFFVEWMALDLLRSESGDIVGVTALEMETGEIYILEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQDMEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPDGSYVVLKLDHLGAETINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQMGGIPTNYHGQVVTWQNGESKVVNGLYAIGECAAVSVHGANRLGTNSLLDLIVFGRATGNHIVASHPERQHSHQKVSQASLDASLDRVNKLESRTSGEKTQDVANAIRMSMQRHCGVFRTLELLNEGVTQIEELAKQADHIAFKDKSKVFNTARVEALELANMTEVARATIKSAANRTESRGAHALNDHPTRDDENWLKHTLWYSEGGRLDYKPVQMKPLTVESFPPKARTF
>NZ_CP021109.1|WP_086056693.1|1421254_1421971_+|succinate-dehydrogenase-iron-sulfur-subunit
MSTKRIVKFEIYRYDPDKDERPYMQKLEVELQPNDKMLLDALVRIKNDVDDSLALRRSCREGVCGSDAMNINGKNGLACITNLRELKEPIVLKPLPGLPVIRDLIVDMTHFFNQYHSVKPYLINDTPPPERERLQSPEAREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYRFIADSRDEATGARLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIRELMVRRTV
>NZ_CP021109.1|WP_086056694.1|1422307_1422568_+|succinate-dehydrogenase-assembly-factor-2
MNALTELERARLRWRARRGLLENDLIITKYLDAYESQLTDADVAALTQLFELGDNDLLDLLLGRSEPEGALDTPKLREIIAKMREL
>NZ_CP021109.1|WP_086056695.1|1422587_1423892_+|citrate-(Si)-synthase
MKLSDKKATLTFSDGTAPIEFPIYQGSVGPDVIDIRKLYGQSGMFTYDPGFMSTASCSSAITYIDGDKGELLYRGYPIEQLAVNCDFLDVCYLILNGELPTPEQKKDFDSQVTHHTMVNEQLHFFLRGFRRDAHPMAVLTGLVGALSAFYHDSLDITNPQHRHISAIRLIAKMPTLVAMAYKYSQGQPFIYPQNNLSYTGNFLRMMFATPCEDYQVNEVVERALDRIFILHADHEQNASTSTVRLCGSSGTNPFAAIAAGVACLWGPAHGGANEACLQMLEELQANGGVAKVGEFMEKVKDKNSGVRLMGFGHRVYKNYDPRAKLMQQTCKEVLAALNLENDPLFKLAMELERIALEDQYFVDRKLYPNVDFYSGIVQRAIGIPTALFTANFALARTVGWIAQWNEMLTDPDYKIGRPRQLFTGSPRRDVKRGK
>NZ_CP021109.1|WP_086071879.1|1424029_1424479_-|DUF2214-family-protein
MLTDALLAWLHFMAIFTLIVPLTAQAVLLRPDMPAVAVRRLAVYDRVYLASALGVIVTGLLRLFYGAKGVAFIAPNPWFHAKMTLFVLIALLSLRPTLAFLRWQRQARMLPGFVPTNTEIKRIRRWVMAQAHLFVFLPLFAALMARGIR
>NZ_CP021109.1|WP_086056697.1|1424719_1427026_-|NADP-dependent-malic-enzyme
MDETLTKLALDYHAHPTPGKISVTPTKTLANQDDLSLAYSPGVAAACMAIHSGGDDAASKYTSRGNLVGVITNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFAGIDVFDIELAETDPDKLVDIIAALEPTLGGVNLEDIKAPECFYIEKKLRERMKIPVFHDDQHGTAIISSAAILNGLKVVGKQMDQVKLVCSGAGAAAIACLDLLVHLGVRRENIFVTDSRGVIWEGRDAEMEPNKKRYAQNTQARTLADIVKGADVFLGCSTAGVLTADMVKTMADKPLILALANPEPEIRPEIAKAARPDCIIATGRSDYPNQVNNVLCFPFIFRGAMDAGATRITEEMKLACVKAIAELAEAEQNDEVARAYAGQELSFGPDYIIPKPFDPRLIVKIAPAVAQAAAESGVATRPIQDMEAYRQKLMGFVYHSGPLMRPLFHQAKQAPKRVIYADGEDERVLRAVQTVVDEKLARPILIGRPSVIEMRIRKFGLRLAVGETIEIVDPEDDARFNETWSSYYQMRGRHGVTPAIAKAMVRKHNTLIGAMLLRRGDADALLCGVGSRYDNQLKYVDEVIGRKPGANAYAALNVLMLPDQTLFIADTHVNEDPTAEELADITIQAADEMLRFGVVPKVALLSHSNFGSRRTASSNKMAQARQIVSERAPHLEVDGEMHADAALSEAIRMASYPDSTLKGPANLLIMPNLDTGNITYNMLKMTGSHGIAMGPILLGAARPVHILTNSATVRRIVNMTALAVVDAQQEAAEAAKAANRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_8

1597029-1597149

Orphan

Consensus_repeat	Method
AGGCGCGCCCCCTTGAGGGGGAAGCGCGTCAGCGCTTCGGGGGTGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_8

>merge|NZ_CP021109|8|1597029-1597149|CRISPRCasFinder
AGGCGCGCCCCCTTGAGGGGGAAGCGCGTCAGCGCTTCGGGGGTGGGCCCTTCCCCTCGGCTTTGCCGGTCCGCAAGGCGCGCCCCCTTGAGGGGGAAGCGCGTCAGCGCTTCGGGGGTGG

>NZ_CP021109|8|8|1597029-1597149|CRISPRCasFinder
AGGCGCGCCCCCTTGAGGGGGAAGCGCGTCAGCGCTTCGGGGGTGG	GCCCTTCCCCTCGGCTTTGCCGGTCCGCA
AGGCGCGCCCCCTTGAGGGGGAAGCGCGTCAGCGCTTCGGGGGTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086071965.1\|1602669_1603521_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP021109.1\|WP_086071963.1\|1597151_1598816_-\|Na/Pi-cotransporter-family-protein	unknown	unknown	gnl\|CDD\|224202
NZ_CP021109.1\|WP_086056835.1\|1601773_1602655_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP021109.1\|WP_086071967.1\|1607520_1609410_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP021109.1\|WP_086059316.1\|1591522_1592149_-\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|224527
NZ_CP021109.1\|WP_086071962.1\|1596126_1596918_+\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|366780
NZ_CP021109.1\|WP_086071960.1\|1590328_1591201_-\|urease-accessory-protein	unknown	unknown	gnl\|CDD\|223899
NZ_CP021109.1\|WP_086056826.1\|1589017_1589323_-\|urease-subunit-beta	unknown	unknown	gnl\|CDD\|237303
NZ_CP021109.1\|WP_086071958.1\|1587267_1588971_-\|urease-subunit-alpha	unknown	unknown	gnl\|CDD\|237305
NZ_CP021109.1\|WP_086071957.1\|1586592_1587234_-\|urease-accessory-protein-UreE	unknown	unknown	gnl\|CDD\|237323
NZ_CP021109.1\|WP_086056838.1\|1605086_1606052_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP021109.1\|WP_086071961.1\|1595001_1595973_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235713
NZ_CP021109.1\|WP_086073555.1\|1599053_1600445_+\|L-serine-ammonia-lyase	unknown	unknown	gnl\|CDD\|273233
NZ_CP021109.1\|WP_086056828.1\|1590013_1590316_-\|urease-subunit-gamma	unknown	unknown	gnl\|CDD\|183913
NZ_CP021109.1\|WP_086071966.1\|1606561_1607473_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_CP021109.1\|WP_086059318.1\|1606334_1606565_+\|exodeoxyribonuclease-VII-small-subunit	unknown	unknown	gnl\|CDD\|179195
NZ_CP021109.1\|WP_086056830.1\|1592204_1594922_+\|DNA-polymerase-I	unknown	unknown	gnl\|CDD\|235591
NZ_CP021109.1\|WP_086071964.1\|1600715_1601588_-\|protease-HtpX	unknown	unknown	gnl\|CDD\|235478
NZ_CP021109.1\|WP_086056837.1\|1603784_1604930_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	unknown	unknown	gnl\|CDD\|226985
NZ_CP021109.1\|WP_086071959.1\|1589339_1589966_-\|HupE/UreJ-family-protein	unknown	unknown	gnl\|CDD\|368209

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086071965.1\|1602669_1603521_+\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	5.68444e-81
NZ_CP021109.1\|WP_086071963.1\|1597151_1598816_-\|Na/Pi-cotransporter-family-protein	gnl\|CDD\|224202	COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism].	6.85611e-120
NZ_CP021109.1\|WP_086056835.1\|1601773_1602655_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	1.85819e-10
NZ_CP021109.1\|WP_086071967.1\|1607520_1609410_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP021109.1\|WP_086059316.1\|1591522_1592149_-\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|224527	COG1611, COG1611, Predicted Rossmann fold nucleotide-binding protein [General function prediction only].	1.68978e-57
NZ_CP021109.1\|WP_086071962.1\|1596126_1596918_+\|dienelactone-hydrolase-family-protein	gnl\|CDD\|366780	pfam01738, DLH, Dienelactone hydrolase family.	6.04972e-74
NZ_CP021109.1\|WP_086071960.1\|1590328_1591201_-\|urease-accessory-protein	gnl\|CDD\|223899	COG0829, UreH, Urease accessory protein UreH [Posttranslational modification, protein turnover, chaperones].	1.43312e-76
NZ_CP021109.1\|WP_086056826.1\|1589017_1589323_-\|urease-subunit-beta	gnl\|CDD\|237303	PRK13203, ureB, urease subunit beta; Reviewed.	1.06092e-66
NZ_CP021109.1\|WP_086071958.1\|1587267_1588971_-\|urease-subunit-alpha	gnl\|CDD\|237305	PRK13207, ureC, urease subunit alpha; Reviewed.	0
NZ_CP021109.1\|WP_086071957.1\|1586592_1587234_-\|urease-accessory-protein-UreE	gnl\|CDD\|237323	PRK13263, ureE, urease accessory protein UreE; Provisional.	5.4387e-82
NZ_CP021109.1\|WP_086056838.1\|1605086_1606052_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	1.24211e-123
NZ_CP021109.1\|WP_086071961.1\|1595001_1595973_+\|SDR-family-oxidoreductase	gnl\|CDD\|235713	PRK06139, PRK06139, SDR family oxidoreductase.	1.3025e-127
NZ_CP021109.1\|WP_086073555.1\|1599053_1600445_+\|L-serine-ammonia-lyase	gnl\|CDD\|273233	TIGR00720, hypothetical_protein_NEICINOT_00681, L-serine dehydratase, iron-sulfur-dependent, single chain form. This enzyme is also called serine deaminase and L-serine dehydratase 1. L-serine ammonia-lyase converts serine into pyruvate in the gluconeogenesis pathway from serine. This enzyme is comprised of a single chain in Escherichia coli, Mycobacterium tuberculosis, and several other species, but has separate alpha and beta chains in Bacillus subtilis and related species. The beta and alpha chains are homologous to the N-terminal and C-terminal regions, respectively, but are rather deeply branched in a UPGMA tree. This enzyme requires iron and dithiothreitol for activation in vitro, and is a predicted 4Fe-4S protein. Escherichia coli Pseudomonas aeruginosa have two copies of this protein. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	0
NZ_CP021109.1\|WP_086056828.1\|1590013_1590316_-\|urease-subunit-gamma	gnl\|CDD\|183913	PRK13241, ureA, urease subunit gamma; Provisional.	3.19444e-74
NZ_CP021109.1\|WP_086071966.1\|1606561_1607473_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	1.73376e-86
NZ_CP021109.1\|WP_086059318.1\|1606334_1606565_+\|exodeoxyribonuclease-VII-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	2.13019e-22
NZ_CP021109.1\|WP_086056830.1\|1592204_1594922_+\|DNA-polymerase-I	gnl\|CDD\|235591	PRK05755, PRK05755, DNA polymerase I; Provisional.	0
NZ_CP021109.1\|WP_086071964.1\|1600715_1601588_-\|protease-HtpX	gnl\|CDD\|235478	PRK05457, PRK05457, protease HtpX.	1.39059e-178
NZ_CP021109.1\|WP_086056837.1\|1603784_1604930_-\|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha	gnl\|CDD\|226985	COG4638, HcaE, Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only].	5.28255e-41
NZ_CP021109.1\|WP_086071959.1\|1589339_1589966_-\|HupE/UreJ-family-protein	gnl\|CDD\|368209	pfam04955, HupE_UreJ, HupE / UreJ protein. This family of proteins are hydrogenase / urease accessory proteins. The alignment contains many conserved histidines that are likely to be involved in nickel binding. The members usually have five membrane-spanning regions.	1.53754e-36

>NZ_CP021109.1|WP_086071962.1|1596126_1596918_+|dienelactone-hydrolase-family-protein
MSFSPAAGNVQSTAIHTSPEGLTHGLIDLPVKDGTVPAYYATPEGKTNVPIVCVVQEIFGIHEHIQDICRRLAKEGYFAIAVNLYERQGDASTYTDIPTLIQDIVSKVPDEQVMADLDASVAWAAQHGGDDSRVGVTGFCWGGRITWMYTAYSPKVKAGVAWYGKLTQGHGPLIKRNAVDIAQELHGPVLGLYGGQDHSIPLADVDLMKQRLAAGNAHAKASRIDVYPDSGHAFLADYRPSYNEKDAKDAWSKMLAWFAQYLK
>NZ_CP021109.1|WP_086071961.1|1595001_1595973_+|SDR-family-oxidoreductase
MANQSPFTVVLTGASSGIGRATALAFAREGASLVLAARDRDALESVAQSCQRAGASALAVPTDVTEPDQMLALADSAIETFGGIDVWINNVGTGAVGRFDEVPLKAHRRVIEANLLGHLYGSHVALRHFRQRGRGVLINMVSVGGWAATPYAASYAASKFALRGFSESLRAELSDMPGIAVCEVYPTFVDTPGLTHAANYSGRRLRPTLPMLDPRDVAAALVALARRPRPSTMLGSVAWPARLAHMVTPDLSARVARRLMDAGFRRAHPAAMTDGNLFAPSTGHRIDGGLPPQGRRLETLLKWGMAAMAGFALWRAVSRGDGR
>NZ_CP021109.1|WP_086056830.1|1592204_1594922_+|DNA-polymerase-I
MNKTLLLVDGSSYLYRAYHAMPDLRNAQGEPTGALYGVINMLRKLKQDYDAQYAACIFDARGKTFRDDLYPEYKSHRPPMPDDLAAQIEPIHETVRALGWPVFAVEGVEADDVIGTLARIATEHGLKTIVSTGDKDLAQLVNEHVTLVNTMTNETLDPAGVVRKFGVPPERIVDYLMLIGDTVDNVPGVDKVGPKTAVKWLTEYGSIERLIEAADSIKGVAGNNLRNAIPNFPLTRKLLSVRCDCDLSAVVSGPEGLVPAEEDKEALLALYERYGFRTWLREISGESERVPTGDSRVAPERPAAPEQTDYRIITDWAAFDDWLEKLRAAPLAAVDTETTSLDEMQARLVGISFAIAPGVAAYIPVAHRGPEAGQQLPKDEVLQRLRFWLEDPAVPKLLHNAKYDAHVLANEGIRLAGVAEDTMLQAYVLESHRGVSLADLAQRWLGRSGVTYEELCGKGASQICFDEVAVDRAGHYAAEDADFTMQMHAILRPRVSANPGLERIYRLELQVSEVLTDIERTGVRVDAEELARQSHALGQEMLTLEQRAYELAGQPFNLNSPKQLGEILFGRMQLPVVRKTASGAPSTDEEVLSKLAQDYPLPQVLLEYRGLSKLKSTYTDKLPRMINPATGRVHTHYAQAAVITGRLASSEPNLQNIPVRTPAGRRVREAFIAEHGVLMSADYSQIELRIMAHVSDDANLQQAFAAGEDIHRATAAEVFGVPLEAVAAEQRRAAKAINFGLIYGMSVFGLAANLGITRDAAQAYIDRYFARYPGVAQYMESTRVLAREQGFVETVFGRRLWLPEIRGGSGPRRQAAERAAINAPMQGTAADLIKMAMVAVHQWIAREKLLTRMIMQVHDELVLEVPEAEAELVKAELPGLMCNVAQLRVPLVAEVGVGKNWEQAH
>NZ_CP021109.1|WP_086059316.1|1591522_1592149_-|TIGR00730-family-Rossman-fold-protein
MSEILTAAEKLRDLGPAVSIFGSARVSRDSPYYEKCEALSSALAQAGFAVIAGGGPGIMEAANKGAYDAGGTSVGLNIVLPHEANNNEYQTISLMFEYFYSRKATFFMHSFAYVALPGGFGTLDELFEALTLVQTGKVPPAPIVLMGKEYWHGVVDWLAKTVLTNGMIGAHDLELFIVEDDPEIVVRRIVDFHAKYLSPEQYAPSLPA
>NZ_CP021109.1|WP_086071960.1|1590328_1591201_-|urease-accessory-protein
MDAALPILDIPHTGGWLATLRLGLASRAGRTVLVERRHSGPLTVQKPLYPEPDPGICHLTLLHPPGGLASGDTLSVALSLAKGAHAVVTTPGATKWYKASPAWPSRQTLTLRVGDGARLDWLPLENIYFDHSQARQHTDIHLGRGATALGWDAALLGRQAAGEAWAAGQISGDVRLLSEDGRLLWAERQRLRAGSGLRQAPQGLAGLAAYGTLWAAGAACTAALAEALAPALPFDEGLRAGATSPVPGVLIVRAAAAHIEPLRNLFAALWLRLRPLVHGVPGRPLRLWAT
>NZ_CP021109.1|WP_086056828.1|1590013_1590316_-|urease-subunit-gamma
MKLTPREKDKLLIFTAALLAERRKARGLKLNYPEAVAYISAALMEGARDGRTVAELMDYGTTLLTRDDVMEGVPEMIPDVQIEATFPDGTKLVTVHHPIP
>NZ_CP021109.1|WP_086071959.1|1589339_1589966_-|HupE/UreJ-family-protein
MTPNPLDRARTAGTIAAIASVPALLYGAAAAAHPWTEHIAETGGMAASAMAGLLHPLTGADHLCAMIAVGIWSAMTARRAWMAPLAFAGVLLAGALLGLARLPMPGVEPMIAASLLVLGLMVATRARLPDWAGAGIAALFAFFHGHAHGAELPETAIAAAYIGGFMLATLALHGAGIGAGMLLRRAHAWVPRVTGLGVALYGAALLTA
>NZ_CP021109.1|WP_086056826.1|1589017_1589323_-|urease-subunit-beta
MIPGELLVDEGEIELNAGRATITLAVDNTGDRPIQVGSHFHFHEVNDALRFDRAAARGFRLNITAGTAVRFEPGQTRTVELVALDGERVVYGFAGRVMGRL
>NZ_CP021109.1|WP_086071958.1|1587267_1588971_-|urease-subunit-alpha
MSVKIGRRAYAEMFGPTTGDRLRLADTDLLIEIERDFTIYGEEVKFGGGKVIRDGMGQSQRIGAEVADTVITNAVILDHWGIVKADIGLKDGRIQAIGKAGNPDIQPGVTIVIGPGTEIIAGEGKIVTAGGIDSHVHFICPQLIDEALAAGLTTLLGGGTGPATGTAATTCTPGAWHIERMLAAADGWPINIGLLGKGNASQPAPLLEQIDAGAIGLKLHEDWGTTPAAIDCCLDVAERTDTQVAIHTDTLNEGGFVESTIAAFKGRTIHTYHTEGAGGGHAPDILKVAGLPNVLPSSTNPTRPYTVNTIDEHLDMLMVCHHLDAAIAEDVAFAESRIRRETIAAEDILQDLGAISMISSDSQAMGRIGEVILRTWQTAHKMKAQRGALPGDGRADNARAKRYIAKYTINPALTHGMAHEIGSIEAGKWADLVLWDPAFFGVKPEMVLKGGIITTALMGDPNASIPTPQPVHYREMFGARAGALARGSLTFVSQSAYQAGVAARYGLTKRVVPVQGIRGIRKSHMVHNDWQPRIDVDPETYRVVADGQELICEPARVLPMAQRYFLF
>NZ_CP021109.1|WP_086071957.1|1586592_1587234_-|urease-accessory-protein-UreE
MRRIEKAVGQGHTIAKALLRRAPTLTLPFESRSRSRLSATLDNGEAVALFLPRGTVLRDGDALIAEDGGLVRVVAAPEPVLRATCPDPHVLLRAAYHLGNRHTPVEVGRDYLQLEHDPVLRDLLLRLGLTVIAIDAPFEPEAGAYGGGHKHGHDETFAEDYALAQRAYQERHGGHGHGHDHGHAHGHGHGHDHDHGHGHDHHSPAGHRHGRKH
>NZ_CP021109.1|WP_086071963.1|1597151_1598816_-|Na/Pi-cotransporter-family-protein
MSGLLTLLDFAGYVALLLWGVHMVQTGVQRAFGAALGAALGRALGTRLRAFAAGLGITAALQSSTATGLMITGFAAGGVVGLVPALSAMLGANVGTTLIVQLLSFDLTALAPVLILCGVWMFRRYPPGRTRDLGRVFIGLGLLLMSLHSLVDLFIPFQNAPLLRIVLQALATQPFAAMAVAAVLTWAAHSSVAMVVLIMSMATHQLVPPEAAYAMVLGANLGTAINPMLEGVTGDDPAARRLPLGNLLTRAAGVVLGLAVLPWVDTWMHALGADDPSRAVANFHTLFNTVIAIVFLPALAPYAALLTRWLPKRVDPDDPARPQYLDESAHDVPAVALGNASREALRMADMLQTLLLVARAGFKRDNRHRMAQAKQLDTAVDKLETAITLYLATLDRENMTSEDTQRMEQILAFTSNIGHAADIVYSGLLSHAARLRKQGWTLAPDQRAQLDESLGHLLSNERRSAALFVNADLRQARALAGEKERFRALEAQASEAHLDKIKSGHIEAAEVGQLYLDILRDVKGVNSYLVGAAAYPVLAKEGELLPSRLRESAN
>NZ_CP021109.1|WP_086073555.1|1599053_1600445_+|L-serine-ammonia-lyase
MAVSVFDLFKIGIGPSSSHTVGPMRAALLFAQGLQRDGLLPRVASVRAELYGSLGATGKGHGTDKGVMLGLMGEAPDTVDPSAIAGMLQAVRASRVLPLLGQHRVPFIEKEHLLFYRREAMAEHPNGMKFHAFDADGASLRESRYLSVGGGFVVTAGASNTQVIAAHDQLPFPFRTGRELLEMAADSGLSVAGLMMRNEQVWRTEDEVRAGLDRIWEVMQQCVARGCGQDNPDADGELPGPLRVRRRAPELYRSLTQRAERTLSDPLSVMDWVNLYAIAVNEENAAGGRVVTAPTNGAAGIIPAVLHYYDRFVPGASRAGIHDFLLTAAAIGLLYKFNASISGAEVGCQGEVGVACSMAAGGLAAVLGGTVSQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNAMASIKAVNAARMALRGDGHHYVSLDSVIKTMRETGADMKTKYKETARGGLAVNIVEC
>NZ_CP021109.1|WP_086071964.1|1600715_1601588_-|protease-HtpX
MKRIVLFVLTNLAVMLVLSATLRILGIDRYLTMNGLNVSQLLVFSVVVGFTGAIISLLMSKSMAKWSTGAQVIAPNAPRTQQEAWLLDTVHQLADRAGIGRPEVAIYEGPPNAFATGAFKNDALVAVSTGLLESMTEEEVTAVLGHEVAHIANGDMVTLTLIQGVVNTFVVFLARVVGYFIDKAVFRSERGIGPGYYITVIVCEILFGIVASIIVAWFSRQREYRADAGSAHLLGSRDPMIRALARLGGLESGPLPKSFEASGIAGGGAISALFASHPPIQSRIAALQRG
>NZ_CP021109.1|WP_086056835.1|1601773_1602655_+|DMT-family-transporter
MQALWMLLASLMFAIMGSCVKLATEHNASLSQVVLFRGLPSVVLLLVWARAARQSIVPSSWKLHVWRNVAGVSSMWLGFFALSHLPLATATSLTYTSPLFIAAWMLGWGGAQRDMVRIISVGLGFLGVIAVLRPSIGDDQWLAALLGLGAGGAAAVAMMQIRELGRIGEPEWRTVLFFSCAVSLSSAVGLFAEGWGGADATGYVALTGIGVAGLFGQLAMTRAFGLGSALLTAALQYTTIIFAAVLGMAFWHDHLDEIAWVGMGLIIAAGLLSIWRTMRETRAGSAAKKEKQA
>NZ_CP021109.1|WP_086071965.1|1602669_1603521_+|sulfurtransferase
MRPAPLISASELAARLNDADVRVFDVRHDLGDFAAGRRQYEESHVAGARFLDNETELAGPRTGRNGRHPLPDRAALAGLMAAHGVRPETLVVGYDASGGQFAAHLWWLLRWIGHDRVAVLDGGWQAWTAGGLPVESGPAPQPEAPAQAVVRAPLVQAVDADAVLANLRSKSFTLVDARAAARYRGEVEPIDPEAGRIPGALNRPYTDNLEADGRFKSPAQLRQEFIAVIGDRPPESIVHQCGSGITASANLFAMEVAGLGGSRLYPGSWSEWISDPSRPREKG
>NZ_CP021109.1|WP_086056837.1|1603784_1604930_-|aromatic-ring-hydroxylating-dioxygenase-subunit-alpha
MTDIGRMAQFVPARTQLPVSAYFDEARFRREQERIFKQSALYVGHRKMVPEVGDWRTLVQENGGRALVHTSEGVELISNVCRHRQALMLGGVGGQADPAGNLKATGGNIVCPLHRWTYSPQGELLGAPQFESTPCMKLDRFRLRDCHGLLFEGPRDPAQDLGGLFARPEFDFGDYVLDHVEIHQCNYNWKTFIEVYLEDYHVGPFHPGLGRFVTCDDLTWEFGAWHSVQRVGVHQALANPGSDVYRAWHDRLLDYRQGQAPDFGAIWATYFPTHMIEVYPHVLVLSTLHPRGPQDTVNVVEFYYPEEIAAFEREFVEAQQAAYMETAKEDDEIAERMDAGRKALMERGVTEAGPYQSPMEDGMQHFHEWYRRIMEETDPHP
>NZ_CP021109.1|WP_086056838.1|1605086_1606052_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHAWLKIIAATALAAACGIAQAQDYPSRPIKVVSPFPAGGATDVLTRLLAERMSKDLGTSMIVENRAGAGTTIGASYVQREPADGYTILMATNSTLVTNRFLYKSLPYDPDGFAPIGMVGIGPLVLLSSPKTPFGNVKELVDYAHKHPGKVTFATFGPGTSSHLAAELFKSQTGTDMLHVPFKGATQALPALIAGDVDIFFDMVATGMPQADAGKVRVFGITSTQRLDSEPKLPTLAEQGYPKFDMTAWFSFVAPPHTPETALTKLRAALMEALKDETVRKKMLDMGIQPASGTAEALISQMKAEQPVVQQLVRQANIVLQ
>NZ_CP021109.1|WP_086059318.1|1606334_1606565_+|exodeoxyribonuclease-VII-small-subunit
MPQDFETALAQLEALVAAMEDGSLPLEESLAAYRRGVELTRICQERLAQAEQQVRVLEGDLLRPLDPDALDDESNG
>NZ_CP021109.1|WP_086071966.1|1606561_1607473_+|polyprenyl-synthetase-family-protein
MKHAHLAFQDWLADRAAHVERTLDELLPSVDTVPARLHEAMRYAVLGGGKRVRAALVYAAGQACPVTGHAAAIDASLDRAAAAVELIHAYSLVHDDLPCMDNDTLRRGRPTVHVQYDDATAMLVGDALQPLAFELLAEMPIAPALVVQATKVLARASGSLGMAGGQAIDLESVGRALDRDELQTMHGMKTGAMLAVSVALGGIVSGASSSARQALDDYAQAIGLAFQVVDDILDVTADTSRLGKTAGKDAAENKPTYVSLLGLDQARAFAQDLRAAALDALTPLGEGRARLAELADFIVLRDR
>NZ_CP021109.1|WP_086071967.1|1607520_1609410_+|1-deoxy-D-xylulose-5-phosphate-synthase
MTTDLLETIDSPADLKRLDRRALKKLADELRAFILASVSRTGGHLSSNLGTVELALALHTVFDTPDDRIVWDVGHQSYPHKILTGRREGMARLRQEGGISGFPRRSESEYDAFGTAHSSTSISAALGMAVASRNAGVSRQHIAVIGDGAMSAGMAFEAMNNAGVTPNINLLVILNDNDMSISPPVGALNRYLARLMSGRFYAAAKNMGKAVLQHVPPVLEFARRIEEHAKGMVTPATLFEEFGFNYVGPIDGHDLDALIPTLQNLKALQGLQFLHVVTRKGQGYKLAEADPVLYHGPGKFDPAVGIVPAKAPSKLTFTQVFGQWLCDMAEQDEKLVGITPAMREGSGLVEFEQRYPLRYFDVGIAEQHAVTFAAGLACEGQKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFALDRAGLVGADGATHAGNYDIAYLRCIPNMVVATPSDEAEARLLLTTCYRYPGPASVRYPRGGGRGAQVPATLDDVPVGKGVVRRHGATIAILCFGTLLPAVEKAAEALDATVADMRFVKPLDEALVRELASRHDALVTVEEGAIMGGAGSAVCEALNAAAVTIPVLQLGLPDRFIDHGDRQALLAAVGLDEHGIETAVRNRFGHLLDRPIQKVNRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_9

1639201-1639288

Orphan

Consensus_repeat	Method
GGCGGACCGGCGGAGCCGGATCCGCGGCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_9

>merge|NZ_CP021109|9|1639201-1639288|CRISPRCasFinder
GGCGGACCGGCGGAGCCGGATCCGCGGCGTCCCCGATCGCGGGGCATCTGTTTTCTTCGGCGGACCGGCGGAGCCGGATCCGGGGCGT

>NZ_CP021109|9|9|1639201-1639288|CRISPRCasFinder
GGCGGACCGGCGGAGCCGGATCCGCGGCGT	CCCCGATCGCGGGGCATCTGTTTTCTTC
GGCGGACCGGCGGAGCCGGATCCGGGGCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086071985.1\|1645261_1646011_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378479
NZ_CP021109.1\|WP_086056870.1\|1643350_1644151_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182574
NZ_CP021109.1\|WP_086056858.1\|1630655_1631372_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181044
NZ_CP021109.1\|WP_086071977.1\|1629352_1630495_+\|alanine-racemase	unknown	unknown	gnl\|CDD\|143500
NZ_CP021109.1\|WP_086071978.1\|1631398_1632778_+\|DNA-repair-protein-RadA	unknown	unknown	gnl\|CDD\|236994
NZ_CP021109.1\|WP_086071986.1\|1646182_1647553_+\|DNA-recombination-protein-RmuC	unknown	unknown	gnl\|CDD\|224241
NZ_CP021109.1\|WP_086071976.1\|1628328_1629165_-\|squalene-synthase-HpnC	unknown	unknown	gnl\|CDD\|274592
NZ_CP021109.1\|WP_086071979.1\|1633354_1634260_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377177
NZ_CP021109.1\|WP_086056867.1\|1640203_1641304_+\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
NZ_CP021109.1\|WP_086071983.1\|1639355_1640075_+\|3-deoxy-D-manno-octulosonic-acid-kinase	unknown	unknown	gnl\|CDD\|234975
NZ_CP021109.1\|WP_086071981.1\|1635656_1635854_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086056868.1\|1641309_1642437_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
NZ_CP021109.1\|WP_086071982.1\|1636057_1638610_+\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|225669
NZ_CP021109.1\|WP_157664820.1\|1635174_1635360_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073557.1\|1644517_1645210_+\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|234840
NZ_CP021109.1\|WP_086056869.1\|1642433_1643354_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182646
NZ_CP021109.1\|WP_086071987.1\|1647635_1648313_+\|ribose-5-phosphate-isomerase-RpiA	unknown	unknown	gnl\|CDD\|234816
NZ_CP021109.1\|WP_086056865.1\|1638606_1639035_+\|group-II-truncated-hemoglobin	unknown	unknown	gnl\|CDD\|381282
NZ_CP021109.1\|WP_086056860.1\|1634450_1634867_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180236
NZ_CP021109.1\|WP_086071984.1\|1644147_1644504_+\|arsenate-reductase	unknown	unknown	gnl\|CDD\|239333

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086071985.1\|1645261_1646011_-\|hypothetical-protein	gnl\|CDD\|378479	pfam10707, YrbL-PhoP_reg, PhoP regulatory network protein YrbL. This is a family of proteins that are activated by PhoP. PhoP protein controls the expression of a large number of genes that mediate adaptation to low Mg2+ environments and/or virulence in several bacterial species. YbrL is proposed to be acting in a loop activity with PhoP and PrmA analogous to the multicomponent loop in Salmonella where the PhoP-dependent PmrD protein activates the regulatory protein PmrA, and the activated PmrA then represses transcription from the PmrD promoter which harbours binding sites for both the PhoP and PmrA proteins. Expression of YrbL is induced in low Mg2+ in a PhoP-dependent fashion and repressed by Fe3+ in a PmrA-dependent manner.	2.09427e-67
NZ_CP021109.1\|WP_086056870.1\|1643350_1644151_+\|ABC-transporter-permease-subunit	gnl\|CDD\|182574	PRK10592, PRK10592, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	6.54856e-106
NZ_CP021109.1\|WP_086056858.1\|1630655_1631372_+\|SDR-family-oxidoreductase	gnl\|CDD\|181044	PRK07577, PRK07577, SDR family oxidoreductase.	3.7243e-149
NZ_CP021109.1\|WP_086071977.1\|1629352_1630495_+\|alanine-racemase	gnl\|CDD\|143500	cd06827, PLPDE_III_AR_proteobact, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases. This subfamily is composed mainly of proteobacterial alanine racemases (EC 5.1.1.1), fold type III PLP-dependent enzymes that catalyze the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. hese proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.	0
NZ_CP021109.1\|WP_086071978.1\|1631398_1632778_+\|DNA-repair-protein-RadA	gnl\|CDD\|236994	PRK11823, PRK11823, DNA repair protein RadA; Provisional.	0
NZ_CP021109.1\|WP_086071986.1\|1646182_1647553_+\|DNA-recombination-protein-RmuC	gnl\|CDD\|224241	COG1322, COG1322, Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only].	1.06201e-95
NZ_CP021109.1\|WP_086071976.1\|1628328_1629165_-\|squalene-synthase-HpnC	gnl\|CDD\|274592	TIGR03464, HpnC, squalene synthase HpnC. This family of genes are members of a superfamily (pfam00494) of phytoene and squalene synthases which catalyze the head-t0-head condensation of polyisoprene pyrophosphates. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. In the organisms Zymomonas mobilis and Bradyrhizobium japonicum these genes have been characterized as squalene synthases (farnesyl-pyrophosphate ligases). Often, these genes appear in tandem with the HpnD gene which appears to have resulted from an ancient gene duplication event. Presumably these proteins form a heteromeric complex, but this has not yet been experimentally demonstrated.	2.4124e-126
NZ_CP021109.1\|WP_086071979.1\|1633354_1634260_-\|hypothetical-protein	gnl\|CDD\|377177	pfam03961, FapA, Flagellar Assembly Protein A. Members of this family include FapA (flagellar assembly protein A), found in Vibrio vulnificus. The synthesis of flagella allows bacteria to respond to chemotaxis by facilitating motility. Studies examining the role of FapA show that the loss or delocalization of FapA results in a complete failure of the flagellar biosynthesis and motility in response to glucose mediated chemotaxis. The polar localization of FapA is required for flagellar synthesis, and dephosphorylated EIIAGlc (Glucose-permease IIA component) inhibited the polar localization of FapA through direct interaction.	0.000511397
NZ_CP021109.1\|WP_086056867.1\|1640203_1641304_+\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.17525e-161
NZ_CP021109.1\|WP_086071983.1\|1639355_1640075_+\|3-deoxy-D-manno-octulosonic-acid-kinase	gnl\|CDD\|234975	PRK01723, PRK01723, 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed.	3.47439e-89
NZ_CP021109.1\|WP_086056868.1\|1641309_1642437_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	5.86555e-163
NZ_CP021109.1\|WP_086071982.1\|1636057_1638610_+\|FtsX-like-permease-family-protein	gnl\|CDD\|225669	COG3127, COG3127, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	0
NZ_CP021109.1\|WP_086073557.1\|1644517_1645210_+\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|234840	PRK00802, PRK00802, DNA-3-methyladenine glycosylase.	3.22601e-70
NZ_CP021109.1\|WP_086056869.1\|1642433_1643354_+\|ABC-transporter-permease-subunit	gnl\|CDD\|182646	PRK10683, PRK10683, putrescine transporter subunit: membrane component of ABC superfamily; Provisional.	4.79765e-124
NZ_CP021109.1\|WP_086071987.1\|1647635_1648313_+\|ribose-5-phosphate-isomerase-RpiA	gnl\|CDD\|234816	PRK00702, PRK00702, ribose-5-phosphate isomerase RpiA.	3.01331e-120
NZ_CP021109.1\|WP_086056865.1\|1638606_1639035_+\|group-II-truncated-hemoglobin	gnl\|CDD\|381282	cd14773, TrHb2_PhHbO-like_O, Truncated hemoglobins, group 2 (O); Pseudoalteromonas haloplanktis PhHbO like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include Pseudoalteromonas haloplanktis PhHbO (encoded by the PSHAa0030 gene) which appears to be involved in oxidative and nitrosative stress resistance.	4.59e-61
NZ_CP021109.1\|WP_086056860.1\|1634450_1634867_-\|hypothetical-protein	gnl\|CDD\|180236	PRK05753, PRK05753, nucleoside diphosphate kinase regulator; Provisional.	2.04985e-31
NZ_CP021109.1\|WP_086071984.1\|1644147_1644504_+\|arsenate-reductase	gnl\|CDD\|239333	cd03035, ArsC_Yffb, Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine.	1.10348e-50

>NZ_CP021109.1|WP_086056865.1|1638606_1639035_+|group-II-truncated-hemoglobin
MTTTTRVQPIFEPLDHTRTIFEQLGGEPAVRELVNRFYDLMDIEEDFAALRAAHGPSLDAAREKLFLFLCGYFGGPDHYVQKYGHPRLRARHLPFSIGEAERDQWVACMGRAMQDMNVPAPLMDRLLHAFYGTADWMRNRAG
>NZ_CP021109.1|WP_086071982.1|1636057_1638610_+|FtsX-like-permease-family-protein
MHDTSAARLDAAIPASAPTGLSHSLRLGVRALLRDWRAGELRLLVIVLIVAVAAVTSVGFLADRVGRALERNAAQMLGADIVLDADEPIPAAFERRAREQGLRLARTYQFPSMASAGQSSQLVSLKAVEAGYPLRGGLRTAAEPAGLETATRDIPEPGTVWVDAQVLSALGVRMGDRIALGDSQFRIARVLTYEPDRGMQFVNLSPRVLMRADELAATHLLAPGSRVGYGLLAAGDASAVAAYSQWLQAHLQRGQKIATVESGRPEIRRMLDRAQRFLSLVALLAVLISAVAVALAATRFMVRHRDGIAIMRCLGATQAQIARMLAAEFLMVGLIASLVGGMFGYMAHLGLIAALGRMLDADLPSPSMVPGIQGLATGLWLLLGFALPSLAQLRHVPPARVLRRDVGLVRPGSAAGYAVGAAGFALLIWWFAGDAMLGVVIAGGFLGAFAAFALVALLCVQALARLRRAAGGMPALRFALAGVVRRRAATVTQVCALAIGLMALLLLTMTRTDLVAGWQRTLPQDAPNRFLINIQTDQREPVAAALRQAGVGDVTLFPMIRGRLVAVNGRPVSASDYAEERARRLVDREFNLSYSATMPSYNSLQAGRWMSADSREVSMESGIAATLGLGMGDKLTFDIAGQSVEVTVTSLRGVDWDTMRANFFAMLSPGVLADAPQSWITAFHLPSGQRELLPRLVQRFPNLTVFDVDAILRQLQGVLDQVVQAVQLLFGFTLAAGVLVLTAALAATRDERVREAAVLRALGATRRQLARAQRIELLAVGGLAGLLGAAGAGAVAWALSRHVFDFDITFSLWPWLAGVAVGMLGAWAGGALALRGVLRTPPLVTLREAL
>NZ_CP021109.1|WP_086071981.1|1635656_1635854_+|hypothetical-protein
MTNRSRIAAFLSASALCLGLSAAPAVFAAEAGSANAKPAKAHTHKHKAKSGATAKKSAAPAPAAK
>NZ_CP021109.1|WP_157664820.1|1635174_1635360_-|hypothetical-protein
MGAAVVPWSMVKAKTSSLRFHKIELSPAPTAQIVVASVPRRAGVTAQAFVADFLSRRSDRA
>NZ_CP021109.1|WP_086056860.1|1634450_1634867_-|hypothetical-protein
MHVSAEERVLSELDHARLVGLLTRLTASRHDDATQDAHDLLVTAPTVPGPAVPPDLVTMRTRLLLRGEDNGEQELTLVYPAEADAAHGCISVLSPLGLSLIGCREGQTIQWQGRDRVVHTSTIAKILYQPEAAGDYGT
>NZ_CP021109.1|WP_086071979.1|1633354_1634260_-|hypothetical-protein
MDITKAFIKAKQPCADGYRWYLRNARADDSYQQLLDALVADGRVGDACWLLDQFGPTDAVCVLDDIEAHAIVFAGTLHVRGSVRVDTVLRVGRDLRVDGGIRANRVTSGGEIRCGAALSCDAAIAAGGDLLVAWNLDAAGAVSAERLRVGWDLTGGAGLRARADVWVGGSLHLHGPLDGLAGVRVGEEMECAAAITVKHGVECGATLRCAGHIHAGWGIRASGSILAEGAIRAGESIRAGEEIRAGPGYGIYAGLDVRDDAWETSAQVRARRRPVQLHSGWWAGPDESACSPNDAASACPT
>NZ_CP021109.1|WP_086071978.1|1631398_1632778_+|DNA-repair-protein-RadA
MAKSRTVYVCAECGGTSPKWQGKCPHCNAWNTLEETVETAAAPAAAASHRYAPLASSSPVRSLAEIEAREVPRQPTGLDEFDRVLGGGLVAGAVVLIGGDPGIGKSTLLLQALASLSESARVLYVTGEESAEQVALRARRLGLTTGNVDLLAEIRLEAIQAAVTEQKPAVAVIDSIQTLYSGELTAAPGSVSQVRECAAQLTRLAKQTGIAIVMIGHVTKDGALAGPRVLEHIVDTVLYFEGDTHSSFRLVRAFKNRFGAVNELGVFAMTDRGLRGVANPSALFLSQHDRQVAGSCVMATQEGTRPLLVEIQALVDGVQGSNPRRLTVGLESNRLAMLLAVLHRHAGVVTSDQDVFVNAVGGVRITEPAADLPVLLSIMSSLRDRPLPRGMVAFGEVGLAGEIRPAPRGQERLREAAKLGFNVALIPKANAPRHPIEGLEVWAVDRLEHALDRLKNGAG
>NZ_CP021109.1|WP_086056858.1|1630655_1631372_+|SDR-family-oxidoreductase
MKDKCVLVTGATKGIGWALTRRLADMGCHVVGIARNTSDVDFPGYLYACDLADAGKTEEVLREIRDKYPVDAVVNNVGLVLPQPLGSVELASLFNVLDLNVRVAVQVAQAFVENMKARRAGRIVNVVSRAIYGGYERTSYSAAKNALVGCTRTWALELAEYGITVNAVAPGPIETELFRASRPVGSDAEKRILSTIPMKRIGSPADVAAAIAFLLSDDAGYITGQVLSVDGGGSIAGR
>NZ_CP021109.1|WP_086071977.1|1629352_1630495_+|alanine-racemase
MPRPISVTISVSALAHNLAVVQRHLEQAAAAARGRGDACKTPSIWAVIKAHGYGHGTAQAARGFANANGLAMLDLAEAVECREAGWTKPILLLEGFFEPADLEILDRYRLTSVVHTREQLDMLAGYRPSRPLNVFVKLNSGMNRLGFAPQAYRDAFARAQALREQGVLGAVGRMTHFANADAPEGVASQLEVFQRTAGDLPGPVSLSNSAATLRYPEIALARPDGESWVRPGICLYGASPFFDTDAATFGLRPAMSLRSQIIAVQHLQPGDAVGYGSLFTADRPLRTGVVACGYADGYPRHAGTGTPIVVAGVRTRVLGRVSMDMLCVDLTPVPDAGIGAPVSLWGADGPSVDEVAQAAGTIGYELLCALAARVPVRSVA
>NZ_CP021109.1|WP_086071976.1|1628328_1629165_-|squalene-synthase-HpnC
MAVDHYENFPVASVLLPRRLRRAVADIYRFARSADDIADEGAADDAQRLAALAAYRAELHRIAQGKPGARPIADPQLARVFDPLADTIARHQLPITPFYDLLSAFEQDVTVKRYADMSALLDYCARSANPVGRLMLHLYGAATPGNVRDADAICTGLQLTNFWQDVRIDWRKQRVYLPQDTLLRHGVTEEDIAACRLTPEWEGLMRELVAHARALLHSGAPLARRLPGRIGLELRLVVQGGLRILERIEGARFDVFMNRPELGPKDWALMIWKALRHG
>NZ_CP021109.1|WP_086071983.1|1639355_1640075_+|3-deoxy-D-manno-octulosonic-acid-kinase
MGAETLRVAWQGKRPGAMCYDAMQVPRADPAMFDPAYYGARAEPVAVGGRQSAWFVDGDCGPAVLRHYRRGGMVARISRQRYIWLGEARTRCFREFRLLESLAAQGLPVPAPLAAAYWRVGALTYEAAILVRRLPDVRPLARMLQEPVWDAAADAIARMHQAGVWHADLNAYNILLDARGKAWIIDFDRGRQGGVSGPAKRRNMERLQRSLVKVGGAAGQAFFERLNQAYQNRMTRAPA
>NZ_CP021109.1|WP_086056867.1|1640203_1641304_+|polyamine-ABC-transporter-substrate-binding-protein
MGINARARLAAGALMALTALSAKAQENVVNVYNWAEYTAPDTIPGFEKETGIKVRYDTYDNNDTLQAKLLTGKSGYDVVVPSTHYASRQLQGGLFQPLDKDKMPNLKYLDPDVMALVAQVDPGNKYFVPWGYGTNGLGYNVTKVQAIMGKDAPLNSWDMLFKPENAAKLKDCGISVLDEAAQVFPAVLHYLGKDPNSTNPDDYKAALDVLKQIRPYIRQFSSSGYIDEMASGDLCMVYGFSGDVMIARDRAKQNKQSFEINYVIPQGGAPAWFDVMAVPKDAPHPENAMKFINYIETPQVHAAITNKMFYPNANKEARKYVVPEVADNPMIYPPADVSKTLYVIKAQPINILRLQTRMWAELKSGR
>NZ_CP021109.1|WP_086056868.1|1641309_1642437_+|polyamine-ABC-transporter-ATP-binding-protein
MNDSRYAAPHAADADEFVRVCDLVKIFGDTVAVRSVNLAVRRNELFALLGSSGCGKSTLLRMLAGFEEVTSGQILLDGEDITNVPPYRRPVNMMFQSYALFPHMSVEANVAFGLKQEGVDRAEIHDRVFEALNLVQMAGYSRRKPHQLSGGQQQRVALARSLVKRPKLLLLDEPMSALDKQIRQNTQIELVRILEQVGVTCIMVTHDQEEAMTMAHRLAVMTEGQIVQVGTPQDVYEFPNSRFVAGFIGSTNLFSGTIVVDEPDHVAIESDQLSRHLYVSHGVSEPLGMPVHVSIRPERIVVSREQPDSAYNWAHGAVTHMAWMGSYALYHIRLDSGATVEATVPRRVFEKTEAPAVHEEVYVSWDADSATVLPS
>NZ_CP021109.1|WP_086056869.1|1642433_1643354_+|ABC-transporter-permease-subunit
MNGSLLRRLLPSSRALAVVPPFAWLALFLLVPFLLVLKISFADLQFGVPPYTPLVELKDEALNFSLHLRGYALLFTDSLYLATYLSSVKIAAISTVCCILIGYPMAYYIARSNPETRNILLLGVILPFWTSLLLRVYAWVGILRNDGLLNKLLLGLGIISQPLEIYRTDLAVYIGMVYSYLPFFILPLYANLVKMDLRLLEAAYDLGARPWQAFWQITVPLSRPGVIAGAMLVFIPAVGEYVIPEMLGGANTLMMGRVMWSEFFNNADWPMAAAVTCVMVLLLLVPLALFQYNQVRQVEMMREGKL
>NZ_CP021109.1|WP_086056870.1|1643350_1644151_+|ABC-transporter-permease-subunit
MKGPHRGMRALALGLGFAFLYIPILSLVVFSFNDSPLVTSWSGFSFKWYASLFHDDALLSAAWLSFRVAALAATAATVIGTWAGYILARMGRFRGFSLYIGMLSAPLVIPEVVIGISLLLMFVEVRSTIGWPENGIFTIWVGHTTFCMAFVAVIIQSRVRDLDRSLEEAALDLGATPLKVFFTITLPLIAPALASAWLLSFTLSLDDVILSSFLSGPGYTTLPIEVFSRVRLGLKPEVNALAALFILTVGICVVVANRLQRRKESA
>NZ_CP021109.1|WP_086071984.1|1644147_1644504_+|arsenate-reductase
MNLPILYGLKQCSTCVKARTWLDGHGIEHEFIDYRDHPVPPATLKAWAEQLGGWEKLVNRTSMTWRALPESRKSASTDAQWQALIAEYPALVRRPVTVTPDGAVAVGFSEKRYSERFA
>NZ_CP021109.1|WP_086073557.1|1644517_1645210_+|DNA-3-methyladenine-glycosylase
MLPDSFFDRDAQQVARELIGMVLRRRHGDLWLSARIIETEAYYLHDKGSHASLGYTHKRRALFMDGGAIYMYYARGGDSLNISAGGPGNAVLIKSAHPWLDAVSGEDSLARMQALNPDAQGRSRPPQRLCAGQTLLCRALGLKVPEWDGGRFDPSSFFVEDIGARPRRLIRTVRLGIPEGRDAHLPYRFVDPAYAPFCTRNPLRRGQVAGRDYDWITRQGRPCKGQADPA
>NZ_CP021109.1|WP_086071985.1|1645261_1646011_-|hypothetical-protein
MSIVSLPARREFAAPPLASLAPLPVAGETFAPFDMLDLAGLRPIASGAERLVYQHPTHPSLLVKVVDLAELADHLSTRPLRRWRKNLQRDGAYRNHIAELAEYAAAQHAAAGRWKIPMARMLGLAQTNLGLGLLVEKITDGQGGLAPTVEQIVRERGLDETLARELDNFFDALADHHVVLNDVSARNVVMGLNADGETGLYLIDGFGSKQAIPLFAYSKTLNRRRIQRKYRMLRAKLQARSLARPQLHD
>NZ_CP021109.1|WP_086071986.1|1646182_1647553_+|DNA-recombination-protein-RmuC
MPQSDILLLSWVGAAAAVVAAVAAIVAAWRAGRSTGVGVRLEALAAEQERTARELRLELSESQRGLRVELGQQLDALRGGIARDAQAARTESAESLARFGAAFGEQVQRLIDLNDRRMQEVRQTVEQRLQALQSDNAGKLDEMRRTVDEKLHATLEQRLGESFKLVSDRLEAVHKGLGEMQSLASGVGDLKRVLTNVKSRGTWGEVQLARLLEDTMTPDQYACNVKPVPGSDAIVEFAIRLPGRAEGGAPVWLPLDAKFPKEEYERLIEAEQAADPDGARNAAAALARAVELQAKSIAAKYIAPPHTTDFAIMFLPTEGLYAEVLRRPGLLDKLHGMRVNVAGPANLAALLNSLQMGFRTLAIERRSSEVWQVLRAVKTEFGRFGEALAGVKRTLDTASSKIGQTEVRTRAMLRSLKAVEALPGDAPGAGAGAPEQGGNGLATTVFDADDDEAPQA
>NZ_CP021109.1|WP_086071987.1|1647635_1648313_+|ribose-5-phosphate-isomerase-RpiA
MLSQQELKQQAATAALEFVEEVAGADVVIGVGTGSTADLFIDGLARFKEKLRGTVASSTRSAQRLQALGIPVLDLNDVERMPIYVDGADEIDGNLHMIKGGGGALTREKIVASVADRFICIADESKLVKRLGTFPLPVEVIPMARAAVARQLASMGGRPALREGFVTDNGNVILDVSGLPITDAAALELRINNLPGVVTCGLFTQPGAHVALLATQQGIRRLSRP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_10

2138845-2138917

Orphan

Consensus_repeat	Method
AGCGCTTCGGGGGTGGGCTTCCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_10

>merge|NZ_CP021109|10|2138845-2138917|CRISPRCasFinder
AGCGCTTCGGGGGTGGGCTTCCCTTCGCCCCCTTGAGGGGGAAGCGCGGAGCGCTTCGGGGGTGGGCTTCCCT

>NZ_CP021109|10|10|2138845-2138917|CRISPRCasFinder
AGCGCTTCGGGGGTGGGCTTCCCT	TCGCCCCCTTGAGGGGGAAGCGCGG
AGCGCTTCGGGGGTGGGCTTCCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086072255.1\|2130190_2132146_+\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|182731
NZ_CP021109.1\|WP_086072262.1\|2141246_2142245_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP021109.1\|WP_086072254.1\|2128366_2129224_-\|23S-rRNA-(adenine(2030)-N(6))-methyltransferase-RlmJ	unknown	unknown	gnl\|CDD\|225509
NZ_CP021109.1\|WP_086072263.1\|2142958_2143666_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP021109.1\|WP_086072259.1\|2135660_2136644_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP021109.1\|WP_086057272.1\|2147190_2148093_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP021109.1\|WP_086072258.1\|2133704_2135117_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP021109.1\|WP_086057261.1\|2135320_2135533_-\|DUF1059-domain-containing-protein	unknown	unknown	gnl\|CDD\|368852
NZ_CP021109.1\|WP_086059371.1\|2143854_2145144_+\|Glu/Leu/Phe/Val-dehydrogenase	unknown	unknown	gnl\|CDD\|223411
NZ_CP021109.1\|WP_086072261.1\|2139023_2140328_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380563
NZ_CP021109.1\|WP_086072260.1\|2136759_2137764_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP021109.1\|WP_086057266.1\|2140393_2141245_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP021109.1\|WP_086072264.1\|2146087_2146864_-\|lipoate--protein-ligase-family-protein	unknown	unknown	gnl\|CDD\|223173
NZ_CP021109.1\|WP_086072257.1\|2133010_2133688_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226647
NZ_CP021109.1\|WP_086073591.1\|2145201_2145978_-\|DUF3298-domain-containing-protein	unknown	unknown	gnl\|CDD\|378702
NZ_CP021109.1\|WP_086057271.1\|2146860_2147136_-\|biotin--protein-ligase	unknown	unknown	gnl\|CDD\|378435
NZ_CP021109.1\|WP_086057268.1\|2142231_2142954_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP021109.1\|WP_086057264.1\|2137866_2138676_+\|putative-hydro-lyase	unknown	unknown	gnl\|CDD\|180100
NZ_CP021109.1\|WP_086059370.1\|2129246_2129996_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|236524
NZ_CP021109.1\|WP_086072256.1\|2132346_2133012_-\|arylesterase	unknown	unknown	gnl\|CDD\|238860

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086072255.1\|2130190_2132146_+\|peptidylprolyl-isomerase	gnl\|CDD\|182731	PRK10788, PRK10788, periplasmic folding chaperone; Provisional.	2.35553e-87
NZ_CP021109.1\|WP_086072262.1\|2141246_2142245_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	5.87909e-66
NZ_CP021109.1\|WP_086072254.1\|2128366_2129224_-\|23S-rRNA-(adenine(2030)-N(6))-methyltransferase-RlmJ	gnl\|CDD\|225509	COG2961, ComJ, Protein involved in catabolism of external DNA [General function prediction only].	4.32164e-131
NZ_CP021109.1\|WP_086072263.1\|2142958_2143666_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	2.23278e-119
NZ_CP021109.1\|WP_086072259.1\|2135660_2136644_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	1.08917e-15
NZ_CP021109.1\|WP_086057272.1\|2147190_2148093_-\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.26018e-13
NZ_CP021109.1\|WP_086072258.1\|2133704_2135117_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	9.77937e-49
NZ_CP021109.1\|WP_086057261.1\|2135320_2135533_-\|DUF1059-domain-containing-protein	gnl\|CDD\|368852	pfam06348, DUF1059, Protein of unknown function (DUF1059). This family consists of several short hypothetical archaeal proteins of unknown function.	8.30168e-08
NZ_CP021109.1\|WP_086059371.1\|2143854_2145144_+\|Glu/Leu/Phe/Val-dehydrogenase	gnl\|CDD\|223411	COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism].	0
NZ_CP021109.1\|WP_086072261.1\|2139023_2140328_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380563	cd06340, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, their ligand specificity has not been determined experimentally.	2.32433e-146
NZ_CP021109.1\|WP_086072260.1\|2136759_2137764_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	7.1971e-43
NZ_CP021109.1\|WP_086057266.1\|2140393_2141245_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.47671e-70
NZ_CP021109.1\|WP_086072264.1\|2146087_2146864_-\|lipoate--protein-ligase-family-protein	gnl\|CDD\|223173	COG0095, LplA, Lipoate-protein ligase A [Coenzyme metabolism].	8.6454e-66
NZ_CP021109.1\|WP_086072257.1\|2133010_2133688_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226647	COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism].	9.48551e-105
NZ_CP021109.1\|WP_086073591.1\|2145201_2145978_-\|DUF3298-domain-containing-protein	gnl\|CDD\|378702	pfam11738, DUF3298, Protein of unknown function (DUF3298). This family of bacterial protein C-terminal regions is highly conserved but the function is not known. Several members are annotated as being endo-1,4-beta-xylanase-like, but this could not be confirmed, and the structure can be defined as a heat-shock cognate 70kd protein 44kd ATPase.	3.56587e-12
NZ_CP021109.1\|WP_086057271.1\|2146860_2147136_-\|biotin--protein-ligase	gnl\|CDD\|378435	pfam10437, Lip_prot_lig_C, Bacterial lipoate protein ligase C-terminus. This is the C-terminal domain of a bacterial lipoate protein ligase. There is no conservation between this C-terminus and that of vertebrate lipoate protein ligase C-termini, but both are associated with the domain BPL_LipA_LipB pfam03099, further upstream. This domain is required for adenylation of lipoic acid by lipoate protein ligases. The domain is not required for transfer of lipoic acid from the adenylate to the lipoyl domain. Upon adenylation, this domain rotates 180 degrees away from the active site cleft. Therefore, the domain does not interact with the lipoyl domain during transfer.	4.16667e-05
NZ_CP021109.1\|WP_086057268.1\|2142231_2142954_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	4.59083e-105
NZ_CP021109.1\|WP_086057264.1\|2137866_2138676_+\|putative-hydro-lyase	gnl\|CDD\|180100	PRK05463, PRK05463, putative hydro-lyase.	0
NZ_CP021109.1\|WP_086059370.1\|2129246_2129996_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|236524	PRK09454, ugpQ, cytoplasmic glycerophosphodiester phosphodiesterase; Provisional.	7.2245e-139
NZ_CP021109.1\|WP_086072256.1\|2132346_2133012_-\|arylesterase	gnl\|CDD\|238860	cd01822, Lysophospholipase_L1_like, Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.	3.42164e-91

>NZ_CP021109.1|WP_086057264.1|2137866_2138676_+|putative-hydro-lyase
MSALPHNGAGTPSASYQARLDARSGAMTGPTANVAPGHVQANLAILPKALADDFLRFCLRNPKPCPVLAVSEPGNPALPELGVDIDIRTDIPRYRVWKDGVLVEEPLDVKHVWRDDLVSFLIGCSFSFEEAMLDNGLPVRHIEQGRNVPMYRTNVPTQPAGRFSGPLVVSMRPLKPADAIRAIQVTSRFPSVHGAPVHFGDPAAIGIADIGKPDYGDPVDIRPGEVPVFWACGVTPQSVVAAVKPEFCITHAPGHMLVTDLINSRVAAL
>NZ_CP021109.1|WP_086072260.1|2136759_2137764_+|LysR-family-transcriptional-regulator
MIDLRNIETFFWVARLGGFRAAAEKLNATQPAISQRIASLEAGLGVRLFERDSRGITLTAKGYELLSHAERMLQMRTDMQQAARAQNVMSGTLRLGVSETIVHTWLPSLMEYMHEAYPALMVEIQVDTSTALRAQLSSHQIDLAFLLGPMEEPRVENIHLCRYPLAWIASPQLRLGRPPISLKRLGRWPVITYTSNTDPHRAVRRILIEGGVQTPRMYGSSALSVIVRMTLDGIGTAVIAPVILGRELAQGLLQILDVQAPELPPLNYTACWMQGPDSHVARTVAQAAQYIAREDAARIAGNPLTLDPPPLPAPGLGPALRGGHKDKGGRNADK
>NZ_CP021109.1|WP_086072259.1|2135660_2136644_-|DMT-family-transporter
MGGASQSRTAGGHAGLAAPAAQPLAGIALLLLSMWTLSSLDASGKWVMAAGVPMLLLSWVRYAAHLALALALIVPVKGWGILKSRRPREQMLRGGAMLGATLMFFTALRYLPQAEATAINFLAPLIVLLLAPWLLREPPRLSRWVAAGVAFLGVLIVIRPGGGLDTVGTIFGLLGAFCFSAQYIASRRVAGDDPLTSVIWSGGVGTVVLSFALPYIVPAALPALRGLDALHWAVLASTGVTGCLGHLLQIAAYRKAPASTLAPFTYLQIVSSTTTGWLIWGHFPDALTWLGIAVICGSGITIGIMEWRRAERQRRLAGAIRVPGNPG
>NZ_CP021109.1|WP_086057261.1|2135320_2135533_-|DUF1059-domain-containing-protein
MTRKYIDCREFPSEANCSVALSADSEEELLEAAVQHACAVHHHTDTPELRQQIRTLFHDGTPPVEAPQRA
>NZ_CP021109.1|WP_086072258.1|2133704_2135117_-|FAD-binding-oxidoreductase
MFTLSHTAMDDLKAALRGRVITPSDAEYDETRRVWNAMIDRRPALIVRCAGVADVRCGVRFAHEHGLPLSVRGAGHNIAGSAVCDQGVMIDLSAMRSVRIDPQARRAYVEPGATLADFDHEAQAFGLATPLGINSTTGVAGLTLGGGFGWLSRRFGMTIDNLRAADVLTADGALHHASAAEQEDLFWAIRGGGGNFGVVTTFEFELHPLGPQIYGGLLVLPMEQAANALRAYRAAAAAMPEELTVWAVLRLAPPLPFLPPETHGKPVAVFAMCYSGDVEDGPQAVEPLRHFGTPYGEHLGAMPYVAWQKAFDPLLTPGARNYWKSHDFADLQDGLFDTLIDAAGRLPSPQCEIFLGQLGGKAGRVPPDAMAYANRDAKYIVNVHARWNDAADDAACIGWARDFFDRAAAFALGSVYVNFMTDDESARIDAAYGPNIARLRTVKARYDPHNLFRHNQNIRPDAQEHARPAA
>NZ_CP021109.1|WP_086072257.1|2133010_2133688_+|ABC-transporter-ATP-binding-protein
MGTGNAIEVRGLGKKVADAGGTLAILDGIDFTVPAGAALAITGSSGSGKSTLLGLLAGLDVPTAGSVSLAGRDLFALDEDGRARLRANHVGFVFQSFQLLPNLTALENVMLPLELAGLPARDPAIAMLERVGLAGRLHHYPRTLSGGEQQRVSLARAFVVRPDLLFADEPTGSLDAATGARVIDLIFELHREHRATLVLVTHDASLAARCERQLVLAAGRVVSAA
>NZ_CP021109.1|WP_086072256.1|2132346_2133012_-|arylesterase
MRPLIRFLFAAALVLLTSAAHAQTTLAGSGSPTPGAAQRTRTILVVGDSLSAEYGIARGTGWVPLLGQRLEREHTGWTVVNASISGDTTTGGLTRLPPLLKQHRPAIVILELGSNDALRGLPLSMTQQNLTAMARQAKQAGARVLLVGMQIPPNYGRAYTEQFRDLFEKVASAENTGLVPFFMEGIATNRDFFQPDGIHPNEAGQPRLLENVWAGLRPMLN
>NZ_CP021109.1|WP_086072255.1|2130190_2132146_+|peptidylprolyl-isomerase
MFDFIRNHQRWMQFILLILIVPSFVFFGVQSYSSFMSEEPKMATVNGKPITQREYDLARREQLDQYRQMMGAQFDPALLDTPAMRQRLLDQLINQRLLAAAAADNRFSVSDETLRNTIASNPAVQEGGRFSPERYRSVLAAQGLTPAAFEAGLRRDLAIARVLDPVGQSARVPTAVATSIEHALTETRHVLTRRYAAADYRKQVQVSDADVQKWYDENKQQYQVPDQVKAQYVVLDEAAASAGIQVSDDDIAKYYEQNKSRFGQPERRRASHIMIELPANASDAQRKAARAKADDIARQAAEHPAQFAELARKYSQDAGSASKGGDLGWIAPGMLTPALQKALDGLNKGQVSGVVESPYGFHVLQLTDLQPAQTKPLAEVRQQIQDEIRKQIASSRFSDMATKLTSLVYDQRDSLRPAADALGLKIREAGGITRTGLLPQEEAGADAASASPDSALLDNARVRQALFSPEVLRDKQNSGVIELSPDRMLVVRVAAYTPAHVPPLDKLKDKIHARLVEQRAADAAAKAGEQALESLRKNPSAPADGFGGAVDVSRQDPQNLSRPVLEAVMRAPGSPLPSYAGARDGDDYVVARIDKVEAGKVEPDAVTALSKQLSDAWGQAEDEAVLKMLRTQYKVEIAPEAARILQGGEVG
>NZ_CP021109.1|WP_086059370.1|2129246_2129996_-|glycerophosphodiester-phosphodiesterase
MDTPLPTWPYPRLIAHRGGGRLAPENTMAGMRAGAEHGFRMFEYDVKLSKDDVLILLHDDDVDRTTDGKGPARNMTYAELARLDAGAWHSPAYAGARIPTLEEVARYTIEQGIASNVEIKPCPGRETETGTAVALAVRELWRDAPVAPLLSSFSEEALAAAHVAAPQLPRALLVEKIPMDWRDRLVQHDCIALNVNQKDVTPELVKAVHGAGYRLSAWTVNDPARARDLLDWGVDAIFTDELATIRPDA
>NZ_CP021109.1|WP_086072254.1|2128366_2129224_-|23S-rRNA-(adenine(2030)-N(6))-methyltransferase-RlmJ
MFSYRHAFHAGNHADVLKHAILIHVLDYLGQKDTPYWIIDTHAGAGLYRLDSDWAAKNAEFADGIGRLWNRADAPPLLARYLERIRAYNPAGTLRHYPGSPWLALDAMRDHDRLRLFEAHPTEAEVLVGNLEQQGGIALRQTTIFDTDGFEGMKALLPPPPRRGLVLIDPSYEDKQDYRRVTLAVKEGLKRFATGTYAVWYPLVQRRESQELPRQLEKLGAKRWLHAALSVRKPAADGFGLHGSGMFLINPPWTLAAALKEALPWLKQVLAQDPRARYTLDVRED
>NZ_CP021109.1|WP_086072261.1|2139023_2140328_+|ABC-transporter-substrate-binding-protein
MKMDSHAAPMASAGLGKARVSKLIAGAAACFALGFGVPAAAQTQTVRIGAIYPLSGALASTGAEIKAAVELAVDIVNNPHPELKGLPLAEGSGLPNLGGAKLEVVFGDSQGKPEVGLADAQRLIQQEKVVALTGAYQSAVTKTASRVAEQAGIPYLNGESSSPDLTDRKYKWFFRTSPTDDTFIENMMQFLDGIKQVPTEKIAVVYENTDFGVNTYKALDKFAKQYKRKIVANIAYTAGSASVTSEVQKLADAKPDVAIFASYTSDAMLFVRTMREAKYAPPVFLANDAGFIDSRFVQEVGQQVQGVLTRDVWSNDIATSKPILKTINDLYKAKTGKELNGNNARSLQGVLVLADAINRAGSTKPEAIRDALKKTDLSEAQIAMPWSGVKFDETGQNSKGAGLILQMTSAGYQTVWPTNYNKDKSLPALPFAWK
>NZ_CP021109.1|WP_086057266.1|2140393_2141245_+|branched-chain-amino-acid-ABC-transporter-permease
MLEALYAGLFNGLIYAAVAVGLALIWGITDVINFAHGEFLMLAMYAAYWFFTLGHVDPTLSAPLVAALLGFVGFLTYALIIKRLQKGPPMAVILATFGLGLVLRQLAFIAFTPDYRNLPDTLVSGSVSLAGISIGRPQVITGLVALVVVIALFVLVYRTRWGHALQAVAEDRQVAALVGISPDRVNAQVWILGSAAVGLAGALLTTFFYVFPSVGTVFGLLAFVAVCMGGFGSLPGAFIAGILIGIIEAMTGYFVAPALKTVSIFILFILVLWYRPRGLFGRW
>NZ_CP021109.1|WP_086072262.1|2141246_2142245_+|branched-chain-amino-acid-ABC-transporter-permease
MTSVKQMDMTAAMPAKARHSRAPLAAAVVLAILFALVPFFVTDQFTIQVLLLVLLFGALGAAWNLVGGFLGRISFGHGVFVGVGAYTTILLLQHLELTPLVGIPAGALVSAVLAWIVGGPTLRLSGHYFAMATIALLQIGLLLMVNWDWAGGAVGIEAPIGDSALMLLFRTKVPYYWIAVGLALVTFLATYFLVHSRTGFYWRAINGDEAAARSLGVPADRYKMLAFVLSAAITGAWGGFFAMYVGFIDPESMFSLTLSVQVVLVAILGGVGTLVGPWIGAAVLLPLSEGTRVLWGSSGMGLDLLVFGLAILLVTMFLPGGLITLRGRRGSA
>NZ_CP021109.1|WP_086057268.1|2142231_2142954_+|ABC-transporter-ATP-binding-protein
MALLEVKELTKRFGGLVANKDINLSVDAGEIVAIIGPNGAGKSTLFNGLVGHHAPTSGSVTFNGESMLGRKPEQVAAMGLVRTYQIPRNFGQMTVLENAMVGALLRHPRLQDAREAARKVLELVGLADRADVKAAGLNVAGQKRVELARALATEPRMLLLDEVAGGLNPTEAIALADILRRIHGAGVTLVIVEHVLEVVMRLAQRVLVLNFGQTIAEGPPQEIVRNPAVIEAYLGRKHRA
>NZ_CP021109.1|WP_086072263.1|2142958_2143666_+|ABC-transporter-ATP-binding-protein
MLKVENLNVAYGGVQAVRGISLEVRPGEITALLGANGAGKSSTLAAIVGTVRPAAGRIVFEGEDITGSRPENLVQRGIAMIPEGARVFARQPVEQNLRLGAYTVRSESVYRERLEHVYEVFPRLRERRTQLAGTMSGGERQMLAIGRALMSGPRLLLVDEPSLGLSPLLVEQVFDALAALNKQAGLSVLLVEQNMNAALEVASRAYVMQSGAIALSGDAAELAASDEVREAYLGM
>NZ_CP021109.1|WP_086059371.1|2143854_2145144_+|Glu/Leu/Phe/Val-dehydrogenase
MHETPTHALPSYLDPNNVGPWGIYLQQVDRVTPYLGALGRWVETLKRPKRALIVDVPVELDNGRIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMALAAWMSIKNAAVNLPYGGAKGGIRVDPRGYSQAELERITRRYTSEIGVIIGPSKDIPAPDVNTNAQIMAWMMDTYSMNEGATATGVVTGKPVALGGSLGRVEATGRGVFVVGCEAARDLGFDVNGARVIVQGFGNVGGTAARLFHGVGAKIIAVQDHTGTVYNEYGLDVPELLVHVSQHGGVGGFEKAQTIEASEFWKLETEFLIPAALEGQITAANASDIKAKVVVEGANGPTTPEADDILFDNGILVVPDVVANAGGVTVSYFEWVQDFSSFFWTEDEINHRLERIMRDAYAAVSQVAREHKVTLRTAAFIVACTRILQARQVRGLYP
>NZ_CP021109.1|WP_086073591.1|2145201_2145978_-|DUF3298-domain-containing-protein
MSAGLLGLTALLAGCGSTPPADISLSPGSAASANAGDVRVDTVKWTRTKPGCSGECPRIEVDSIAFPGIPKLTALVDHVLAYMTGVDPNRPRPYDTLNEYAQYFFQTAQPRDETWFKARVKDTVGDIIAIELHTGQMLTGAAHPIPATQYLNWERSKGRVLALDEAIIPGRGPQFVDALKAAHARWLKTNEDARRDPAAYNRMWPFSPSSNFALTREGVTVKYDAYSIAPYSYGEPELQIPYKDLVGVLRPEFIPRQD
>NZ_CP021109.1|WP_086072264.1|2146087_2146864_-|lipoate--protein-ligase-family-protein
MTRSTWRDHDWQLIRESARTPLEHMALDAVLSDEVAAGRRAPTLRFWEWARPAVVIGRFQSLKNEVDPDGARRHGVEVVRRVSGGGAMFVEPGNTITYSIYAPLSLVEGMSFQESYAFLDAWTLEALQSVGIQAWYQPLNDITSSGGKIGGAAQARRGQAVLHHVTMAYDIDAEKMVQVLRIGREKLSDKGTTSAKKRVDPLLTQTGMPREQIIDRMIEVFRNRHGLTQGAITEAEMAEADRQARERFATAAWLTQVP
>NZ_CP021109.1|WP_086057271.1|2146860_2147136_-|biotin--protein-ligase
MHGEYKVPGGKLVVADVNVEDGALTAVSISGDFFLEPPEALAEIDRALTGLAATASEAELALAVALALPPGTEMFGFSPEAVAIAVRRALA
>NZ_CP021109.1|WP_086057272.1|2147190_2148093_-|DMT-family-transporter
MATPTERTGALQMSAAMAMSGTLGYFVLESGQGPFNVVFFRCLFGALALLVYCHARGLLSRRYFGRTSFGLAVAAGAALVMNWVLLFSAYRLASISLSTAVYNFQPFFLMGLGAVFLGERPSLTKVAWAGVAFGGLLMLLDLQGSSALSHDHYLSGLLLGMGAGFLYAVTAIIVKRLAGIPPHLLALVQAVVGIVMLAPMADFSALPATAGQWICLAVLGVVHTCLMYILLYSAIQKLPTAMLAALSFIYPAVAILVDYAFFAQRLDLAQAAGISLILLAVAGVTLNWRLWPAPRKGGVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_11

2723838-2723937

Orphan

Consensus_repeat	Method
GAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_11

>merge|NZ_CP021109|11|2723838-2723937|CRISPRCasFinder
GAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCTCTCCCCGCCGGTCCGCTGGCGTCGCCCCCTTGAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGC

>NZ_CP021109|11|11|2723838-2723937|CRISPRCasFinder
GAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGC	TCTCCCCGCCGGTCCGCTGGCGTCGCCCCCTT
GAGGGGGAAGCGCGCCAGCGCTTCGGGGGTGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086059436.1\|2722311_2723544_-\|flagellar-hook-associated-protein-3	unknown	unknown	gnl\|CDD\|236345
NZ_CP021109.1\|WP_086072565.1\|2720376_2722257_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP021109.1\|WP_086072567.1\|2725738_2726875_-\|flagellar-assembly-peptidoglycan-hydrolase-FlgJ	unknown	unknown	gnl\|CDD\|139173
NZ_CP021109.1\|WP_086057678.1\|2709181_2709721_+\|flagellar-motor-switch-protein-FliN	unknown	unknown	gnl\|CDD\|181183
NZ_CP021109.1\|WP_086057682.1\|2711208_2711997_+\|flagellar-biosynthetic-protein-FliR	unknown	unknown	gnl\|CDD\|235568
NZ_CP021109.1\|WP_086072568.1\|2730558_2731767_-\|flagellar-hook-basal-body-complex-protein	unknown	unknown	gnl\|CDD\|235557
NZ_CP021109.1\|WP_157664864.1\|2712163_2716027_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372668
NZ_CP021109.1\|WP_086057692.1\|2728930_2729716_-\|flagellar-basal-body-rod-protein-FlgG	unknown	unknown	gnl\|CDD\|183688
NZ_CP021109.1\|WP_086072563.1\|2716072_2717707_-\|sulfatase-like-hydrolase/transferase	unknown	unknown	gnl\|CDD\|293741
NZ_CP021109.1\|WP_086072561.1\|2710119_2710875_+\|flagellar-type-III-secretion-system-pore-protein-FliP	unknown	unknown	gnl\|CDD\|235566
NZ_CP021109.1\|WP_086057696.1\|2732587_2733004_-\|flagellar-basal-body-rod-protein-FlgC	unknown	unknown	gnl\|CDD\|235556
NZ_CP021109.1\|WP_086072564.1\|2719880_2720369_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086057679.1\|2709725_2710055_+\|flagellar-biosynthetic-protein-FliO	unknown	unknown	gnl\|CDD\|183160
NZ_CP021109.1\|WP_086072566.1\|2723951_2725631_-\|flagellar-hook-associated-protein-FlgK	unknown	unknown	gnl\|CDD\|236165
NZ_CP021109.1\|WP_086057691.1\|2728235_2728931_-\|flagellar-basal-body-L-ring-protein	unknown	unknown	gnl\|CDD\|139164
NZ_CP021109.1\|WP_086057681.1\|2710888_2711158_+\|flagellar-biosynthesis-protein-FliQ	unknown	unknown	gnl\|CDD\|235567
NZ_CP021109.1\|WP_086059438.1\|2733023_2733431_-\|flagellar-basal-body-rod-protein-FlgB	unknown	unknown	gnl\|CDD\|180196
NZ_CP021109.1\|WP_086059437.1\|2726887_2727955_-\|flagellar-basal-body-P-ring-protein-FlgI	unknown	unknown	gnl\|CDD\|235399
NZ_CP021109.1\|WP_086057693.1\|2729764_2730526_-\|flagellar-basal-body-rod-protein-FlgF	unknown	unknown	gnl\|CDD\|183642
NZ_CP021109.1\|WP_086057695.1\|2731851_2732547_-\|flagellar-basal-body-rod-modification-protein	unknown	unknown	gnl\|CDD\|183638

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086059436.1\|2722311_2723544_-\|flagellar-hook-associated-protein-3	gnl\|CDD\|236345	PRK08870, flgL, flagellar hook-associated protein FlgL; Reviewed.	2.53789e-112
NZ_CP021109.1\|WP_086072565.1\|2720376_2722257_-\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	6.99082e-139
NZ_CP021109.1\|WP_157664864.1\|2712163_2716027_+\|hypothetical-protein	gnl\|CDD\|372668	pfam13678, Peptidase_M85, NFkB-p65-degrading zinc protease. This family of bacterial metallo-peptidases is thought to compromise the inflammatory response by degrading p65 thereby down-regulating the NF-kappaB signalling pathway. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52; and the heterodimeric p65-p50 complex appears to be most abundant one.	0.00858726
NZ_CP021109.1\|WP_086057678.1\|2709181_2709721_+\|flagellar-motor-switch-protein-FliN	gnl\|CDD\|181183	PRK07963, fliN, flagellar motor switch protein FliN; Validated.	2.14004e-54
NZ_CP021109.1\|WP_086057682.1\|2711208_2711997_+\|flagellar-biosynthetic-protein-FliR	gnl\|CDD\|235568	PRK05701, fliR, flagellar type III secretion system protein FliR.	3.52313e-65
NZ_CP021109.1\|WP_086072568.1\|2730558_2731767_-\|flagellar-hook-basal-body-complex-protein	gnl\|CDD\|235557	PRK05682, flgE, flagellar hook protein FlgE; Validated.	4.32332e-141
NZ_CP021109.1\|WP_086072567.1\|2725738_2726875_-\|flagellar-assembly-peptidoglycan-hydrolase-FlgJ	gnl\|CDD\|139173	PRK12713, flgJ, flagellar rod assembly protein/muramidase FlgJ; Provisional.	9.22299e-121
NZ_CP021109.1\|WP_086057692.1\|2728930_2729716_-\|flagellar-basal-body-rod-protein-FlgG	gnl\|CDD\|183688	PRK12694, flgG, flagellar basal body rod protein FlgG; Reviewed.	1.69088e-148
NZ_CP021109.1\|WP_086072563.1\|2716072_2717707_-\|sulfatase-like-hydrolase/transferase	gnl\|CDD\|293741	cd16017, LptA, Lipooligosaccharide Phosphoethanolamine Transferase A (LptA) or Lipid A Phosphoethanolamine Transferase. Lipooligosaccharide Phosphoethanolamine Transferase A (LptA) or Lipid A Phosphoethanolamine Transferase catalyzes the modification of the lipid A headgroups by phosphoethanolamine (PEA) or 4-amino-arabinose residues. Lipopolysaccharides, also called endotoxins, protect bacterial pathogens from antimicrobial peptides and have roles in virulence. The PEA modified lipid A increases resistance to the cationic cyclic polypeptide antibiotic, polymyxin. Lipid A PEA transferases usually consist of a transmembrane domain anchoring the enzyme to the periplasmic face of the cytoplasmic membrane.	1.0671e-19
NZ_CP021109.1\|WP_086072561.1\|2710119_2710875_+\|flagellar-type-III-secretion-system-pore-protein-FliP	gnl\|CDD\|235566	PRK05699, fliP, flagellar biosynthesis protein FliP; Reviewed.	2.86813e-124
NZ_CP021109.1\|WP_086057696.1\|2732587_2733004_-\|flagellar-basal-body-rod-protein-FlgC	gnl\|CDD\|235556	PRK05681, flgC, flagellar basal body rod protein FlgC; Reviewed.	1.9495e-72
NZ_CP021109.1\|WP_086057679.1\|2709725_2710055_+\|flagellar-biosynthetic-protein-FliO	gnl\|CDD\|183160	PRK11486, PRK11486, flagellar type III secretion system protein FliO.	9.54189e-24
NZ_CP021109.1\|WP_086072566.1\|2723951_2725631_-\|flagellar-hook-associated-protein-FlgK	gnl\|CDD\|236165	PRK08147, flgK, flagellar hook-associated protein FlgK; Validated.	0
NZ_CP021109.1\|WP_086057691.1\|2728235_2728931_-\|flagellar-basal-body-L-ring-protein	gnl\|CDD\|139164	PRK12700, flgH, flagellar basal body L-ring protein; Reviewed.	1.87407e-121
NZ_CP021109.1\|WP_086057681.1\|2710888_2711158_+\|flagellar-biosynthesis-protein-FliQ	gnl\|CDD\|235567	PRK05700, fliQ, flagellar type III secretion system protein FliQ.	3.0829e-28
NZ_CP021109.1\|WP_086059438.1\|2733023_2733431_-\|flagellar-basal-body-rod-protein-FlgB	gnl\|CDD\|180196	PRK05680, flgB, flagellar basal body rod protein FlgB; Reviewed.	1.12484e-60
NZ_CP021109.1\|WP_086059437.1\|2726887_2727955_-\|flagellar-basal-body-P-ring-protein-FlgI	gnl\|CDD\|235399	PRK05303, flgI, flagellar basal body P-ring protein FlgI.	0
NZ_CP021109.1\|WP_086057693.1\|2729764_2730526_-\|flagellar-basal-body-rod-protein-FlgF	gnl\|CDD\|183642	PRK12640, flgF, flagellar basal body rod protein FlgF; Reviewed.	6.59953e-117
NZ_CP021109.1\|WP_086057695.1\|2731851_2732547_-\|flagellar-basal-body-rod-modification-protein	gnl\|CDD\|183638	PRK12633, flgD, flagellar basal body rod modification protein; Provisional.	5.91344e-83

>NZ_CP021109.1|WP_086059436.1|2722311_2723544_-|flagellar-hook-associated-protein-3
MRLSTSTIYQSGLNGILRNESDVLALQQQISSGRRVVTPSDDPLAAGKAITAYQNLNITQTYASNREAANRSLGLESNALGSIVTTLTDVLTRVVQAGNGTMADEDRNSLATVLEQSRDALLALANSTDGNGQYLFSGTTGDAAAYVQDPNSGIISYNGSAGQRLVQVEQARQMAVSDIGTDIFARATPGTTEYIATAQPTNKGTVTFSSPSIVPGNASAGHNFQITFKTDATTGAMTYSVEDTTTNTVVQSDVPYESGAEIDLGAAKLALKGDPADGDTLTVTTAQSTGLDMFHTLNSLITTLRAPSDGNAAAQAQLTNMLATANKKLSINLDNVSTVQASVGARQNELDALDTMGSQRALTDNKTLTDLTKIDYYEAVSAMSMHQLALQASMAAFSAVKGTSLFSMNK
>NZ_CP021109.1|WP_086072565.1|2720376_2722257_-|HAMP-domain-containing-protein
MFANLKVRTSIILLLSLYLLAMLLSNGVAWLGLQSSNNKLDGVNTIYTDQVTNLYAGYSQVLRARQVLNNAYDKIQNNRVDEGMSDLSRAAGFKSEADKRMALFAQAPKLPETVEMAQGIVSAYKTYSDMVDGQLSALRSRSLDAFAASSKTSSSANQGLDRAMKTMLDYLDKTTDNMVAQGHDDFTLARIVTVAMIVFAIILTAACWLVLNRMVLRPLREAGSHFDRIAAGDLSQHIEVRSTNEIGVLFGAVRRMQESLTRTVAAVRRGVDEINVGAREISAGNTDLSSRTEQQAASLEETAASMEELASTVKQNAENARQANQLAASASDVAERGGSAVAEVVNTMQEISGSSRKISEIVSVIDGIAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKALIEDSVSKVGAGSQQVERAGATMQEIVASVKRVTDIMGEISAASEEQSSGIDQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQEQAQRLAEAVAVFKINEARVIDMPAREIPAAAAPRMPAPPSESAPAATSAEAPRLSHAPAAARSARPAPASQAPASPAAAKAPARAAAPARRAPAAANDGVAPRPAPKARAAGGTAAALNEDDWESF
>NZ_CP021109.1|WP_086072564.1|2719880_2720369_-|hypothetical-protein
MALTLRLIATWRPRLLASLAGLVLLGGCATGQNFSAESLASLQPGRTTMTDAIQTLRAMPQQVMPQSDGSTVAIWAYKMSVVADALYFRREAMLQFGADGRLARVLNTTNVPLPDATRQRLLGATSIPQEGPATPVAAANSQPETGAPGPGPGATAIPVRVQ
>NZ_CP021109.1|WP_086072563.1|2716072_2717707_-|sulfatase-like-hydrolase/transferase
MSDSSSHGASGIPGWRARAVSSVSACALIECLAFAYVAVVFPALDGFYAIDRFRAIGVNVQGHLGPAEVLRQAVFILEYAFAVVMLYAATRLGRWRSTGVLALFVPLLTLDLAAHAIYGRPAGIGNISALNASATMLGAALQEYGSIIAAAAGKALLLVAPLVVKAWIGHERRWSIVCPLLLAAALTAMYGTILVKRGPPALIGFPKGFSYALGSVYLKLNDVIGRPRRVPAQPMTAPEYPDIRNVVVVVDESVEYGYFSRVLDAGKSRYADFGLAYSGANCSAASNYILRKALWSRSDRGRLGIARTDSLFALARRAGYVVTYIDNQGVLSDPTTRNYIDAKELGDINRVVENEGPPYERDPTALQQIAVLARTGRNFIFVNKNGAHFPYPASVAPDRATGDRVADYTTSVRVNAADFLLALQDAVPADTMVFYTSDHGQSLTTRATHCNTGAETTAQEFRVPFLVLATNPGPAQQLQQAAALQRGRLTHLEFSESVRRVLGYRIPGMGSIFDARPAQAGFCGLYGSPKVFFGMLPECRVLVR
>NZ_CP021109.1|WP_157664864.1|2712163_2716027_+|hypothetical-protein
MPTAVSPLAPAAGQPLHNRADQPLSTRAPDDLVQLLPAQRQPRSTVASGDAAMPRHGHAIYENRRWRRDAPDARPAAPPDSLPSGQPRAEDAWIAACRAGPVDTAYWNGRLEDDDALMVRLATASGGYAGTPTAADLTPAKRRELAVSLIRALTAGIDWQVSLGQAPNATAGIYFDGLTLRNASGKPMAGIVQELEARIASVLQACGTAQLAGLTDCAGLARQVRRMMTSDPTLSLQPPPDVSYGSPRWVTLWTGMQTLADQGLSPHKVSTDDLLAVGRAAIAVQTRKSPRPAGGATPPGIDIGALLLMAHAAGRIDLRRIAQEAPDSAAGGEAAALAPEDLDRLTSFLKEIMADELRILDAIAGLKPPTGRELAADNLRAAGLDPEHRVDVRSVVIPAAFGPVRFKIPLPFAFDQQALADVYVSHETLDLSEDAGDPALSAPVSPEVSRARTKLGRSLKDEFDAAFDRYKTTAAGHIATLIDASVARYGSDHGIDFEGATITVTRAQRVDSLHLPVVPGPGQALLAQATASTKRTDANGYFVSIDTSAGRHRYFVALADGAEYPLPPERSIEDWAASHGEIVFGTAVHKPDFPGSLFNDLTYPLTTLATGKREEIGAQLKASLPGTLERSRAALYGGSEVETIRGIERGLIPFYSTYSAIKDGRTEDIAWSLALDVLIFVPALGEGLSLGMRAGEALMAGLSRAVSETAGEGLLQAIKLGVAESGRFAPALMRQAGKTLGAVAHSAVIDPRDLLKLLRGGALLGNKGLRAVARSLKTSRPELAQALIEAARKMSAGGARYRPLPAGMLRRYRISDPGLIDTLSKAARSDDGTIMLGAKRYAEVEGNYLALTADHAASTQERPVWRIAGAGLPGTRQGGVRLVWDAELGRWQEAKNVPQLKGGGSTSASASTSASGSASATPAGTQLTRVKVADDAVAALDRDVPADAPNHRGDYDNWDNSEIYEYSYTGRLANTETVELAVEVLEEANDITQYAWWESEFDDFFDMEVVGLETSAYAEIDPRYADPETVKHLKITMTDRIRTFLTDLYARSETFRALVNRARSEGYIAKDDKWTIQIQPPDALSGGLCEFAEEHGAEYDDRIVRIPDLQAPPHGLQDQMLADGYTFEPYLSPATIIHELIHVLTRRSDPAVDLWKDEASHLVHGFPERGVVEYLTQRVLKESGIQAPRRLTYLSFTSEGQADLARVITPEKIAALQRYVDMQDDYLLKRFPQHDPNPATPWNPSAGNERWLTADSVGSGSESGSDSESGSGSESGSGSGSPEPMET
>NZ_CP021109.1|WP_086057682.1|2711208_2711997_+|flagellar-biosynthetic-protein-FliR
MISFTLDQWHGWINAFLWPFARLLALIGVAPVFGESSAPPLVKIGLAAILAVVIAPSLPPMPAVSPASYQGLWILAQQVFIGIATGFCMRVCFAAVQTAGDFVGLQMGLSLATIFDPTTQSNTEVLARLFNILAMLVFLSVNGHLLMLGMLVKTFTVLPIGTPVLNPEGWAAVAQLGSKIFSTGLLLALPLIAALLTIQLALGILNRAAPQLSVFAVGFPITLTAGVILLAVALPQSTGFLAAFFEESVNAMERVASLLAGI
>NZ_CP021109.1|WP_086057681.1|2710888_2711158_+|flagellar-biosynthesis-protein-FliQ
MDAETVMTMTYQAMRMVLIVAGPLLGVTLAVGLLVSVFQAATQINEMTLSFIPKLLAVAATLVLLGPWLIGMMTDYIRQIMDQIPTLVS
>NZ_CP021109.1|WP_086072561.1|2710119_2710875_+|flagellar-type-III-secretion-system-pore-protein-FliP
MRTAAITLAGLALLALACIPLSASAQATLPALTATPGPNGSETYSLSVQTLLMLTSLTFLPAALLMMTGFTRIIIVLGLMRSALGTQTTPPNLVLIGLALFLTAYTMSPVFDQIYKDAYQPFSEGAISFETAIERGSQPLRTFMLHQTRETDLSLFANLTNQPAMETPAEVPMKVLVPAFVTSELKTAFQIGFTIFIPFLIIDMVVASVLMGLGMMMVPPISVSLPFKLMLFVLADGWHMLLGSLARSFYQ
>NZ_CP021109.1|WP_086057679.1|2709725_2710055_+|flagellar-biosynthetic-protein-FliO
MADAAPFRVFIGLIVVIAAILLCGWIARRAGLAGRTHGGALRIVDSLNLGPRQRIVLVQVEDARLVVGIAANQMNLLHTLPPGSAAPEEPGLPASRAFAHKLGQALRRN
>NZ_CP021109.1|WP_086057678.1|2709181_2709721_+|flagellar-motor-switch-protein-FliN
MTDQNAERPDQNKPASGAADDWADALAEQSRAAPPTQADGLKPADDWADALAEQTAASASPAAAPAPAASAAKPAAASVFKPLSGSSEKSTADIDLIMDVPVQLTVELGRTRLTIKNLLQLGQGSVVELDGLAGEPMDIFVNGYLIAQGEVVVVDDKYGIRLTDIITPAERINRLNGRR
>NZ_CP021109.1|WP_086072566.1|2723951_2725631_-|flagellar-hook-associated-protein-FlgK
MSLYSLGLSGLNAAQAGLTTTGHNIDNAATEGYTRQRVLTSTAGATATSAGFYGRGVQVDTVQRQYDSFLYKQLVGSQSSASSYSTYLDQISQIDNRLGDETVGISPALAEFFASVNAVASGPADAAARADMIGTAQALVSQINSAYQDLQTQREGLNTQIASAVNQVNSYLNQINKLNQEIVIARAQGNGNAPNDLLDQRDQLLSELSQTVGIRYTTQGDMVSISLESGQALLSGTTVYSLQAVASSTDPSRTVVAYNLPSGPGGATTPVQLDDSKFKNGTLGGLMQFRSTALDTLQNRLGQMAVGLAMTFNAVHQQGVDRQGLPGGDFFSMISPAAISGAANAGTGGITADYTDASQITASDYSIKYVQSDPADPTTGQYVVTRLSDNTTNTYTPTGTPPTITFDGLTLNLSGTPADGDTWTLQPTRNAARDLGMAITDPGKIAASSTTNPGTANGDNALALAKLQTTRNLAGNTLSVTDLYAQIVNNVGQQTAAAKANDKAQTAVVNQRLANNSSVSGVNLNEEYVNLSQYQEQYQAAAKIIEVAGTMLDAILGLR
>NZ_CP021109.1|WP_086072567.1|2725738_2726875_-|flagellar-assembly-peptidoglycan-hydrolase-FlgJ
MALGPSSNAGASQSSIFDFGALASLHRDVTTQPNSAEKQAEVARQFEAVYIQMLLKQMRQATMQSGMFDSNESRMVRSMADEQLALQLANPGIGLAQSLLKQMRANQPGEAGQGQDGGTGAQAPQQPLDLAARTVARAAPDGEVAALLRLLNRNRASDRALAAAEGAPDHVVDFVSQMASAAKAAERQSGVPARLILGQAALESGWGQREIRYPDGRTSYNLFGIKAGDSWKGKVVNVMTTEYEDGVPRKVMQPFRAYNSYEESFADYARLISDNPRYEAVTQARDEYDAARRIQAAGYATDPRYADKLIGIMGQLAGTAGAGQGPDAGVAAGRPGPGATAFEGRSAPGWDGQDSAESARAEAVAALSAAEPIAGGVR
>NZ_CP021109.1|WP_086059437.1|2726887_2727955_-|flagellar-basal-body-P-ring-protein-FlgI
MAAGMGAHAERLKDLASIQGVRGNQLIGYGLVVGLDGTGDQVRQAPFTQQSVTNMLSQLGVTVPANSNMQLKNVAAVMVTMNLPAFARPGQTFDVVVSSMGNAKSLRGGTLLLTPLKGADGQVYALAQGNILVGGAGASAGGSSVQINQLNGGRISNGAVVERGVPTTFARDGNVFLELNELDFGTAQNVAAALNRHFGGGVSQVIDGRTIRVQAPVEPSAQAAFLSQLENLQVTRAPASAKVIINARTGSVVMNRTVMLEESAVAHGNLSVVVNQTNAVSQPNTPFGGGQTVVVPNTTIDVRQENGSLQHVRTSANLADVVRALNALGATPQDLLAILQAMQSAGALRAELEII
>NZ_CP021109.1|WP_086057691.1|2728235_2728931_-|flagellar-basal-body-L-ring-protein
MSPAMRAVRFLCSIVLAAGLGGCALIPPEPVVLGPTTAMPPPQPVPVPTPNGSIYQPTVYGNYPLFEDRRPRNVGDIVTVVLEERTAAAKNVATNTSRTSTTQNTVAASPGFMSSWFNSKLNTETEGANTNKGAGDSSANNTFTGTLTTTVVGVLPNGNLQVAGEKQIAINRGSEYIRFSGVVDPRSVSGLNTVSSTQVADARIEYRSKGVMDEVQTMGWLQRFFLIANPF
>NZ_CP021109.1|WP_086057692.1|2728930_2729716_-|flagellar-basal-body-rod-protein-FlgG
MLRSLWIAKTGLEGQQTSLDVISNNLANVNTNGFKRGRAVFQDLMYQTLRQPGAQVGDANQLPSGLQLGTGTRVAATERLHSEGNLTSTGDPMDIAIQGQGFLQVQLPDGTDAYTRDGSLQVDQNGQLTTAGGLVIQPPINVPNNALSLTIGKDGTVSVTQPAAPGTNVQIGQLQLANFINPNGLQAIGDNLYLETDASGAPNVGQPTVDGLGSILQNYVETSNVNVAEELVNMITTQRAYEMNSKAVETSDQMLARLTQL
>NZ_CP021109.1|WP_086057693.1|2729764_2730526_-|flagellar-basal-body-rod-protein-FlgF
MDRVIYTAMNGAARISEEQAVLSNNMANVNTPGFRAQIALYRSVPINDGTSLPTRVSTVASTPRNDFQAGVMQTTGRNLDVAITDNGWLAVQTPQGEAYTRAGDLQVGVNGLLQTAQGMPVLSNQNGPIDVPPDASLTIAVDGTITAIGAGDPPNTILNLGQLKLVSPPTESLVHGDDGVFRRVAANGQPAPPMPADPTLRVMPGVLEGSNANAASSMVGMIENARRFEMQMQVIRDAQANEEKANTILSTVS
>NZ_CP021109.1|WP_086072568.1|2730558_2731767_-|flagellar-hook-basal-body-complex-protein
MGFGQGLSGLDAASQNLDVIGNNIANANTVGFKSATATFADIYATSRVGLGVKVASIDQRFTVGNVTSTGGQYDIAIDGANGFFRLVDASGAVTYTRNGQFRIDKDLNLVNAAGQQLTGYGPAGVGTAPVPLSLPTANIAPEATNSSGFVANLNANANAIDPATTFDPTNAATYTDSQPMTVYDSLGNSHQLTQYFVKREANAAGESVYDVYYTLDGAAMTPTSATLTFDKAGRMTSAPTVPVGFANPGGTGSPAADLAITLDYTGTTQFGSDFKADFTPNGNTSGEFTNISFGKDGSIVANYTNGKTQVVGVVALANFNNVNGLQPVGDNAWSETSESGQAVLGQPGTNGLATLQGQAVEASNVNLSTELVNMIVAQRTYQANTQTIKTQDQVLQSLLAIQ
>NZ_CP021109.1|WP_086057695.1|2731851_2732547_-|flagellar-basal-body-rod-modification-protein
MTTTSNVNNTTTTGGASSSSSSSASSAQSLQDQFLTLLVAQMNNQDPLNPMDNYQLTSQLAQISTVQGVQDLKTVVQAISGQVDLSQSMNAVSMIGKQVLIPGNSLKVDTDASGAKVMTPIGIDVQADAGDVVLKISDNTGRVVRTIDLGAQDAGIITPAWDGKDDSGNVMPDGAYTISVNATNADGSAVTAEALTYGQVGGISYTTQGVRLDLGLAGQVSMLDVRKVLGS
>NZ_CP021109.1|WP_086057696.1|2732587_2733004_-|flagellar-basal-body-rod-protein-FlgC
MGLLSIFDISGSALTAQSQRMNVAASNLANADSAVGPDGQPYRARQVVFQVNPGQGQMTGAEIGGVRVAGIVQDNAPMRRQYDPTNPLADAQGYVTMPNVDPVAETVNMISASRSYQANVEVLNTAKALMQKTLTIGQ
>NZ_CP021109.1|WP_086059438.1|2733023_2733431_-|flagellar-basal-body-rod-protein-FlgB
MIDRLSQDLGFFQQSLDLRAQRQEILSANIANADTPNYKARDFDFRSALESAMGAGMNLPPVNLALTSPRHIAAQGQSFPTVDLLYREPYQASLDGNTVDMDAERVQFADNTLHYQSTSTILSAKIKSMLTAISE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_12

3527481-3527594

Orphan

Consensus_repeat	Method
GACACACGGGCTGCCTCCCCGCATCCCCACGGGACACGGGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_12

>merge|NZ_CP021109|12|3527481-3527594|CRISPRCasFinder
GACACACGGGCTGCCTCCCCGCATCCCCACGGGACACGGGGAGACACACAGGCGGGAGACACACGGGCGGGAGACACACGGGCGGCCTCCCCGCATCCCCACGGGACACGGGGA

>NZ_CP021109|12|12|3527481-3527594|CRISPRCasFinder
GACACACGGGCTGCCTCCCCGCATCCCCACGGGACACGGGGA	GACACACAGGCGGGAGACACACGGGCGGGA
GACACACGGGCGGCCTCCCCGCATCCCCACGGGACACGGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086058306.1\|3529810_3530857_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270367
NZ_CP021109.1\|WP_086058308.1\|3532210_3532819_-\|recombination-protein-RecR	unknown	unknown	gnl\|CDD\|234616
NZ_CP021109.1\|WP_086058304.1\|3528189_3528984_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NZ_CP021109.1\|WP_086072944.1\|3518453_3519770_-\|pyrimidine-utilization-transport-protein-G	unknown	unknown	gnl\|CDD\|132655
NZ_CP021109.1\|WP_086072950.1\|3533258_3535826_-\|DNA-polymerase-III-subunit-gamma/tau	unknown	unknown	gnl\|CDD\|237057
NZ_CP021109.1\|WP_086058301.1\|3522849_3526083_-\|carbamoyl-phosphate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|235393
NZ_CP021109.1\|WP_086072945.1\|3520060_3520702_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP021109.1\|WP_086058305.1\|3529011_3529818_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP021109.1\|WP_086058302.1\|3526093_3527221_-\|glutamine-hydrolyzing-carbamoyl-phosphate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|237139
NZ_CP021109.1\|WP_086073691.1\|3520753_3521536_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235910
NZ_CP021109.1\|WP_086058297.1\|3517511_3517988_-\|transcription-elongation-factor-GreA	unknown	unknown	gnl\|CDD\|234693
NZ_CP021109.1\|WP_086072948.1\|3530880_3532116_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP021109.1\|WP_086072946.1\|3521611_3522511_-\|lipid-A-hydroxylase-LpxO	unknown	unknown	gnl\|CDD\|380241
NZ_CP021109.1\|WP_086072943.1\|3516800_3517418_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|198171
NZ_CP021109.1\|WP_086072947.1\|3527627_3528179_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP021109.1\|WP_086072949.1\|3532883_3533210_-\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|234669
NZ_CP021109.1\|WP_086058295.1\|3516141_3516783_-\|RlmE-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223370
NZ_CP021109.1\|WP_086072951.1\|3537123_3537987_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293817
NZ_CP021109.1\|WP_086072952.1\|3537986_3538625_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086058294.1\|3514055_3515942_-\|ATP-dependent-metallopeptidase-FtsH/Yme1/Tma-family-protein	unknown	unknown	gnl\|CDD\|273520

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086058306.1\|3529810_3530857_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270367	cd13649, PBP2_Cae31940, Substrate binding domain of an uncharacterized protein similar to ABC-type transporter for thiamin biosynthetic pathway intermediates; a member of the type 2 periplasmic binding fold superfamily. This subfamily includes the periplamic-binding protein Cae31940 which is phylogenetically similar to the ThiY/THI5 family. ThiY is the periplasmic N-formyl-4-amino-5-(aminomethyl)-2-methylpyrimidine (FAMP) binding component of the ABC transport system (ThiXYZ). FAMP is imported into cell by the transporter, where it is then incorporated into the thiamin biosynthetic pathway. The closest structural homologs of ThiY are THI5, which is responsible for the synthesis of 4-amino-5-(hydroxymethyl)-2-methylpyrimidine phosphate (HMP-P) in the thiamin biosynthetic pathway of eukaryotes, and periplasmic binding proteins involved in alkanesulfonate/nitrate and bicarbonate transport. After binding the ligand, They interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ThiY/THI5 proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.33682e-123
NZ_CP021109.1\|WP_086058308.1\|3532210_3532819_-\|recombination-protein-RecR	gnl\|CDD\|234616	PRK00076, recR, recombination protein RecR; Reviewed.	4.52339e-108
NZ_CP021109.1\|WP_086058304.1\|3528189_3528984_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	3.18546e-71
NZ_CP021109.1\|WP_086072944.1\|3518453_3519770_-\|pyrimidine-utilization-transport-protein-G	gnl\|CDD\|132655	TIGR03616, Putative_pyrimidine_permease_RutG, pyrimidine utilization transport protein G. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the uracil-xanthine permease family defined by TIGR00801. As well as the The Nucleobase:Cation Symporter-2 (NCS2) Family (TC 2.A.40).	0
NZ_CP021109.1\|WP_086072950.1\|3533258_3535826_-\|DNA-polymerase-III-subunit-gamma/tau	gnl\|CDD\|237057	PRK12323, PRK12323, DNA polymerase III subunit gamma/tau.	0
NZ_CP021109.1\|WP_086058301.1\|3522849_3526083_-\|carbamoyl-phosphate-synthase-large-subunit	gnl\|CDD\|235393	PRK05294, carB, carbamoyl-phosphate synthase large subunit.	0
NZ_CP021109.1\|WP_086072945.1\|3520060_3520702_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	1.12559e-71
NZ_CP021109.1\|WP_086058305.1\|3529011_3529818_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	5.54134e-116
NZ_CP021109.1\|WP_086058302.1\|3526093_3527221_-\|glutamine-hydrolyzing-carbamoyl-phosphate-synthase-small-subunit	gnl\|CDD\|237139	PRK12564, PRK12564, carbamoyl-phosphate synthase small subunit.	0
NZ_CP021109.1\|WP_086073691.1\|3520753_3521536_-\|SDR-family-oxidoreductase	gnl\|CDD\|235910	PRK07024, PRK07024, SDR family oxidoreductase.	3.4833e-138
NZ_CP021109.1\|WP_086058297.1\|3517511_3517988_-\|transcription-elongation-factor-GreA	gnl\|CDD\|234693	PRK00226, greA, transcription elongation factor GreA; Reviewed.	7.78642e-81
NZ_CP021109.1\|WP_086072948.1\|3530880_3532116_-\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	2.65068e-143
NZ_CP021109.1\|WP_086072946.1\|3521611_3522511_-\|lipid-A-hydroxylase-LpxO	gnl\|CDD\|380241	NF033391, lipid_A_LpxO, lipid A hydroxylase LpxO. Members of this family are LpxO, an enzyme that modifies one of the lipid chains in lipid A by hydroxylation, with resulting changes in resistance to the host immune response and to the antibiotic colistin. This family, as built, includes LpxO1 from Pseudomonas aeruginosa, but not its paralog LpxO2.	0
NZ_CP021109.1\|WP_086072943.1\|3516800_3517418_+\|hypothetical-protein	gnl\|CDD\|198171	smart01103, CRS1_YhbY, Escherichia coli YhbY is associated with pre-50S ribosomal subunits, which implies a function in ribosome assembly. GFP fused to a single-domain CRM protein from maize localises to the nucleolus, suggesting that an analogous activity may have been retained in plants. A CRM domain containing protein in plant chloroplasts has been shown to function in group I and II intron splicing. In vitro experiments with an isolated maize CRM domain have shown it to have RNA binding activity. These and other results suggest that the CRM domain evolved in the context of ribosome function prior to the divergence of Archaea and Bacteria, that this function has been maintained in extant prokaryotes, and that the domain was recruited to serve as an RNA binding module during the evolution of plant genomes. YhbY has a fold similar to that of the C-terminal domain of translation initiation factor 3 (IF3C), which binds to 16S rRNA in the 30S ribosome.	2.63564e-29
NZ_CP021109.1\|WP_086072947.1\|3527627_3528179_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	5.3565e-19
NZ_CP021109.1\|WP_086072949.1\|3532883_3533210_-\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|234669	PRK00153, PRK00153, YbaB/EbfC family nucleoid-associated protein.	1.01533e-44
NZ_CP021109.1\|WP_086058295.1\|3516141_3516783_-\|RlmE-family-RNA-methyltransferase	gnl\|CDD\|223370	COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis].	2.05541e-90
NZ_CP021109.1\|WP_086072951.1\|3537123_3537987_+\|hypothetical-protein	gnl\|CDD\|293817	cd07731, ComA-like_MBL-fold, Competence protein ComA, ComEC and related proteins; MBL-fold metallo hydrolase domain. This subgroup includes proteins required for natural transformation competence including Neisseria gonorrhoeae ComA, Pseudomonas stutzeri ComA, Bacillus subtilis ComEC (also known as ComE operon protein 3) and Haemophilus influenza ORF2 encoded by the rec-2 gene, as well as Escherichia coli YcaI which does not mediate spontaneous plasmid transformation on nutrient-containing agar plates. It also includes the phosphorylcholine esterase (Pce) domain of choline-binding protein e from streptococcus pneumonia. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. .	1.63722e-14
NZ_CP021109.1\|WP_086058294.1\|3514055_3515942_-\|ATP-dependent-metallopeptidase-FtsH/Yme1/Tma-family-protein	gnl\|CDD\|273520	TIGR01241, ATP-dependent_zinc_metalloprotease_FtsH, ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH. [Cellular processes, Cell division, Protein fate, Degradation of proteins, peptides, and glycopeptides].	0

>NZ_CP021109.1|WP_086058302.1|3526093_3527221_-|glutamine-hydrolyzing-carbamoyl-phosphate-synthase-small-subunit
MADGTVFRGISIGAPGHTVAEVVFNTAMTGYQEILTDPSYAGQIVTLTYPHIGNTGVNAEDVEARRVFASGLVVRDCPARVSNFRATSSLPEYLKSQGIVAIAGVDTRKLTRILREKGAQGGCILAGDDAERAIALAREFPGMSGQDLAKTVSIEANSQWNEGTWRLGEGFNRPETGKFHVVAYDFGVKHNILRLMADRGCRITLVPAQTPAEEALKLNPDGLFLANGPGDPEPCDYAIEATRAFLARKLPVFGICLGHQIMGLAVGGKTRKMKTGHHGANHPVQDVDTKRVFITSQNHGFEVDAATLPENARVTHISLFDGTLQGFELTDRPAFCFQGHPEASPGPHDILVLFDKFISQMAGQAETAKSASKIA
>NZ_CP021109.1|WP_086058301.1|3522849_3526083_-|carbamoyl-phosphate-synthase-large-subunit
MPKRTDIKSILIIGAGPIIIGQACEFDYSGAQACKALKAEGYRTILVNSNPATIMTDPETADVTYIEPITWQAVEKIIERERPDALLPTMGGQTALNCALDLAHNGVLERYNVELIGANERAIEKAEDRQKFKQAMTDIGLESAKSGVAHSMDEAWEVQKRIAAELGNSGFPVVIRPSFTLGGTGGGIAYNAEEFETICRRGLEASPTSELLIEESLLGWKEFEMEVVRDRADNCIIVCSIENLDPMGVHTGDSITVAPAQTLTDKEYQIMRDASIAVLREIGVDTGGSNVQFAVNPANGRMIVIEMNPRVSRSSALASKATGFPIAKVAARLAVGYTLDELRNEITGGATPASFEPTIDYVVTKVPRFAFEKFPTADARLTTQMKSVGEVMAIGRTFQESFQKALRGLEVGVDGLNQKTTDREKLQVELGEPGPERIWYVGDAFAQGFTLDEVHALTHIDPWFLAQIKEIVDIELALEQKTLADLDYDTLWQLKRRGFSDRRLAFLLDTSESEVRRLRHQLNVRPVYKRVDTCAAEFATRTAYMYSTYEEECESAPTDRKKIIVLGGGPNRIGQGIEFDYCCVHAALALREDGYETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIVHKENPVGMIVQYGGQTPLKLARALEANGVPIIGTSPESIDVAEDRERFQKLLNKLGLRQPPNRTARTEAEALAHAAEIGYPLVVRPSYVLGGRAMEIVHEQQDLERYMREAVKVSNDSPVLLDRFLNNATEVDVDCLADGETVFIGGVMEHIEQAGVHSGDSACSLPPYSLSAEVIAEIKRQTGMMAKALNVSGLMNVQFAIQGGDVYVLEVNPRASRTVPYVSKATGLQLAKIAARVMTGKTLASQGVTREIVPSYFCVKEAVFPFVKFPGVDTILGPEMKSTGEVMGVGASFGEAFVKSQMAAGVRLPENGTAFISVKPQDKPRAVEVARGLHALGFKLVATRGTAAEIEAAGIPVQVVNKVTEGRPHIVDMLKNGEVSLVINTVEERRNAIADSRAIRTQALAARVTFYTTIAGARAAVEGMQYMRQGHGLQVYPLQGLHAEL
>NZ_CP021109.1|WP_086072946.1|3521611_3522511_-|lipid-A-hydroxylase-LpxO
MKWAILALFIICAVVVHFRGKVRHRFSRQALDHSTFTSPINVFMYAFSRVPNQPYLSLSEFPELKVLQQRWQDIRAEAEKLFSAGHIKVSDKYNDAGFNSFFKSGWKRFYLKWYDADHPSARALCPVTTGLLADIPSIKGAMFAALPPGSRLPRHRDPYAGSLRFHMGLITPNDPDCYIDVDGQPYYWRDGEAVVFDETYIHYAENKTDVNRIILFADVERPMRYRWAQAVNHFIGNVLLRAAASPNQEGDRTGGINRIFGAVYAVRRFGKRIKKKNKTLYYVLKWAVVLGILAWIFWP
>NZ_CP021109.1|WP_086073691.1|3520753_3521536_-|SDR-family-oxidoreductase
MRHVFITGASSGLGRALAGFYAARGATLGLVGRREGALRDLAAALPGAHAWYGVDVRDRPALHQAASDFLARCGGTVDCVIASAGISAGTLTEQAEDFDVFRAIVETNLLATVATFEPFIASMRTARQGRLVGISSVAGVRGLPGAGAYSASKAAVTAYCESLRNELFADGVRVVTIAPGYIRTPMTAHNPYRMPFLMDAEAFAARAAIAIDRGRSYTVIPWQMGMVARLMRALPDLVYDRLARNAPRKPRQTGAGRDVS
>NZ_CP021109.1|WP_086072945.1|3520060_3520702_+|histidine-phosphatase-family-protein
MTEIWLIRHGETDWNRARRLQGWQDTPLNAHGVNQAERLAERLAQDAATGPFDALYSSDLQRAHDTATPAAERLGLRVRPEPGLRERCYGVLEGVTMDRLDIEQPEAAAAWKSREPDRLLDGGETLRQFHNRVVATIDDIAQRHDGGRVLVFTHGGVLDIVWRHAQGIPLTHPRDAALLNAGVNRLSVDNRRWHVMGWADITHISTLAKDDVV
>NZ_CP021109.1|WP_086072944.1|3518453_3519770_-|pyrimidine-utilization-transport-protein-G
MSGTYFPRWRLVREMAPGAVMAPDERMPWMKTVAMGLQHVVAMFGSTVLAPLLMGFDPNVAILMSGVGSLIFFLFVGGRVPSYLGSSFAFIGGVIAVTGYAGSGANPNIGVALGGIVMCGLAYTVIGLLVWAAGARSGGGTRWIEMLMPPVVTGAVVAVIGLNLAPVAAKGAMGGSGFDAAMALVTVLCVGAIAVRTRGMLQRLLILVGLVLACVIYAVCANGLGLGKPMDFSGVAAAAWFGLPQFAKPVFQASAMGLLVPVAIILVAENLGHIKAVSAMTGRDLDRYLGRAFVGDGVATMVSGAVGGTGVTTYAENIGVMAVTRIYSTVVFAVAALIAILLGFSPKFGALIQTIPGPVLGGMSVVVFGLIAVAGARIWVVNAVDFTDNRNLIVAAVTLILGAGDFTVKLGNFALGGIGTATFGAIILHALLRPRRPA
>NZ_CP021109.1|WP_086058297.1|3517511_3517988_-|transcription-elongation-factor-GreA
MSAIPLTVHGAERLRSELHRLKTVERPAVISAIAEARAQGDLSENAEYDAARERQGFVEARIAELEATLSNAHIINPVELDADGRAVFGATVEIEDLDSGERLMYQIVGDVEADIRANRISVSSPVARALIGKTEGDVVEVQAPSGVREYEVISVRYL
>NZ_CP021109.1|WP_086072943.1|3516800_3517418_+|hypothetical-protein
MPILEITSRERSALRSAAHALRPVVLIGDKGLSDAVLKEIDANLASHGLIKVRAGGEDRETREEMLAAICDALSCAPVHHLGKMLILYRPRPGMPSPAQADAPAKSAKRKPSEPYTPKKIAAEGKTLAKPARAPRKSAEPADETRRPAASRVTLNKAGKPARPSTRKTAAPAHGIPRRTGSALSLRAGARGARPAAGAARKTAKR
>NZ_CP021109.1|WP_086058295.1|3516141_3516783_-|RlmE-family-RNA-methyltransferase
MAKNKFSKDWLHQHINDPYVKLAQQKGYRARAAFKLIEILDTEKLMRRGDVVVDLGSAPGSWSQVARERLAGPGGAIDGRILALDILPMEPVAGVEFLQGDFREESVLAQLEETLNGQPVDLVISDMAPNLSGVSVADAARIQHVCDLALEFALAHLKPEGALIVKAFHGSGFSQIVQSFKQHFKRVVERKPKASRSNSSETFLVARGRKQVG
>NZ_CP021109.1|WP_086058294.1|3514055_3515942_-|ATP-dependent-metallopeptidase-FtsH/Yme1/Tma-family-protein
MNNSFSKVAVWMVIALVLFTVFKQFDGRTQTQDGVSYTQFMDDAKAGRIRKVDVQGDVLYVTPESGRPYTLTSPGDLWMVSDLLKYGVQVSGKAREEQSLLMNIFVSWFPMLLLIGVWIFFMRQMQGGGRGGAFSFGKSRARMLDENTNQVTFADVAGCDEAKEDVQELVDFLRDPSKFQKLGGRIPRGVLMVGSPGTGKTLLAKAIAGEAKVPFFSISGSDFVEMFVGVGAARVRDMFENAKKHAPCIIFIDEIDAVGRQRGAGLGGGNDEREQTLNQMLVEMDGFESGQGVIVIAATNRPDVLDPALLRPGRFDRQVVVPLPDIRGREQILKVHMRKVPLSPNVDASVLARGTPGFSGADLANLVNEAALFAARRNGRTVDMSDFEKAKDKIIMGAERRSIVMPEEERKNTAYHESGHAIVARMLPKTDPVHKVTIIPRGRALGVTMQLPESDRYSMDKQRLLSTIAVLFGGRIAEELFMNQMTTGASNDFERATAIARDIVTRYGMDQELGPMVYAENEGEVFLGRSVTKTTHVSEATMQKVDASIRRIIDEQYEVARKILDGNRDKVEAMAAALLEWETIDADQIDDIMSGRPPRPPKTPQGPSDTADNNPSGLAPGGSAAPAV
>NZ_CP021109.1|WP_086072947.1|3527627_3528179_-|carboxymuconolactone-decarboxylase-family-protein
MARLPYANLESDEARPLVDRIVAERGSVLLLYQMLLHSPPVASGWLTYLTAIRQLSTLPGALRELVIMRVAILNGAPYEADQHAPIARKEGITEAQLDELDRWETSPLFDEDQRAALAYTDAMTRHIRVPQEVFDAVRARMGERQVVELTATIAAYNMVSRFLEALQVHTHDEGSGPDARVGA
>NZ_CP021109.1|WP_086058304.1|3528189_3528984_-|ABC-transporter-permease
MQSMMKTGSNFLRLWQVLLLVILILIWHVASRSQNVAFFFGEPWQVAQRIWAWFVTDADIYRHLWITLSETVLAFAIGTITGLAAGLWLGLSPGASALLDPYIKAANSMPRVILAPIFGMWFGLGIWSKVALAVTLVFFIVFFNVYQGVREVSTTILDNARMLGADRRQLLRHVYLPSATSWVFSSLHTSVGLAFVGAVVGEYLGSASGVGYLILQAEGTLDVNTVFAGIVVLTVFALVLDGVVTIVEKRLMKWQPRAGETEKL
>NZ_CP021109.1|WP_086058305.1|3529011_3529818_-|ABC-transporter-ATP-binding-protein
MADAALALEDITCTFVSREGGQRYTAVQKASLAIAPGEFVSVVGPTGCGKSTLLNVGAGLLKPSSGQVRVFGEPLSGINRRAGYMFQGEALMPWRSALDNVTAGLQFARVSAREADERGREWLRRVGLGGSEHRYPHQMSGGMRKRVMLAQTLIRDPDIILMDEPFSALDIQTRQLMENEVLDLWMAKRKAVLFITHDLDEAIAMSDRVVVLSAGPATHPIGEFAIDLPRPRDVAEVRTHPRFVELHAAIWSVLREEVLKGYAQQKRV
>NZ_CP021109.1|WP_086058306.1|3529810_3530857_-|transporter-substrate-binding-domain-containing-protein
MSVTRREWLKLAGAAGALGLAPAIVRAQKLEKKEVAIAVGGKALVYYLPLTIAEVRGYFKDEGLDVSIADFAGGAKALQAVVGGSADVVSGAFEHALNLQTKGQFYRDFVLQGRAPMIGFGVSAKNMPNYKSPADLKGKKIGVTAPGSSTNMVVNFFLAKHGLKPSDVSIIGVGAGAGAITALRSGQIDAISNTDPVVTALEHSGDLKIIADTRTLKDTKEIFGGNMPAGCLYCSQAYIDANPNTVQALTNAIVRADKWIQAQRDNLDAIANAVPKQYLLGEPEVYKASLKASLEGFSPDGMIPEDGAETAVKALAAFLPDFDPKKVDPSKIWTNEFVKRANQKYPNG
>NZ_CP021109.1|WP_086072948.1|3530880_3532116_-|CoA-transferase
MSALAGLKVLELGTLIAGPFAARLFGEFGADVIKVETPNGPDGKGGGDPIRTWRHLHEGNSLWWTVQARNKRSVALNLKDPRAREIALQLALDADVIIENYRPGVLEKWGLGYEQLRARNPATIMVRLSGYGQTGPLRDRPGFGAIGESMGGLRYVSGHPDRPPVRVGISIGDSIAALHGVIGAMMALRHRDATGGRWNGVSGGQGQMVDVALYEAVFNMMESLVPEYDVAGVVRERTGGALPGIVPSNTYTTGDGQNIVIAGNGDAIFHRLMIAIGREDLAHDPSLARNDGRAKRVEEIDGAIQAWCDGQTIDSALETLQRADVPVGKIYSVADMFRDPQFIARGMIEQHRFADGTPVKLPAVTPKLSETPGGTRWLGPRLGEHTEEVLKSLGYDAAAIAELAASGAIGI
>NZ_CP021109.1|WP_086058308.1|3532210_3532819_-|recombination-protein-RecR
MEPSLPEPEPLRALIEALRRLPGVGVRSARRMAYHLLQHDPRGAEQLGDALASAVHNLRHCSRCNSFTENEICATCANPKRDPTLLCIVETPADQNMIESSHGYRGLYYVLMGRVAPLEGIGPRELDFERLLARATDGVVTEVILATNFTAEGETTAHFLSESLRERGLSVTRLARGVPAGSELEYVDAGTIAWALMERKSA
>NZ_CP021109.1|WP_086072949.1|3532883_3533210_-|YbaB/EbfC-family-nucleoid-associated-protein
MMKGQLAGLMRQAQQMQENMKKAQEALADILVEGAAGGGLVKVTMSCRHDVKRVAIDPSLLSDDKDMLEDLVAAAFNDALRKAEATTQEKMASVTAGMPLPPGMKFPF
>NZ_CP021109.1|WP_086072950.1|3533258_3535826_-|DNA-polymerase-III-subunit-gamma/tau
MTYLVLARKWRPRSFDTLVGQDHVVRALTHALDTQRLHHAWLFTGTRGVGKTTLSRILAKSLNCETGITSRPCGVCRACTEIDAGRFVDYLELDAASNRGVDEMTQLLEQAVYAPGAGRFKVYMIDEVHMLTGHAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPPDAIVGHLRHVLGEEQLDFEVPALRLIAQAAAGSMRDALSLTDQAIAYSAGNLTEEAVRGMLGTIDQRHLVRLLDALSAGEARAVLAVADELATRGLSYSGALADLAGLLSRVAIEQRVAGVTPSDDPLAADIARLARSLHPDAVQLFYSVAVHSRGELALAPDEYAGFVMACLRMLSLHGDAGPQSLPAGPVPTSVASAAQAPAEVAGAAGAAAAAAADAPADTQSASAAVPVPSFGAAPSSPAPVGAAPQVSAVRADASSEPAGARDVPETSGSPAASPASAQISAASQRPGTESSATSSSSTSGASSSGPAAAGSSPSAPTASAPTAPASTQAANRAASAGVAPWEDAPAAAHRKTDEAPSAAGTSGGAEAHAQPNAFVQDAFPPVQPDPPVPTEPAARSGTQAASPADRSPAPASAAAPAAAPAPTPASAAAPASAPASAAAPAAASAPAPTQAPPAAAAASPDPDGPPAWVDEVIPDDAEGGYLPPAEASEDGFIASPDDEDFETVAGDAAAAPAMAVRRVAAPAASSRRSKRAPRLSDMSPAAWPQLAASLPVTGLAAELARQSEWQGVQGDTIVLRVAVKTLADSASRVRLQTVLCEHFGQSLRLEVMVGATGDATAHAVAQQERAERQRAAEAAVEADPFVQALLTDFGGRVVPGSIRHVDPPSAQAR
>NZ_CP021109.1|WP_086072951.1|3537123_3537987_+|hypothetical-protein
MVGQMQLRIWDVEHGACAMVQHLIGADRGRLAMIDSGCTPDWRPSDHIRDVLRRTTVDYLFITNADQDHMSDLAGLRRAGISVDTLIRNPHPPTDALREIKQNNGTPTDDIEEFLSMHGRYTAPPPLRFNEGMRGITAACYYNSYPDFENTNDLSLAAFIKYGNFSILFPGDLEVPGWKALLERPDFRAELAGVTILVASHHGRENGYCEEVFDYCKPMAIVMSDKAIHHDTQRMTQTYRQRVIDNYPDGVYVANTEKRRHVLTTRRDGWIQFDVSDSTFAITTERN
>NZ_CP021109.1|WP_086072952.1|3537986_3538625_+|hypothetical-protein
MKDSLKSANLKLLVSLAGLDTAITFCLAYPHIVEAISLSRLLRASVVPFLPIVVLLLVELAPHNVKAVLVFWKFKDPLPGHAAFTKHGPSDPRIDMNALQRHVGTLPVNPKEQNATWYKLYKRVEADTRVVGAHKAYLLWRDATALSLLLSIAVPFALWCFDAASSLVRASLLLFGLQYILSALAARNSGNRFVCNVLALHAAKRITAASKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_13

3764114-3764217

Orphan

Consensus_repeat	Method
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_13

>merge|NZ_CP021109|13|3764114-3764217|CRISPRCasFinder
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGGAAGGGGAAGTCCACCCCCGAAGCGCTGACGCGCTTCCCCCTCGAGGGGGCGACGCTGGCGGACCGG

>NZ_CP021109|13|13|3764114-3764217|CRISPRCasFinder
CGCGCTTCCCCCTCAAGGGGGCGACGCTGGCGGACCGG	AAGGGGAAGTCCACCCCCGAAGCGCTGA
CGCGCTTCCCCCTCGAGGGGGCGACGCTGGCGGACCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086058493.1\|3767116_3767818_-\|urea-carboxylase-associated-family-protein	unknown	unknown	gnl\|CDD\|378156
NZ_CP021109.1\|WP_086073704.1\|3754413_3755133_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086058488.1\|3760480_3761620_+\|tRNA-guanosine(34)-transglycosylase-Tgt	unknown	unknown	gnl\|CDD\|234642
NZ_CP021109.1\|WP_086073056.1\|3762215_3764093_+\|protein-translocase-subunit-SecD	unknown	unknown	gnl\|CDD\|235615
NZ_CP021109.1\|WP_086073707.1\|3771386_3772217_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270343
NZ_CP021109.1\|WP_086073063.1\|3772488_3773217_-\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|319787
NZ_CP021109.1\|WP_086058485.1\|3755516_3756935_+\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|182606
NZ_CP021109.1\|WP_086073060.1\|3767829_3769161_-\|M20-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|349880
NZ_CP021109.1\|WP_086058486.1\|3756939_3757578_-\|uracil-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234653
NZ_CP021109.1\|WP_086073055.1\|3753464_3753920_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
NZ_CP021109.1\|WP_157664920.1\|3769147_3769948_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP021109.1\|WP_086073059.1\|3765547_3766501_-\|agmatinase	unknown	unknown	gnl\|CDD\|212538
NZ_CP021109.1\|WP_086073705.1\|3757648_3759094_-\|D-alanyl-D-alanine-carboxypeptidase/D-alanyl-D-alanine-endopeptidase	unknown	unknown	gnl\|CDD\|224938
NZ_CP021109.1\|WP_086059556.1\|3766505_3767108_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP021109.1\|WP_086058489.1\|3761774_3762116_+\|preprotein-translocase-subunit-YajC	unknown	unknown	gnl\|CDD\|235518
NZ_CP021109.1\|WP_086073706.1\|3759404_3760475_+\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	unknown	unknown	gnl\|CDD\|234666
NZ_CP021109.1\|WP_086058497.1\|3770662_3771376_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP021109.1\|WP_086073058.1\|3764569_3765499_+\|protein-translocase-subunit-SecF	unknown	unknown	gnl\|CDD\|237275
NZ_CP021109.1\|WP_086058484.1\|3753981_3754299_-\|DUF883-domain-containing-protein	unknown	unknown	gnl\|CDD\|377576
NZ_CP021109.1\|WP_086073062.1\|3770021_3770663_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086058493.1\|3767116_3767818_-\|urea-carboxylase-associated-family-protein	gnl\|CDD\|378156	pfam09347, DUF1989, Domain of unknown function (DUF1989). This family of proteins are functionally uncharacterized.	2.6575e-74
NZ_CP021109.1\|WP_157664920.1\|3769147_3769948_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.01873e-125
NZ_CP021109.1\|WP_086058488.1\|3760480_3761620_+\|tRNA-guanosine(34)-transglycosylase-Tgt	gnl\|CDD\|234642	PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional.	0
NZ_CP021109.1\|WP_086073056.1\|3762215_3764093_+\|protein-translocase-subunit-SecD	gnl\|CDD\|235615	PRK05812, secD, preprotein translocase subunit SecD; Reviewed.	0
NZ_CP021109.1\|WP_086073063.1\|3772488_3773217_-\|haloacid-dehalogenase-type-II	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.74741e-60
NZ_CP021109.1\|WP_086058485.1\|3755516_3756935_+\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|182606	PRK10637, cysG, siroheme synthase CysG.	1.15628e-167
NZ_CP021109.1\|WP_086073060.1\|3767829_3769161_-\|M20-family-metallo-hydrolase	gnl\|CDD\|349880	cd03884, M20_bAS, M20 Peptidase beta-alanine synthase, an amidohydrolase. Peptidase M20 family, beta-alanine synthase (bAS; N-carbamoyl-beta-alanine amidohydrolase and beta-ureidopropionase; EC 3.5.1.6) subfamily. bAS is an amidohydrolase and is the final enzyme in the pyrimidine catabolic pathway, which is involved in the regulation of the cellular pyrimidine pool. bAS catalyzes the irreversible hydrolysis of the N-carbamylated beta-amino acids to beta-alanine or aminoisobutyrate with the release of carbon dioxide and ammonia. Also included in this subfamily is allantoate amidohydrolase (allantoate deiminase), which catalyzes the conversion of allantoate to (S)-ureidoglycolate, one of the crucial alternate steps in purine metabolism. It is possible that these two enzymes arose from the same ancestral peptidase that evolved into two structurally related enzymes with distinct catalytic properties and biochemical roles within the cell. Downstream enzyme (S)-ureidoglycolate amidohydrolase (UAH) is homologous in structure and sequence with AAH and catalyzes the conversion of (S)-ureidoglycolate into glyoxylate, releasing two molecules of ammonia as by-products. Yeast requires beta-alanine as a precursor of pantothenate and coenzyme A biosynthesis, but generates it mostly via degradation of spermine. Disorders in pyrimidine degradation and beta-alanine metabolism caused by beta-ureidopropionase deficiency (UPB1 gene) in humans are normally associated with neurological disorders.	4.00283e-141
NZ_CP021109.1\|WP_086058486.1\|3756939_3757578_-\|uracil-phosphoribosyltransferase	gnl\|CDD\|234653	PRK00129, upp, uracil phosphoribosyltransferase; Reviewed.	1.08439e-125
NZ_CP021109.1\|WP_086073055.1\|3753464_3753920_-\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	4.38962e-11
NZ_CP021109.1\|WP_086073707.1\|3771386_3772217_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270343	cd13625, PBP2_AA_binding_like_1, Substrate-binding domain of putative amino acid-binding protein; the type 2 periplasmic-binding protein fold. This putative amino acid-binding protein belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.72526e-89
NZ_CP021109.1\|WP_086073059.1\|3765547_3766501_-\|agmatinase	gnl\|CDD\|212538	cd11592, Agmatinase_PAH, Agmatinase-like family includes proclavaminic acid amidinohydrolase. This agmatinase subfamily contains bacterial and fungal/metazoan enzymes, including proclavaminic acid amidinohydrolase (PAH, EC 3.5.3.22) and Pseudomonas aeruginosa guanidinobutyrase (GbuA) and guanidinopropionase (GpuA). PAH hydrolyzes amidinoproclavaminate to yield proclavaminate and urea in clavulanic acid biosynthesis. Clavulanic acid is an effective inhibitor of beta-lactamases and is used in combination with amoxicillin to prevent the beta-lactam rings of the antibiotic from hydrolysis and, thus keeping the antibiotic biologically active. GbuA hydrolyzes 4-guanidinobutyrate (4-GB) into 4-aminobutyrate and urea while GpuA hydrolyzes 3-guanidinopropionate (3-GP) into beta-alanine and urea. Mutation studies show that significant variations in two active site loops in these two enzymes may be important for substrate specificity. This subfamily belongs to the ureohydrolase superfamily, which includes arginase, agmatinase, proclavaminate amidinohydrolase, and formiminoglutamase.	1.10493e-149
NZ_CP021109.1\|WP_086073705.1\|3757648_3759094_-\|D-alanyl-D-alanine-carboxypeptidase/D-alanyl-D-alanine-endopeptidase	gnl\|CDD\|224938	COG2027, DacB, D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) [Cell envelope biogenesis, outer membrane].	2.71801e-95
NZ_CP021109.1\|WP_086059556.1\|3766505_3767108_-\|cupin-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	6.94507e-35
NZ_CP021109.1\|WP_086058489.1\|3761774_3762116_+\|preprotein-translocase-subunit-YajC	gnl\|CDD\|235518	PRK05585, yajC, preprotein translocase subunit YajC; Validated.	2.52134e-44
NZ_CP021109.1\|WP_086073706.1\|3759404_3760475_+\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	gnl\|CDD\|234666	PRK00147, queA, S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional.	0
NZ_CP021109.1\|WP_086058497.1\|3770662_3771376_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.4018e-64
NZ_CP021109.1\|WP_086073058.1\|3764569_3765499_+\|protein-translocase-subunit-SecF	gnl\|CDD\|237275	PRK13022, secF, protein translocase subunit SecF.	4.22652e-145
NZ_CP021109.1\|WP_086058484.1\|3753981_3754299_-\|DUF883-domain-containing-protein	gnl\|CDD\|377576	pfam05957, DUF883, Bacterial protein of unknown function (DUF883). This family consists of several hypothetical bacterial proteins of unknown function.	1.16865e-29
NZ_CP021109.1\|WP_086073062.1\|3770021_3770663_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.07782e-57

>NZ_CP021109.1|WP_086073056.1|3762215_3764093_+|protein-translocase-subunit-SecD
MNRYPLWKYLTVLIAVVIGLLYTLPNFYGESPAVQISSAKATIKVDNALLGTVERTLSQARIPTEGVYYEQNGPLGTIRARFASTDQQLQARDLLDKTLNTTPGDPHYTVALNLLPASPAWMRTLGWFEPKPMYLGLDLRGGVYFLLQIDMQGALNARYDALAADVRSVLRDQDIPGATVERTGQSVTATFQNADSRDKAVSALRARVPDLQFTDENGGGKPQLVGTMNAASVTRVQENALTQNMNTLHNRINELGVAEPVIQQQGTDRIVVQLPGVQDVAKAKELLGRTATLEIRMVDDSPAAQAALAANTVPFGLERYTDRDGRPLLVRRQVILTGENLQDAQPGRDQQTQQPAVHLTLDAKGARIFRDVTRDNVGKRMAILLFENGKGEVVTAPVIRGEIPGGQVQISGSMTAEEAADTALLLRAGALAAPMAIIEERTIGPSLGADNIAKGFHSTLWGFVAIAVFIVLYYRLFGVFSTIGLAVNVLLLLALLSMLQATLTLPGIAAIALTLGMAIDSNVLINERIREELRNGATPQQAIHHGFERAWGTILDSNLTTLIVGLALLAFGSGPIRGFAVVHCLGILTSMFSSVVGVRALANLWYGRRKKLTSVSIGQVWKPSE
>NZ_CP021109.1|WP_086058489.1|3761774_3762116_+|preprotein-translocase-subunit-YajC
MQLTDTLGVVVAQAAPEGNALMGMLPIILMFVILYFLMIRPQMKRQKEHRNLLAALAKGDEVVTAGGLLGKVTRVTDTYITVEIAEGADKPVEVVVQKSAVSAVLPKGTIKAL
>NZ_CP021109.1|WP_086058488.1|3760480_3761620_+|tRNA-guanosine(34)-transglycosylase-Tgt
MTTGLQFELLATDGAARRGRVTLNHGVVETPIFMPVGTYGSVKAMLPHELEEVGAQIVLGNTFHLWLRPGTEIMQAHGGLHGFMGWNKPILTDSGGFQVFSLQGMRKITEEGVRFASPIDGARLFLTPEESMRIQRALNSDIVMVFDECTPYEIDGRAATQEEAARSMRMSLRWARRSRQAFDQLGNPNALFGIVQGGMYENLRDESLAGLQEIGFHGYAIGGLSVGEPKEDMMRILAHVAPRLPAQAPRYLMGVGTPEDLVAGVAEGVDMFDCVMPTRNARNGWLFTRYGDIKIRNARYRDDTRPLDPSCACHTCRHFTRAYLHHLQRANEITGARLNTLHNLHFYLTIMQEMREAIAAGRFAAWRAQFAADRARGVD
>NZ_CP021109.1|WP_086073706.1|3759404_3760475_+|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA
MAFHRFLKRVTSPSPSYTLADFDYDLPPELIAQHPSAERAGSRLLHLDAQGNLHDRRFADLGELLRPGDLLVFNDTRVIKARLLGQKATGGRVEVLVERIVAPRRALAHVRASKSPGPGTVLRLADAFEAVVEGRDGDLFELAFPDDVLTLLDAHGATPLPPYITHAPDAGDDARYQTVYAREPGAVAAPTAGLHFDEPMLERLQAMGIGRAFVTLHVGAGTFQPVRVEKIADHVMHAEWYTVPQATADAIGRTRAAGGRVVAVGTTSARALESAAALHMPLRAAQGDTRLFITPGYRFQALDALITNFHLPQSTLLMMVSALAGMGPIRRAYAHAVAQRYRFFSYGDAMFIEAAA
>NZ_CP021109.1|WP_086073705.1|3757648_3759094_-|D-alanyl-D-alanine-carboxypeptidase/D-alanyl-D-alanine-endopeptidase
MAAAAPLAGVTALGGLLAPAAVRAQGLAPSSANALPHELAAAWRASKLPGSSLSLVVQELGGQRLLSINAKAPRNPASVMKLVTTWAGLSSLGPNYVWRTELLSDPGARLANGVLSGPLYLRASGDPFFLLQDFWTLLRDLRLHGVRQIQDLVIDRSIFGSVGSDPGAFDGAPDRPYNASPDALMVGFGALRLLFIPDPAARRWRPVIDPPLPGVSVSGQLEWSDAPCPGSPEVATEPVITQQGVTLRLSGKVAGSCGEFSLYRLALSQPEFATEVFRLLWRELGGTFAGQVRSGLVPPDAVPLASHDSPPLGDVIRTINKRSNNVMARQLLLTLGAEGGLRSANEASSADVVRRVLAGQGLSMPELVIDNGSGLSRIGRISADSLASLLTVAWNSPYMPEFMSSLAIAGVDGTVRRRLRDKDTRGMAHLKTGTLANVRALAGYVLSASGKRYAVVSIVNDDRADAVRPFDDALIKWLVDR
>NZ_CP021109.1|WP_086058486.1|3756939_3757578_-|uracil-phosphoribosyltransferase
MPVHEIRHPLIRHKLGIMRRADLSTKSFRELSQEVGALLTYEACKDLPLEPCTIEGWSGPVQVEKLAGKKITVVPILRAGIGMLDGVLTLVPGAKVSVVGIARDEETLQAQAYLERLVAELDRRVALIVDPMLATGGSMCATIDMLKRAGCRDIRALVLVAAPEGIARVEKDHPDVQIYTASIDQGLNEDGYIIPGLGDAGDRIFGTRQKTE
>NZ_CP021109.1|WP_086058485.1|3755516_3756935_+|uroporphyrinogen-III-C-methyltransferase
MKLFPLFADLTQRLVLVVGGGAVAARKVQALREAGASVRLGAPELHAELAALAREGAIAHVPGRFEESWLDDVWLVVAATDDREVNAQVAAAAGRRRLLVNVVDDPGLSSFQVPSIVDRSPLIVAISSSGVAPVLARRLRERIESMFDHAVGPLADLAGRYRARIRERRPELGGRRRFYDWLMDGPVAALLRQARPEDAARALEAALDRPQEPVRGSVVLVGAGPGDPGLLTLKALRALNEADVILYDRLVSADILSLARRDAEREDVGKRPGEDHAATQARIHALMVEHARRGRRVVRLKGGDAFIFGRGGEELQHLRAHGVPYEVVPGVTAALACAAHAGIPLTHRDHAQSLHLITAHCRDDDDAVDWGALAGSRQTLAFYMGVSQLDALARRLQEHGRAADTPFALVENGSRPEQRVLTGRLAELPALARAHDIRAPALLIVGRVAALANELNWFGRHIDGTAAAGAPA
>NZ_CP021109.1|WP_086073704.1|3754413_3755133_-|hypothetical-protein
MFVRLAVAGAALLTAGAARAGVCDAQFIHDGGQVQLTGSGNLQLGADLTFSEVTKSNGENCRARVTGVATFSYAGLPPGKSKLDYLMTVRSGKATFVRYENAGEKPASDGQFDLRMLGLFAYDGKISGAGQKLPGSSFRLRIGKEAPVGGAPSTTVRIGEKTVGARRSMDTALGKQSCWPISYRRDTDPTMATFQGLTIPIPALNTTVTDWYCPAVNLVMRQDIDQQGAKSAVEITKIK
>NZ_CP021109.1|WP_086058484.1|3753981_3754299_-|DUF883-domain-containing-protein
MNMKSSAEGAKENLIDSVKSSLNDAENLLREAAASTGDKAAELRDRAMTSLKRTREALYEVQDAVMERGRKAARATDDYVHDNPWQAIGIAGVTGLLLGLLIARR
>NZ_CP021109.1|WP_086073055.1|3753464_3753920_-|phage-holin-family-protein
MAIRRSLLGVASSLVDLGRTRFELLALEASTEWARLLRLLGCAFGALLFLTLAVLVFSILVAVYFWPTDQRYIALGVLAAAYAVLGLILIYLVRRTLVLGPKPFAATLDELKRDVQLLGHLRAAAQEEEEAERRAEAERHSPAGRRRETSA
>NZ_CP021109.1|WP_086073058.1|3764569_3765499_+|protein-translocase-subunit-SecF
MEFFRIHRTIPFMRHALVLNIISAVTFLAAVFFIVTRGFHLSIEFTGGTVMEVSYAQTAQLDSVRGAVSKLGYADFQVQNFGTSRDVLIRLPLAEGQTSSEQSDAVLKALKAEDPSVELRRVEYVGPQVGQELVHNGLMALLFVVLGIVVYLGIRFEWKFALAGVVANLHDVVIILGFFAFFQWEFSLSVLAGVLAVLGYSVNESVVIMDRIRENFRKQRKAPVQEVINSAITQTISRTIITHGSTQMMVLSMLFFGGPTLHYFAMALTIGIWFGIYSSVFVAAALAMWFGVKREDLVKPAKKDGPEVA
>NZ_CP021109.1|WP_086073059.1|3765547_3766501_-|agmatinase
MSLSATDTRAQALPRYSGIPTFMRVPHATRLEDFDIAIVGVPFDGGVTARPGARYGPREMRNMSSMTRAIHHVTGFNPFTACRVADVGDVPFTDVFHLENAHADIRRFLEPLYAAGKRTLVAGGDHSITFPIFQAMAPRPPLGMVHIDAHTDTWDDFVGSKFSHGSPFRRAVEAGLLDPRRTVQIGIRGAQNSDEGWRYSLDTGMRVIFIEEFDRMGVDAAIAEARRVVGEGPAYLSVDVDGLDPVYAPGTGTPEIGGLSTRETLALLRGLDGLDLRGADVVEVAPPYDPSGNTALLGATLMYECLCLLARAVAGRG
>NZ_CP021109.1|WP_086059556.1|3766505_3767108_-|cupin-domain-containing-protein
MATPTPVPSMPERGLAALGPRVKHARMVRNMTLKALAQAAGCSESLLSRIERGQAMPSLATLHRLARALETNVAELTAADAPPASPVTRAADRPVLAFSPARGRKGGVKLERVIVPMRGQLLQADIHVLEPLAESLEQIAHAGEEMGYVIEGRFELRLGADTHHLEAGDSFYFSSDVPHSYRNPGKTVTRVLWVNTPTTF
>NZ_CP021109.1|WP_086058493.1|3767116_3767818_-|urea-carboxylase-associated-family-protein
MQTLSSTTQVPDNGEPVGLNNTHLEPISPDGRAEPGKVYEVPARHGRAVRLSKGQVIRIINTHGSQVCDTWAFKADDLSEFMSMEHARAMIDRIVPKVGDPLGSNRRRPIMTLIADTSPGVHDTLMAACDAYRYRNLGVEHYHDNCADNMRMALKAIGLRAREVPQPLNLWMNIPVGQDGGVQWLAPVSKAGDYVDLRAEMDCVVVMSACPQDIIPINDNRPVEVHFQVLAQA
>NZ_CP021109.1|WP_086073060.1|3767829_3769161_-|M20-family-metallo-hydrolase
MQALDNARDRVAGAVDDARLQARLEGLAQFGAVQPGQPRGGVARQALTEQERLARRWLAAEFAGRPGYAVGIDAAANVYVRRQGSDAGAPPVMTGSHVDTQPLGGWLDGAYGVAAGLEVFAALDAAGVHTRRAIETVMWTNEEGSRFAPGLMGSLSYVCPDRLAEFQDARDAQGVPFGQACAEARADFAAAAREAGWQWFDTPLARPLHAYIEAHIEQGPILEARGLQVGCVTAIQGVRWFRVTVPGRSAHAGTTPASARDDAQAKAIALAHALLEYGRAQDDEALRLTIGRWQCRPDSINTIADQVVFTVDTRHPDARVLDALQARLQALLPPGATMDTLQNKPTVTFDGGLTALARQACRALRLTHQDMLSGAFHDAMPLAGFCPTAMLFAPSIAGISHHPEEHTAIEDLAACTRALAWCLTDLAGQTDAPPANASFTSTR
>NZ_CP021109.1|WP_157664920.1|3769147_3769948_-|ATP-binding-cassette-domain-containing-protein
MISMRGVGKTFGSHRVLAGIDLDIARGEVVTLIGPSGSGKTTLLRCMNFLDAYDEGEVHIRGALLGYRRDASGRLVRDSDRAVAEVRAPLAMVFQHFNLWPHMTVLANVMAPLTLARAKPAVQARQIAMEALDRVGLAGKAGVLPASLSGGQQQRVGIARALAVSPEAMLLDEPTSALDPELVDEVLAVIQSLSRDGMTMVMVTHEMSFAAEVSDRIVFMEQGRILATGSAQDIIRRPSHPRIKAFLQPWIRRSLALPEGGADASA
>NZ_CP021109.1|WP_086073062.1|3770021_3770663_-|amino-acid-ABC-transporter-permease
MDFHLLLSLLPEFAPGLLHTVGLVAAALAGGLLTGFIAHVLRETGLRPFIWCYWAYTVMWRGVPFLIHLFIVYFGLPSAGISLDPYAAAALTLSIYSGAYFAEIFRACWEAIPRGQVEAALVMGLDRGQVFRRIQLPQAMRAALPLIAHQTILLVKESALASVITYPELTLTASRIVSAQFVYIEPYVALAACYWLLALAIGRLAGLLARRLA
>NZ_CP021109.1|WP_086058497.1|3770662_3771376_-|amino-acid-ABC-transporter-permease
MNDATLFERLAAYAPVLGNGAVMTVLVAAVAIAGGFLLGAALLGLTLTGSRRSPLRLAVVAYVSFFRGTPMLVQLLMLFYLPSALGVDLPPLFAAMLAMSLNSAAFQCEILRGGLAAVARGQLEAGAVFGLTPRQVFRHIQLPQMARAVWPAVVSEAIDVIKNSAIVSVIAVADLARAARQIVASNYRPLEVYAATGLMYLALTAAVFLLGTWLARRMAGSRHASRVVVRRNAIRKS
>NZ_CP021109.1|WP_086073707.1|3771386_3772217_-|transporter-substrate-binding-domain-containing-protein
MLRSRLIMAVLAFAAAGAAHADLLDNIRQKKEIVIGTEAQFAPFEYLQDGKIVGYGPDLMNLIMSGLPGVKVKQLDVPFQGILPGLATRKFDFIVTSVTMTGERAAKFAFTVPIADATTALVKRKADTALAGAENIAGKTVGSQTGSAQLKALQAYSDKLKAAGKPAVNIREYVSFDEAYADLAAGRLDAVAQSLANLATLVKTRGDVYAVIDQPIGPKTYFGWVGRKEADSASLVKFFSDGIARAQQTGELQKLQMKWFGFTMSVPTDKVPTPEM
>NZ_CP021109.1|WP_086073063.1|3772488_3773217_-|haloacid-dehalogenase-type-II
MSDSTAIQALLFDVFGTVVDWRTSVAAQLRPFLARHNIGADPYDLAHAWRRKYQPALDEIRGGRRPFVRLDVLHRENLESALADVGVDPASIPAGELDELNLVWHRLDPWPDSVPGLRRLKQRFIIAPLSNGNIRLMTDVAKRAGLPWDAILGAEVVQAYKPSHEVYQRTADVLGMRPQEICMVAAHNGDLAAARQCGFRTAFVLRATEYGPNQKTNLRAEQDWDWVVDDLETLATRLGCPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_14

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_14

3798943-3799035

Orphan

Consensus_repeat	Method
GCGTTGGCGGGTCGGCGAAGCCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_14

>merge|NZ_CP021109|14|3798943-3799035|CRISPRCasFinder
GCGTTGGCGGGTCGGCGAAGCCGGATCCGCGGCGCCCCGGTCAGCGGAGCTTCTTGAGTGAGGATGGGGGCGCTGGCGGGTCGGCGAAGCCGG

>NZ_CP021109|14|14|3798943-3799035|CRISPRCasFinder
GCGTTGGCGGGTCGGCGAAGCCGG	ATCCGCGGCGCCCCGGTCAGCGGAGCTTCTTGAGTGAGGATGGGG
GCGCTGGCGGGTCGGCGAAGCCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086073076.1\|3791229_3792801_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341286
NZ_CP021109.1\|WP_086073088.1\|3812723_3813131_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073084.1\|3802200_3803253_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381328
NZ_CP021109.1\|WP_086073087.1\|3810141_3812727_-\|DUF2169-domain-containing-protein	unknown	unknown	gnl\|CDD\|370755
NZ_CP021109.1\|WP_086073078.1\|3793674_3794451_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181044
NZ_CP021109.1\|WP_086073086.1\|3809092_3810145_-\|pentapeptide-repeat-containing-protein	unknown	unknown	gnl\|CDD\|224276
NZ_CP021109.1\|WP_086058515.1\|3794447_3795260_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP021109.1\|WP_086073083.1\|3800535_3802182_+\|apolipoprotein-N-acyltransferase	unknown	unknown	gnl\|CDD\|234721
NZ_CP021109.1\|WP_086073079.1\|3795287_3796040_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239483
NZ_CP021109.1\|WP_086058518.1\|3797658_3798666_+\|PhoH-family-protein	unknown	unknown	gnl\|CDD\|376820
NZ_CP021109.1\|WP_086073082.1\|3799645_3800539_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|226910
NZ_CP021109.1\|WP_086073710.1\|3803853_3804114_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073081.1\|3799070_3799544_+\|rRNA-maturation-RNase-YbeY	unknown	unknown	gnl\|CDD\|234575
NZ_CP021109.1\|WP_086073080.1\|3796210_3797662_+\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	unknown	unknown	gnl\|CDD\|237673
NZ_CP021109.1\|WP_086073075.1\|3789264_3790053_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP021109.1\|WP_086073074.1\|3788165_3789218_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380497
NZ_CP021109.1\|WP_086073085.1\|3804405_3808512_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|214534
NZ_CP021109.1\|WP_086073709.1\|3790163_3791147_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP021109.1\|WP_086073077.1\|3792841_3793678_+\|citryl-CoA-lyase	unknown	unknown	gnl\|CDD\|235748
NZ_CP021109.1\|WP_086058524.1\|3808580_3808964_-\|DUF4150-domain-containing-protein	unknown	unknown	gnl\|CDD\|372665

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086073076.1\|3791229_3792801_+\|AMP-binding-protein	gnl\|CDD\|341286	cd17631, FACL_FadD13-like, fatty acyl-CoA synthetase, including FadD13. This family contains fatty acyl-CoA synthetases, including Mycobacterium tuberculosis acid-induced operon MymA encoding the fatty acyl-CoA synthetase FadD13 which is essential for virulence and intracellular growth of the pathogen. The fatty acyl-CoA synthetase activates lipids before entering into the metabolic pathways and is also involved in transmembrane lipid transport. However, unlike soluble fatty acyl-CoA synthetases, but like the mammalian integral-membrane very-long-chain acyl-CoA synthetases, FadD13 accepts lipid substrates up to the maximum length of C26, and this is facilitated by an extensive hydrophobic tunnel from the active site to a positively charged patch. Also included is feruloyl-CoA synthetase (Fcs) in Rhodococcus strains where it is involved in biotechnological vanillin production from eugenol and ferulic acid via a non-beta-oxidative pathway.	3.96632e-152
NZ_CP021109.1\|WP_086073084.1\|3802200_3803253_-\|aldo/keto-reductase	gnl\|CDD\|381328	cd19102, AKR_unchar, uncharacterized aldo-keto reductase (AKR) superfamily protein. This family includes a group of uncharacterized AKR superfamily proteins. Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance in both health and industrial applications.	1.30092e-151
NZ_CP021109.1\|WP_086073087.1\|3810141_3812727_-\|DUF2169-domain-containing-protein	gnl\|CDD\|370755	pfam09937, DUF2169, Uncharacterized protein conserved in bacteria (DUF2169). This domain, found in various hypothetical prokaryotic proteins, has no known function.	8.8046e-85
NZ_CP021109.1\|WP_086073078.1\|3793674_3794451_+\|SDR-family-oxidoreductase	gnl\|CDD\|181044	PRK07577, PRK07577, SDR family oxidoreductase.	4.17507e-72
NZ_CP021109.1\|WP_086073086.1\|3809092_3810145_-\|pentapeptide-repeat-containing-protein	gnl\|CDD\|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	1.73378e-21
NZ_CP021109.1\|WP_086058515.1\|3794447_3795260_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	3.10088e-75
NZ_CP021109.1\|WP_086073083.1\|3800535_3802182_+\|apolipoprotein-N-acyltransferase	gnl\|CDD\|234721	PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed.	8.00645e-167
NZ_CP021109.1\|WP_086073079.1\|3795287_3796040_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239483	cd03389, PAP2_lipid_A_1_phosphatase, PAP2_like proteins, Lipid A 1-phosphatase subfamily. Lipid A 1-phosphatase, or LpxE from Francisella novicida selectively dephosphorylates lipid A at the 1-position. Lipid A is the membrane-anchor component of lipopolysaccharides (LPS), the major constituents of the outer membrane in many gram-negative bacteria.	1.34953e-36
NZ_CP021109.1\|WP_086058518.1\|3797658_3798666_+\|PhoH-family-protein	gnl\|CDD\|376820	pfam02562, PhoH, PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.	2.43097e-141
NZ_CP021109.1\|WP_086073082.1\|3799645_3800539_+\|CBS-domain-containing-protein	gnl\|CDD\|226910	COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism].	2.82288e-103
NZ_CP021109.1\|WP_086073081.1\|3799070_3799544_+\|rRNA-maturation-RNase-YbeY	gnl\|CDD\|234575	PRK00016, PRK00016, metal-binding heat shock protein; Provisional.	1.68075e-50
NZ_CP021109.1\|WP_086073080.1\|3796210_3797662_+\|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB	gnl\|CDD\|237673	PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional.	0
NZ_CP021109.1\|WP_086073075.1\|3789264_3790053_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.22889e-45
NZ_CP021109.1\|WP_086073074.1\|3788165_3789218_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|380497	cd06273, PBP1_LacI-like, ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	1.58652e-120
NZ_CP021109.1\|WP_086073085.1\|3804405_3808512_+\|PAS-domain-S-box-protein	gnl\|CDD\|214534	smart00138, MeTrc, Methyltransferase, chemotaxis proteins. Methylates methyl-accepting chemotaxis proteins to form gamma-glutamyl methyl ester residues.	6.3699e-89
NZ_CP021109.1\|WP_086073709.1\|3790163_3791147_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76196e-146
NZ_CP021109.1\|WP_086073077.1\|3792841_3793678_+\|citryl-CoA-lyase	gnl\|CDD\|235748	PRK06224, PRK06224, citryl-CoA lyase.	6.07491e-101
NZ_CP021109.1\|WP_086058524.1\|3808580_3808964_-\|DUF4150-domain-containing-protein	gnl\|CDD\|372665	pfam13665, DUF4150, Domain of unknown function (DUF4150).	1.06172e-34

>NZ_CP021109.1|WP_086058518.1|3797658_3798666_+|PhoH-family-protein
MTGPRRHPVSTVNVGGDNAHLANLCGPLDENLRQLADGLGVKLSRRGHRIVLEGEQAELAAQVLRRFDEQAQRKPLSVDDIQLGLVEIGVGRTQDAPGRQPALDPGALPPLDDYAEGLALRTRRTDLRPRTPRQRDYLDNILKHDITFGIGPAGTGKTWLAVACAIDAMERDTVQRLVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLMGFERVQRLFEKQTIEIAPLAYMRGRTLNHAFVILDEAQNTTPEQMKMFLTRIGFGSKAVITGDPSQVDLPRGQQSGLAHAVGVLQDVQGIATTRFTSRDVVRHPLVARIVDAYDKAAEE
>NZ_CP021109.1|WP_086073080.1|3796210_3797662_+|tRNA-(N6-isopentenyl-adenosine(37)-C2)-methylthiotransferase-MiaB
MQEIPIARDSAAPAPAAAPAAAEPAAGAPRKLFIRTFGCQMNEYDSDKMADVLRESQGVELTDTPEEADIILFNTCSVREKAQEKVFSDLGRVQHLKKTKPGLVIGVGGCVASQEGEAIVKRAPYVDVVFGPQTLHRLPELIQQRRAQGRAQVDITFPSIEKFDALPPPRVEGATAFVSIMEGCSKYCSFCVVPYTRGEEVSRPFDDVLVEIADLADQGVKEVTLLGQNVNAYRGRLGDGEEIADFAMLLEYVHEIPGIERIRYTTSHPKEMTPRLIQAYARLPKLVSFLHLPVQAGSDRVLAAMKRGYTTLEFKSIVRRLREARPGLTLSSDFIVGFPGETEEDFEKTMKLIDDVGFDTSFSFVYSRRPGTPAADLADDTPQAVKLQRLQRLQARIAEQAAAIGQAMVGTTQRVLVEGPSRRDPGELMARTENNRIVNFPGPARLIGHMIDVVITQAYPNSLRGRVAIIDDRAEAAQSEAAQ
>NZ_CP021109.1|WP_086073079.1|3795287_3796040_-|phosphatase-PAP2-family-protein
MDKTANRAGAGHADPASPSGPSRRRLDRRTRWLAGWALAVLGIACLAMFVDLPLTRYLQANVPSGVDLAFEWIGEIGDSDNYSWIVLLVYIGALIGLARGASGAWIGGYARVARGALLLMAAWIAGGIVVGVLKKVVARARPEMYFEHGFYGLGEAFAGKPFNSFPSSHTLTAFVLAAAIAATAPRLRWAVYTLAVLAAVSRVVNLDHFASDVATSALIAVTAVHLLKARFLDERYRWPERLPWQWFGRR
>NZ_CP021109.1|WP_086058515.1|3794447_3795260_+|SDR-family-oxidoreductase
MMPAPSNRLAGKVALVAGAGSSAPGWSIGKACAVTLARQGAIVAALDHDAAAAEDAVAAVQAAGGSAFPLHADVADAASMRAAVADTLARHGRIDILQANAGIGKVGGPEDIDMEDWHRIQRVNVDSLLIAAQLVLPHMVRQGGGAIVTVSSVAGLRYIGYPHLAYSVTKAAAIHFTRMLAQQYAAQGIRANTVVPGLIDTPRIRRNVAHMFDAEDLQKARAARDRQVPMGRMGTPWEVAQAVAFLASDDASYITGTELVVDGGIIGKYV
>NZ_CP021109.1|WP_086073078.1|3793674_3794451_+|SDR-family-oxidoreductase
MIADRVRQDPLHASAGGHRHVLVTGGSRGIGRAVVARLLQDGYTVANFDLAAPAGPMGEREHFVQCDISDERQLGAALQTLLDRQPVLRLVNNAGIVRPATVEAATADDMAAVTALNLVAPMRIVQALLPGMRAAGFGRIVNISSRAALGKQARTVYAATKAGLHGMTRTWALELGAHGITVNAVGPGPIATELFDRVNPPGHPETERIRQAIPVRRMGTPDDVAHGVASLIDDRAGFITGQVLYVCGGMTVGLGNAA
>NZ_CP021109.1|WP_086073077.1|3792841_3793678_+|citryl-CoA-lyase
MATPVTRLCAHDLTSMHYRDANLVDDLIGQRSFTEVMFMQIMNRPARPVDMRIVDAVLITLMEHGLTPSAIATRLIYMSAPENLQGAVASGLLAVGSQFVGTMENCSELLDRIIAAGDPAQTARGIVEDARRRRAHLPGFGHHLHKPDDPRAIKLLALTEAETELKGDHVRALRLLAGTVDEVYGRHITINATGAVAAMLGEIGVPTRLMRGFAVISRAAGLVAHIAEEQTDPSGRFIWETIDHAIPYVGKGRSAHGAADAASPQPGSTDARDGKERP
>NZ_CP021109.1|WP_086073076.1|3791229_3792801_+|AMP-binding-protein
MFPIDFFFRAARRHPGRIALESPSASVTYAQLDADVRALAAALQGLDPAPQSRVAICAGNSAEHILALLAVLAAGKIWVPLNTRSSALEVQRIIDATEPGIVFADAGGAALVGDCKARRIALGDADLGDLGLQPLVAAHRGQSPVGHALSRDDVQAIKFTGGTTGLPKGVMQPYRAWNAGIINQIAAWGLTEHDRYVMAAPITHGTSTYVLPVLAQGGTHVLLDAASPATITQAFRERGGTLCFMPPTLIYMIMAQPGVSRADFPALRNLIYGGAPMPADKIEEVQRFFGPVLGTTYGQTEAPQIVTVLPPAELADPANRGSVGRTTWLSEMAIMAPDGRLLPEGELGEVVVRGDLVMAGYWRLPEKTAETIVDGWLHTGDVGMVDARGYLYLKDRIRDVVITGGFNVYPVDVENALSLHPAVYESTVFGVPDPKWGEAVHAAVQCHAGVSVTAQALMAHVRERLGPVQTPKQIHFYESLPRSTVGKVLKTAVRQDALKALQAAPDSPASSAATSQASTPAAS
>NZ_CP021109.1|WP_086073709.1|3790163_3791147_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRGLAASLLALAASLAQTGPAVAASDSRYPARPVTLVVGYAAGGATDIVARLAAKALTETLGQPFVVENRAGANSNIGAEAVYRAAPDGYTLYVGSIANTINQTLYPDLPYAFDKGFAPIGMLATVPNILVVNPKVPANNVAEYIALARKNPGKVTCASSGAGSSIHMSCEMFKLATGTEILHVPYRGSGPAVTDLMGGQVDSMFDNMPSALPHVRAGKLRALGVTSPQRAPFAPDVPTLSESGVKDFSVQSWFGLVAPKGTPQPVIDRLNEALNQILRSDAIKTAYEKGGFVMPPQPNTPAAFQSWIDEETGKWAKVVKSAEIKVQ
>NZ_CP021109.1|WP_086073075.1|3789264_3790053_-|IclR-family-transcriptional-regulator
MNKSPAAVAAAGDRGASGPNTLRRGLRVLDALRAAGPEGLHVVEVAQASGIQRSTVYRFLDVLIESGYAMRDPATRRYRLAAGKLGATPDVHAAAVARWSPVLRGISDETGDSAFLICRAGNDSLCLHREVGNYPVQVLAVTVGHRQPLGVGAAGLAFLSALPMQEAAAIVEENAPALRAYGRMTPGRLRQLIDSARDRGWAVVGNSAVPGVIGVGVAIRDADGRPTLAISVSSLVDRMPAARQRRIAELIAQAVRGGGAPA
>NZ_CP021109.1|WP_086073074.1|3788165_3789218_+|LacI-family-transcriptional-regulator
MRAPPSDSLPEETKGRSAARDVARLAGVSTATVSRALNNPEQVDPDTRRRVLEAAAKLRYVPHGAARSLRSHRSKMIGAVVPSFDYALYARTTSAIHQYLDERGYSLVLAEQHYDLSAEVRVASQLIQHGVDAFVFVGLDHDPALFTLLDDYGRPYVLTWGVDPLRRHPSIGFDNQAATYAVTRHLLQLGHRRFGLLSAPLPGNDRALARGAGMRQALAEHGLELDERCVQYAPISLKAAEDAMARLLALPDPPTAVVATNDVFAVGGMMACRHAGVRIPDDISITGVDNTDLGATQTPGLTSIRTPITEIGHAAAAQLVARLNGQPYEAFQSFPIEVVHRGSTAPPRRE
>NZ_CP021109.1|WP_086073081.1|3799070_3799544_+|rRNA-maturation-RNase-YbeY
MSPTLSLSVQYAVQAPELPRWRLRRWIERALRAARVDGLAAFLGAEISLRVVGLAEGRRLNHGFRERDYATNVLTFEYGVGPDGLARGDIVLCLPVLRREAREQRKTVLDHAAHLTVHGVFHALGYDHIKARDARRMEALETRVLADMGIADPYAPR
>NZ_CP021109.1|WP_086073082.1|3799645_3800539_+|CBS-domain-containing-protein
MPDPYPANDADHAPRQAKPANKSLLDRLLSLVRREPEDREGIKAILEAAHERELLDAESYAMIKGALAVSERTVGDIMVPRSRMDLLDIADPLPHHLSIIIETAHSRFPVFEGDRDNIIGILLAKDLLRCMLDTHIEVRSLVRPAVFIPESKRLNVLLHDFRESRNHLAIVIDEHGGIAGLVTMEDVLEEIVGDIEDEFDEDEETTIFAEGENQWRVLAMTDIDRFNETFGVSLPEDEYDTVGGWLGGELGRIPRRGDFTERDGLRIEVVRADPRRALWLRVKRLPPAPAAPMSTDE
>NZ_CP021109.1|WP_086073083.1|3800535_3802182_+|apolipoprotein-N-acyltransferase
MTSFTLRHPRAAAAAGVFAAGAVQAMTFAPGPLPDGALAIVQVLTLAVLARRQLTALTWRRALWEGWLYNFACYALGLYWLYVSMHYYGGLTPPLAAAGVLALSAFLALFPASAGVLGRWLQPLTPGATPGRRLRSALAFACAWTALEWVRGTLWTGFPWLNIGYAQVDSPFAGWAPIVGVYGVAWLAAFAAAALAALWRPADAPRDPRHAMAAALAAIAALAGWGASQVRWSHPEGAALQVRLIQGNIEQSQKFDPGLMERGLLQHMNQASMPPQPGMPAPRVIILPETVLPVFQDQLAPGAWDVWRRIAAERDATIVMGVPLHRRVDGVDRYTNSAIAFDGNTPVEALRSGEVPRRYDKYHLVPWGEFVPPGFHWFVRMLDIPLGDFDRGDPRQPPFDIDGQRLALNICYEDLFGEELLPAVRPGANGEPGASILVNISNLGWFGDTWALRQHLQIARMRALETARPLLAATNTGITASIDPQGRVVAQLPTMQATSLQTAVQGMTGLTPYTRTGNAAVMGLVAAGLLLLAASRAAAARQMARAAS
>NZ_CP021109.1|WP_086073084.1|3802200_3803253_-|aldo/keto-reductase
MSPTAFPLRSLGRTGMDITRIGFGAWAIGGAGWAAGWGAQDDADSIAAIRHAVARGINWIDTAAVYGLGHSEELVGQALKGMPAAERPYVFTKCGLVWDEKQRTAPPRRVGAARSLRAEAEASLKRLGVERIDLLQMHWPANDGTALDEYWQTLLDLKREGKVRAVGLSNHNVAQLELAEQLGHVDTLQPPFSAIRRDAAADLLPWCAEHETGVIVYSPMQSGLLSGRFTEARAASLPADDWRSRNAEFTGENLRRNLALAQALEEVAQRHGATVAATAIAWTLAWPGVTGAIVGARDPAQVDGWLGAATLELDDDDMARIAAFIETTGVGTGPSSPARQAGDDLPLRSA
>NZ_CP021109.1|WP_086073710.1|3803853_3804114_-|hypothetical-protein
MDILELLQWPAMAASLAAAWLVASTRKGKRNAGFWVFLLSNVLWIAWGWHDDAYALIALQVGLALTNIRGVFKTKATQPADASAET
>NZ_CP021109.1|WP_086073085.1|3804405_3808512_+|PAS-domain-S-box-protein
MPDADPPPKNNQNISPSHLSFPVVGLGASAGGVEALTTFFQHTPENPSMAFVVVVHLSPEHESALDRILQNATRMPVVQVKSDRPIEANHVYVIPPASKLEMNDSYLRIKSVARGRGPLIAIDGFFRTLADAHKSRAVGVVLTGGGSDGSVGLARIKEQGGITLAQQPEDAEHDTMPRSAIATGMVDIVLPVAEIPARLLSIADNLARMQVPAPTDDPVDLDTRRPDETTEERAALRDILTLLRARTGHDFKHYKKATVLRRIERRMQVTGVPDMPAYASMLHDNAEETPKLLSDMLIGVTQFFRDRESFETLEQRCIAPMFRHRDGDGPPHIRAWVAGCATGEEAYSVAMLLCEYGESAANPATPKIQVFATDIDEPSLSAARAGLYPSAIETDVSATRLQRFFTREGSNYRIKKELRERVLFAPHNILRDPPFSRLDLVTCRNLLIYLDREVQVDVLRMFHFALKPGGYLFLGSSESADACENLFSVVDKRHRIYQAKDTASLHRPVPVLPLSGFDRPQQTAVQATAVRRSKLSFAEIHQRALELYAPPSVIVDHESNIVHMSERAGRFLRYVGGEPSRNLPSLVYPDLRMELRTALFQAVHSRKSVEARRVAMTLGDRQVYVNMVVRPFRHEDSGNDFMLVIFDEVEAVMSPAGEQAPHVPNSVLAQLEAELQRTKEQLQLTMEQSETSTEELKASNEELQAINEELRSTTEELETGKEELQSVNEELITVNSELKSKVEETAKINDDLQNLIASTDIATVFVDRSMRIKWFTPRAKDIFSVIANDAGRSLLDITHRLDYPDLAQDAAAVFESLRTIEREVRSTDNRWYLARLLPYRSAEHRIEGAVLTFIDVTDRRYAEARINAIAQSTRDFAIITLSNGGTITSWNLGAQLLFGYTETEAVGRDFSLIFTPEDIEAGAPALELQRAREQGYASDERWHLRKDGSRVFCAGGMNPIDDPVSMGFAKIARDITAQKQHEQEQENRLETTRANSTLKDEFFAVMSHELKHPLNLIQLNAELLVRTPEVRAVSVAARAADAIQRAVRSQARIIEDLLDVARAQTGKLKLNRSVVSLTATVDSIVRVMTPTAAETGVTLTTGYDMADTLYIDADPVRVEQIVWNLMNNGIKFTPAGGMVTVELGRDNQMARVCVRDTGEGIDPDFLPRLFDMFSQAEMRSGTQPRMGLGIGLAVVSQLVHAHGGRVEAASEGKGRGSCFTVWLPLASHTFTGTADIPERESGQLAGVRVLLVDDSHEILDTFSALLELEGAQVEAVDSGKRGLDALDSMAFDVIISDIGMPGMDGYAFLGETRARGCDTPAIALTGYGAKRDIDKALSAGFTAHLSKPILLDDLVAIVRRTLGRAEPR
>NZ_CP021109.1|WP_086058524.1|3808580_3808964_-|DUF4150-domain-containing-protein
MLAVCQLPGIALGFPDVCKTPIPPLPHVDVATSSMGIPVAWNVLLLAAPVHNMATVVPITLGDTAGVGGGLISQTFMGSSRYMTGAFTVLVRGTPIVRMTSLTVQNTINTVGMQVFSPQPKVLVLAP
>NZ_CP021109.1|WP_086073086.1|3809092_3810145_-|pentapeptide-repeat-containing-protein
MNIGTLLDKVRHGEPVENADLRGADLSGLDLAGGFFDEVDFSGARLAGCRLDDSQFTHCRFDGADLNAARLEEARIVRCSVQNVNLNGVSARALMSGESDWSGARFADAVIDHASFHAVTLRGAVLRTQRIDRAVFSQTVLEQADFGGTALSFVTFHRLDLRTASFAGTACESVMFIECDMTGHRFAGQPFVLCQFTDSKLDGADFSRANLRQANFKGASLRGAAFDAASGPQCLFPEADLTKATLRGAHFDGAIWADASLEEAVFASASLNLCVFHRARCARADLRGASLADADFSTADLRDADLRDARFERTRFHRAIQDGARLSHRNGIIENDPALLEAELWSAGKP
>NZ_CP021109.1|WP_086073087.1|3810141_3812727_-|DUF2169-domain-containing-protein
MKTIKPLRLSVLTRPYRWQRQDHLGVAVLALARLGDAPRLLPEQALWKLAGEETGGLLDIGMPKPYPEVLATGYAYTAHQKDRTSCAVRLKVEGIADKALLVFGDRYWLDGRPDAPRPFDAMRLDWSRAYGGPGVPENPLGIGAADEMVNGVRVRRVPNIESPDARLSGASQRPAPAGYGPYGMDWPQRARHMGSRYDQEWLENDFPGFAPDMDPRYFNAAPEDQRAARPEAVLAGAAYEVWNMHPERQVLRGRLPDWRARCFASRSADGAGLEEIGLGLSTAWFFPHRDCVVLIWHGRMPLQEDDAADIRLIMPALECAGQPRATAHYESVLARRLDPGRGALHAMVNADLVPAGLCDPWLDGEGRSEADRPSRRNLRKGAERRHAAARADLVAQGLDPDRYLAPLPPEEPPPSLADLPDRIERMEMEMAQARRGEGVTAAAYAQAGLDDLAAVAGVDMKALRAQDAGTPAPPFDFAALRRQLRQAQAQPWAAEAGGAKWDAMARQGMLHAGQYLAPPPMPPHRARRTRASLQARARATRDARGLHLAGADLSGMDLRGMDFRGAILAGADLSGACLDQCDFGEAVLAAARLDGASAREASFVRANLGGVRCGATDLRGADLSQARVDEAVFDGCDARGVRIDGGAASRALFRGCDFGEASLTQWTAMRTILERCRFAGARFDQCVMMETAVQDCDFAGARMTRAGFTQCAFAGAKQFAGADLEGCAFAGGADLSDACFAGARIRHSSLRGAVLDRADLSGARLEAADFSECRLHGADLSHAEAPRSLFVRADLRDASLRGARLIETVLPKSILLGTCLDEANLFRADVAMARMDATTSLRGAYTKGAKRYPLYRAEPTA
>NZ_CP021109.1|WP_086073088.1|3812723_3813131_-|hypothetical-protein
MASFPDWNWSGWTWVIAAIVLLSLLQAGWHLRAELRRRAQDNAVAARQNEVRQTGRPYSAIVLRTTDTGIRMGAVKSFVIELALHVQGDTVVPDFDATVRVPLSPVRLADFTEGRTIQVRVDPATRDVAIAQRTE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_15

3915081-3915153

Orphan

Consensus_repeat	Method
CGCCCCCTTGAGGGGGAAGCGCG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP021109_15

>merge|NZ_CP021109|15|3915081-3915153|CRISPRCasFinder
CGCCCCCTTGAGGGGGAAGCGCGGAAGCGCTTCGGGGGTGGGCCTACCCCCGCCCCCTTGAGGGGGAAGCGCG

>NZ_CP021109|15|15|3915081-3915153|CRISPRCasFinder
CGCCCCCTTGAGGGGGAAGCGCG	GAAGCGCTTCGGGGGTGGGCCTACCCC
CGCCCCCTTGAGGGGGAAGCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086073138.1\|3909152_3913085_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073134.1\|3901489_3903721_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
NZ_CP021109.1\|WP_086073144.1\|3919371_3920106_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP021109.1\|WP_157664895.1\|3905421_3905904_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073142.1\|3917199_3918903_+\|argininosuccinate-lyase	unknown	unknown	gnl\|CDD\|176463
NZ_CP021109.1\|WP_086073139.1\|3913138_3914800_-\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|227010
NZ_CP021109.1\|WP_086073135.1\|3903737_3904742_-\|xanthine-dehydrogenase-family-protein-subunit-M	unknown	unknown	gnl\|CDD\|224238
NZ_CP021109.1\|WP_086073145.1\|3921537_3922359_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NZ_CP021109.1\|WP_086073720.1\|3920546_3921518_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270271
NZ_CP021109.1\|WP_086073133.1\|3900865_3901432_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176908
NZ_CP021109.1\|WP_086073147.1\|3923200_3923932_+\|Asp/Glu/hydantoin-racemase	unknown	unknown	gnl\|CDD\|226004
NZ_CP021109.1\|WP_086073146.1\|3922355_3923129_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213260
NZ_CP021109.1\|WP_086073136.1\|3905803_3908116_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223715
NZ_CP021109.1\|WP_086073148.1\|3923928_3925446_+\|dihydropyrimidinase	unknown	unknown	gnl\|CDD\|184033
NZ_CP021109.1\|WP_086073719.1\|3904754_3905294_-\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|236910
NZ_CP021109.1\|WP_086058590.1\|3900540_3900846_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|197713
NZ_CP021109.1\|WP_086073143.1\|3918854_3919277_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319914
NZ_CP021109.1\|WP_086073141.1\|3915778_3916876_-\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270400
NZ_CP021109.1\|WP_157664896.1\|3908274_3909018_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341282
NZ_CP021109.1\|WP_086073140.1\|3915174_3915768_-\|TRAP-transporter-small-permease-subunit	unknown	unknown	gnl\|CDD\|227011

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086073134.1\|3901489_3903721_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	0
NZ_CP021109.1\|WP_086073142.1\|3917199_3918903_+\|argininosuccinate-lyase	gnl\|CDD\|176463	cd01359, Argininosuccinate_lyase, Argininosuccinate lyase (argininosuccinase, ASAL). This group contains ASAL and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASAL is a cytosolic enzyme which catalyzes the reversible breakdown of argininosuccinate to arginine and fumarate during arginine biosynthesis. In ureotelic species ASAL also catalyzes a reaction involved in the production of urea. Included in this group are the major soluble avian eye lens proteins from duck, delta 1 and delta 2 crystallin. Of these two isoforms only delta 2 has retained ASAL activity. These crystallins may have evolved by, gene recruitment of ASAL followed by gene duplication. In humans, mutations in ASAL result in the autosomal recessive disorder argininosuccinic aciduria.	2.76931e-117
NZ_CP021109.1\|WP_086073144.1\|3919371_3920106_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.948e-41
NZ_CP021109.1\|WP_086073146.1\|3922355_3923129_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213260	cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters. NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	6.61752e-120
NZ_CP021109.1\|WP_086073139.1\|3913138_3914800_-\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|227010	COG4664, FcbT3, TRAP-type mannitol/chloroaromatic compound transport system, large permease component [Secondary metabolites biosynthesis, transport, and catabolism].	1.76236e-98
NZ_CP021109.1\|WP_086073135.1\|3903737_3904742_-\|xanthine-dehydrogenase-family-protein-subunit-M	gnl\|CDD\|224238	COG1319, CoxM, Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion].	2.98074e-82
NZ_CP021109.1\|WP_086073145.1\|3921537_3922359_+\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	1.03284e-75
NZ_CP021109.1\|WP_086073720.1\|3920546_3921518_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270271	cd13553, PBP2_NrtA_CpmA_like, Substrate binding domain of ABC-type nitrate/bicarbonate transporters, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes nitrate (NrtA) and bicarbonate (CmpA) receptors. These domains are found in eubacterial perisplamic-binding proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding their ligand with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. These binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.55608e-26
NZ_CP021109.1\|WP_086073133.1\|3900865_3901432_+\|SRPBCC-family-protein	gnl\|CDD\|176908	cd08899, SRPBCC_CalC_Aha1-like_6, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.04105e-34
NZ_CP021109.1\|WP_086073147.1\|3923200_3923932_+\|Asp/Glu/hydantoin-racemase	gnl\|CDD\|226004	COG3473, COG3473, Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism].	9.50768e-31
NZ_CP021109.1\|WP_086073136.1\|3905803_3908116_+\|hypothetical-protein	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.1791e-41
NZ_CP021109.1\|WP_086073148.1\|3923928_3925446_+\|dihydropyrimidinase	gnl\|CDD\|184033	PRK13404, PRK13404, dihydropyrimidinase; Provisional.	0
NZ_CP021109.1\|WP_086073719.1\|3904754_3905294_-\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	gnl\|CDD\|236910	PRK11433, PRK11433, aldehyde oxidoreductase 2Fe-2S subunit; Provisional.	2.00815e-90
NZ_CP021109.1\|WP_086058590.1\|3900540_3900846_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197713	smart00418, HTH_ARSR, helix_turn_helix, Arsenical Resistance Operon Repressor.	2.69876e-16
NZ_CP021109.1\|WP_086073143.1\|3918854_3919277_-\|VOC-family-protein	gnl\|CDD\|319914	cd07251, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.98038e-48
NZ_CP021109.1\|WP_086073141.1\|3915778_3916876_-\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270400	cd13682, PBP2_TRAP_alpha-ketoacid, Substrate-binding component of an alpha-keto acid binding Tripartite ATP-independent Periplasmic transporter and related proteins; contains the type 2 periplasmic-binding protein fold. This subgroup includes TRAP transporters that bind to ketoacids such as pyruvate and alpha-ketobutyrate, xylulose, and other unknown ligands. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
NZ_CP021109.1\|WP_157664896.1\|3908274_3909018_+\|AMP-binding-protein	gnl\|CDD\|341282	cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and, in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the adenylation domain of the Bacillus subtilis termination module (Surfactin domain, SrfA-C) which recognizes a specific amino acid building block, which is then activated and transferred to the terminal thiol of the 4'-phosphopantetheine (Ppan) arm of the downstream peptidyl carrier protein (PCP) domain.	7.0254e-14
NZ_CP021109.1\|WP_086073140.1\|3915174_3915768_-\|TRAP-transporter-small-permease-subunit	gnl\|CDD\|227011	COG4665, FcbT2, TRAP-type mannitol/chloroaromatic compound transport system, small permease component [Secondary metabolites biosynthesis, transport, and catabolism].	7.15302e-76

>NZ_CP021109.1|WP_086073139.1|3913138_3914800_-|TRAP-transporter-large-permease-subunit
MEFFIANLAPIMFATLVVFLLLGFPVAFALAANGILYGLIGIELGLLTPALFQALPQRVFGIISNDTLLAVPFFTLMGLVLERSGMAEDLLETIGQLFGTVRGGLAFAVVFVGAMLAATTGVVSASVISMGLISLPIMLRYGYDRRLASGVIAASGTLSQIIPPSLVLIILADQLGRSIGDMYRAAMVPGFLLAGAYIVYVAIMCLIKPSCAPALPEEARRFREANGTRGGRSLLVLMAISVAAAWLMGRWLENDAAPMDERIVVSLLLWGLTAFVIAIVNKVLKLGLLSALAERVTFVMIPPLFLIFLVLGTIFIGVATPTEGGAMGAVGAIVMALIRRRLSLDLLKQAMDTTTKLSCFVVFILVGSTVFGLTFRGVNGDLWVEHLLTGLPGGQWGFLIVVSVLTFVLAFFLDFFELAFIIVPLLGPVADKMGIDLIWFGVILAVNMQTSFMHPPFGFALFYLRSVAPKDPYRDRVTGRTIAPVTTGQIYWGSVPFIVIQLLMVAAVMLMPAMVMHYKGDQSQIDPSSVKIDVQGGYGTSVYGDGDPGAAFK
>NZ_CP021109.1|WP_086073138.1|3909152_3913085_+|hypothetical-protein
MQVTPAASARDAVSPAADANHPPHIDDGLAIALAAPLPLPADGHSPAAAQPAEDRGGAHAAGSHWQRKTRTPIRSRRNTPGHVAAPPPAPRWADRLADAFLRLQATGYTPCTPLENDETVMNALARASGLYPADAQPHAMSAGQKRFLAGHLAMSLTRDIHWDIELSPSAGSDGGVYIEHGVVRNGTAMSIAAARAALAGRIDAVLRATGVPPAQRGWLAPALCDALIADPTLGLRPPPADIRYGSRQWATLWMGLALSRELALPPAPGIGDVIALGQAAMTDPDSNLSTQALLRMAQAAGAIDAAHLAGGDIQHPLTQLRQFVMSHFKAEFPLLDELGGLSRSALATDLLTQAGIDADRQIEVKTWILPAAWGPFKLELPLLFASYRTAIRDYYVDRDTLSASDVEALRRDADDPRPDPDKVLAKLPPSLRTEFERRFDSYKRAACNYLVRRIGNWLASPGTAPAGEGDASAPRVAVHTVRLQRYRILNPPPMPGAGAVLLDERSSKWLIVDIESGAQRSRAIFDPGTETAVPIPPGLDIRTWASGNTGLLFEGYARQAPPAPPAGATPRTLIDHQKTAIAVDALAQGPLDDLSAWLSPALASRIERARAAAAGQSASETLKEIERGLVPFRGAYLAIRNGDLAGAVLSGLLDVAAFLPGIGEGIKTGMTAARAAEAALQAGLAGWRNEGLRTGLILASRRAGQFAGTLGRQAAALAATLARDSVPHPYVWLSPADMMGRAGVDDAMRTAAQLADTHPAIAQHAWQAGQRMAGADFEDGRWVVASQSESAASATRAAPPAGAADDIALADTPLYLTAQDGRGAALPLQRHGDDGYVQFNPETLEPVGPLLLPDRAGKLQSSLPVDLLQRHHVREREVLDALTRTPMREDGTLALGDRIYARVGGDYLELLRDRAASTPGRTVWTVVDVPGPATRHAGVRIVHDRLTGVWRLAERPGLKGGGNPINAIRAYWHRRRARAEDAAMTRQSHEIAHRFLAASYNAASLNVWHYPDAVRAQYPGLIARSLDDHFIKGPDGRIRRFPGGFVADGCFIRGYSRLLDPELLRATDMMADFSQLNGAKVLAGYALNDGTGTVSFLEDGKRIASLAHWGGVYPLSDGAYLFAAPTLAGDAHACEQMLLSQAKPRREVLDELRRTSPSGPRDATPQTAINRLLASLARRLRAAPYRLPLKGVRHDEAMKRLKESLSQHGPCILHRNGRMVMLDAIEQDGEGVWLVIRDPLTCTRARVPDCEEFWSNRTAAMVATAARGEWTLPDVDAVFIPQDTRLLHRALSSASSSLTPGSPSPLVSPA
>NZ_CP021109.1|WP_157664896.1|3908274_3909018_+|AMP-binding-protein
MLVSPFGKACRNDHAATDPEPTDVTAQEVVARLAMTTRAFPARTAIRHGPACCTYAQLWAASERVAAGLRDHGVRARTPLGIGLPASIPWLAAVLGIAKCDASCALLDLQRGREWLAQRIADTGARYVISNREHRHLFSGPVLPIEALLACRADGRHPESFLPFGATGATPAVEKAPADGCAECVAWAPGACPPPSLWHSLWRIASGATMVLAEADAIPYDAQAHGATALRMAGSIVGLSAKAPAHA
>NZ_CP021109.1|WP_086073136.1|3905803_3908116_+|hypothetical-protein
MQVNLKRFAILAITAITLCAGSASAPSKASPVVDYPAVDSAAPISLRPYTQVYEDRDGRLALADILAIEKSDPHRFRPLKEMRRLGAYSGSAWWLRTEIVNAAKAPHALILVGGPPNLEQVDFYLQQDGQWRHFPAGTMIPALQKDGATGYPAAQFTAAPGEAVAVWIRIESASPIRLEPALYTPGSFVAARASDNILGGVLTSSIAALGICAFILFAASHRRAFLWFGGICVTIALSEAASRAYIQPVFWSMASGWTYRLETVIHAIGAALTAMFVYAMGQRAGLPAGHRKVYGVIAALLVICIVPTHFLPVAVLSMATLALTVVMGICLMTSALGTARLSRNGAILLAAAAVLLLAHAAGMSLHLPGASPWLIPSALPQAGTPPVALFSMLACAVALTLWATHRRKSQRVAPGNKQLAAKETGSLERDAAPPHAQVPPATPAAVAPRDEAGHLATPQQTLVLGYVGHDLRAPLATISGYARLLRQTARPEQESYLDMIERSINYQFSLIDEILAYAEYDLQPFDISAGDVQLPALLEELARFGVSLCNHQGNAFRYIPATQLPAVVRLDAKRTRQAVLNLLGNAAKFTRDGTVCFEAGVNQRDDGAELMLQVTNDGTPIPVEHQAEIFSAFRQLRHRDAGSGLGLFIADRIVHGMGGSLRFDSSPKLGNRFAITLPIAVADATPIVTRPIHHVAARDGGTQGIAAPPLAARLALAKLAREGELSEIQQWTAETRQHHPQYEAFYRAVDQCVDNFDMECLQRLALLGIT
>NZ_CP021109.1|WP_157664895.1|3905421_3905904_+|hypothetical-protein
MNVSPGTSAIGDPAKLVPASSYLARPARPRRPVAQLRSGLQKLLAHMDANAANPAFLLPHISHLFDRIFGVRSSRRTKAGAHLFCRFPRLARPFDFMQYVPSFRGSHSGSMQQKWEHRALLAVTPNLHAGQLEAVCDLGDHSDHALRGIRIGAVQSIAGG
>NZ_CP021109.1|WP_086073719.1|3904754_3905294_-|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein
MNVAAAGTRAAADAPAAGKAAPSPPGTIPTRLVVNGEAHQLDLDPRTTLLDALREHLHLTGTKKGCDHGQCGACTVHVNGRRVNACMSFAATHEGDTITTIEGLGQPGNLHPMQAAFVEHDGYQCGYCTSGQIMSAVAMLKEPWGTSDADVREAMSGNICRCGAYPNIVSAIQDARRKV
>NZ_CP021109.1|WP_086073135.1|3903737_3904742_-|xanthine-dehydrogenase-family-protein-subunit-M
MEMFELTRPRDVQDAVRAGAMARTAQQGADVRYLAGGTTLVDLMKLDVERPRRVVDINRLGLDRIEPLPGGGVRIGAMVRNADLANDATIKRDYAALSQALLSGASAQLRNMATTGGNLLQRTRCVYFRDTASACNKRDPGSGCSAIDGYNRNLAILGTSDRCIASNPSDMNVAMMALEATIHIQGANGERTVPIGDFYTLPGDTPERETVLEPGDLITHVTLPSPPPGSRSVYLKLRDRASYEFALASAAVIAVVENGAMRHVRVALGGVGTRPWRAPEAESALVGKAPGEDAFRAAADAALQDARPQSQNAFKVELARRCLVHALKQATQTA
>NZ_CP021109.1|WP_086073134.1|3901489_3903721_-|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MNTVADRSVSDAAGIIGRATPRIDGPLKVSGRASYTSDFHFPGMLYAVPVCSTIANGRIEALDLAEAEAMPGVRMILHRGNIGKLYRVQGAKVDETRPPFDDDVIRYYGQYVAAVVADTFEQAMAAANAVKVRYRADKPQVATALSPDTKPEVKSQRGDADPAFEAAAVKVDQTYITPVETHNPIELHATVAVWDGQAYTLYETTQAVANHKAVMVQQLGTTPENVRVVSRFLGSGFGGKLWPWPHCAIAAVAARETGRPVKLVLTRQMMFQNVGHRPITQQRIRLGATQDGKLVSLQQDYVTQTSILDDYEENCAEATPHMYSTPNLRVTAALARRHMGTPTPMRGPGAVPGLFALESAMDELAVALKMDPVQLRLTNEPEHDESNGLPFSSRHLVECIRLGAEKFGWPQRTPEIGSMRRDGKILGWGMACCSWLGARQPTHARVDLKADGSAHVACGTQDIGTGTYTIMAQLVSAETGIAPERIDVMLGDTALPEGPVSGGSTVTSSVVPAVFQATRAAVQSVLQLACKTDGSPYSGRKPEDLALTAGRVHLKGRPPESGVNFGEIIAGADLMAISGEGSETSGNFGNDPLKRKYSINSYGVHFAEVEWQPEIARMRVSRVVTVIDAGRILNPRPARNQIEGAIVMGVGMALFEHTLYDDRSGKPVNNNLADYIVASNADTPEIDVTFLDHPDPVLNELGARGVGEIGLAGTAAAITNAIYHATGLRVRELPATIEDLLQA
>NZ_CP021109.1|WP_086073133.1|3900865_3901432_+|SRPBCC-family-protein
MSERENYRPGPAAGMQVRKDGEKWTLVVVRELRHAPEKVWKAITEPEHLREWAPFDSDRSLGTVGTARLSTVGAPVSQTSETRIKRAEAPRVLEYTWGDNDMRWELEPLDGGGTRLTLWHNIDRGFISMGAAGWHICLDVLDRALSDRPVGRIVGMDALKFGDWQRLNAEYAKQFGLEPASWPPQAAD
>NZ_CP021109.1|WP_086058590.1|3900540_3900846_+|helix-turn-helix-transcriptional-regulator
MESAFSIVAEPNRRAILGLLLASERSVGDLERELRLSQPSVSKHLRVLRDAGFVESRIEAQRRLYRLRPEPLMELDAWLAPFRRYWSGHVDALERHLDKME
>NZ_CP021109.1|WP_086073140.1|3915174_3915768_-|TRAP-transporter-small-permease-subunit
MKALLALSRLIDAINLRVGRAVTWVTLLVVLVSAGNAVVRKVLHTSSNAWLELQWYMFGAMFLLASGYTLLKNEHVRVDILSARLSRRKQIWIEIFGVLFFLLPACVLILVLSWPVFTESWLTNEQSSNSGGLVRWPVKLLIPVGFTLLVLAGISHLIKCVGYLLGRCEDPMRRDVAKSAEEELAEEIAREAQSRGV
>NZ_CP021109.1|WP_086073141.1|3915778_3916876_-|TRAP-transporter-substrate-binding-protein
MQRRSFLKNAALGAAAGSATLASPVFAQDAPTIHWRLASSFPRSADAIYSGGENLAKYVGEATGGKFAIRAFPAGEIVPALQVLDGVQNGTVECGHSASYYYFGKDPALSFDAAVPFGLNTRQMNAWMRHGNGLKLMRDLFKNYNIVNFPCGYTGTQMGGWFRNEIKTVDDLKGLKFRVSAFAGAVLSRLGVVPQQIAGGDIYPALEKGTIDGAEWIGPYDDEKLGFNKVAKYYYFPGWWEGTLQVSLYVNQDAYNKLPKHYQAVLEQAAAAATNDMIAKYDAENPAALRRLIANGAVLRSFPKPVMDACYAESLKVYKEMSEKSAMFKKIYDDMVAFRDNEIPWFRVADGSYDGYMGTIPRDGK
>NZ_CP021109.1|WP_086073142.1|3917199_3918903_+|argininosuccinate-lyase
MRRHFAPACLAIALSSLGAAAAAQTAPGQPAPPATPNATSASSAAPSSDAGHGGAGLAASQAPDAAAKPAAAHRRDEFFWLGEINKATAVINTDQGLLDKAMAPQLAAAVAKVIQDGNQPGGKRPSTVITFEPLLIKAGGMDVTLLHAGRSSQDMHATYRAAILRDKLLELADQLNITSATLVDLAARHAGTIVPNYTNGVAAQPNSYGHYLLGHAAALDRDAQRIREAYARIDRSPMGTTVLNGTSWPLDRQRMADYLGFSRLVDNAYDASQISSMDEPVEVASIVTSIALHTGNFIEDIMTQYAQSRPWILLQEGGGNTYVSSAMPQKRNPGLLNSTRSDASTALTLAMGPVIQTHNITPGMSDPKEVAQNSAMVDSAIKALKKWDRVMKALVINPDRALEELNSDWTASQELADVLMRKYQLPFREGHHFASEVVEYARQHDIKPLDFPYAQAQRIYAETVKGTRYPQALPMSEAEFRSTLDPVAIVKNRATAGGPQPAEMDRMLKDARDRLAAQAAWISQHREHIDDALARLDKDFDRLLDSGKDSPDQPASGNAGFHATSHK
>NZ_CP021109.1|WP_086073143.1|3918854_3919277_-|VOC-family-protein
MESRISFITLGVSDLERAVHFYRDGMGLATEGIVGVEFEHGAVAFFDMQPGLKLALWGREDLAHDTGLPAATPGVPSFALAHNVRNETEVDAVLEQARQAGGQVVKPAGKTFWGGYAGYFQDPDGYLWEVAWNPALPLAG
>NZ_CP021109.1|WP_086073144.1|3919371_3920106_-|GntR-family-transcriptional-regulator
MAIPNEKGARGAASAKPAAPAPILANEDIYRRLQQAVFEHRLLPGTRLVEDHLAEVTGSTRGRIRQVLARLAHENLVTLIPNRGAFIAKPTVEEAREVFAMRQLIEPSMADLLARGPKASHIARLRAHVRQEAAARAAGDRAAIIRLSGAFHMLMAELTGNRILTRTLRELCAQTCLVITLYDKPNTPACPYHEHETMIDAIEAGDGAQAAALMRHHLQHIEATLALEEPEPAGRVDLQSLFFS
>NZ_CP021109.1|WP_086073720.1|3920546_3921518_+|ABC-transporter-substrate-binding-protein
MVTLAGSYGPARAADPEIKLGFAKCAHCVPMGLTPQLAKGVAIDATAFTSGNDVLTALVSKSVDIAQVTYLHFVTALDKGFDIVAISGEVNGGSELLSAPALGLKADDWDGLKKLVAARKQAGTPLRVAASRGNAQDLHMRGVLATHGINPDKDVQFINIPNPADHAAALQRNEVDLVSTVEPFASQIRMNGAGKHFDFPYDQAAGKLTNLIVTRSDVIRAKPQAVQSTVDAVVALVGKLKTDQGMWVGAIAKYTALDPRIAAAALDNAYPDYAMYQKQTLAIARMMKDLHYVSTDVSAQIPSHMDYSFLARSTGKTPADLGQ
>NZ_CP021109.1|WP_086073145.1|3921537_3922359_+|ABC-transporter-permease
MHLLRHKERLAVPLIVLLAWEAFSRSGWIPPALLPAPSRVILTWADWIFGTDGSTQSYSGEWLNAAVASLLRVLAGYAIAAASGILLGIAIGWWRWVEKTVEPTIQVLRPIPPVSWIPLAIIWFGIANKPAIFLVFLGAFFPILMNTIHGVKNVDRNLIRAAAMMDATQWQLLRHVVMPAALPSIFSGLRIAIGSAWMLTVTAEMVAVKSGLGYSLWDSYYFLRYDLVIAAMVSIGLLGFLSDLLLKHIMNGALHWQRASTLQGNQHAARSPR
>NZ_CP021109.1|WP_086073146.1|3922355_3923129_+|ABC-transporter-ATP-binding-protein
MSHVVFEGIGKTFYDARRNTELLTLQDVSLSVGEHELLCLLGPSGCGKSTLLNMLAGFEQPTTGRVTVQGKPVTRPGADRGMVFQQATLMPWLPVWDNVAFPYRLRGMPKAQRRRLAQPYIDLVGLTGFEDHYPSELSGGMSQRVGIARALLLNPGVILMDEPFAALDAQTKADIQEELVAIWQKSRSTIVFVTHSVEEALILGTQVAVMTHRPGRIRELIPIDLPRPRDTTSALFNEIKRHVLSLIREEAALARAA
>NZ_CP021109.1|WP_086073147.1|3923200_3923932_+|Asp/Glu/hydantoin-racemase
MTVNRLLLGMLTPSSNTALEPVTSAMLSGLPEATAHFGRFPVTEIALSERALAQFDDAPILQAATLLAHARMSVICWNGTSSGWLGFDADRELCRRIESATGIAACTSVLALNEIFERRSVRNFALVTPYTDDVQARILNNYLDAGYTCVAERHLGRRDNFSFSEVDADTLRGMVREVAKSGPDAISIFCTNLHGAPLVEELEREVGIPIYDTIATAVWKSLRLAGADTRRVQGWGSLFREVL
>NZ_CP021109.1|WP_086073148.1|3923928_3925446_+|dihydropyrimidinase
MSDAPASGNKPYDLVVRHARVATASDVFETDIGIRDGRIAALARDLPPGAEEIDAAGRWVLPGGVDAHCHLAQKTGDNSVMADDFLSGTRSAACGGTTTVIPFAAQLKGESLAQAVRDYHAVADGKACIDYAFHMIVSDATAQVTQEELPALIGQGYTSFKIYMTYDDLKLNDRQILDVLDTARRHGAMTMVHAESSDCIAWLADRMLAEGLQAPPYHALSRPPVVEREATHRAISLAELLDTPILIVHVSGPEAIEQIRWAQTRGLKIYAETCPQYLFLTAADLGGDALHGAKCICSPPPRDAAAHEAVWNALANGTFQVFSSDHAPFRFDGEGGKKPQGDDTPFNHVPNGIPGLETRLALLFSEGVLEGRLDINTFVALTATQPAKLYGLAPRKGTIAIGADADIVVWDTGLPRVVRNADLHHNVDYTPYEGRTVRAWPGITLSRGRVVYRDGEFVGEAGHGRFLPCERPLAARPRPARHRRAPWLDVLSRVAPDTANDGATP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_16

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_16

4232971-4233066

Orphan

Consensus_repeat	Method
GGGAAGCGCGCCAGCGCTTCGGGGGTGGGCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_16

>merge|NZ_CP021109|16|4232971-4233066|CRISPRCasFinder
GGGAAGCGCGCCAGCGCTTCGGGGGTGGGCTTCCCTTCCGGTCCGCAGGCGCGCCCCCTTGAGCGGGAAGCGCGCCAGCGCTTCGGGGGTGGGCTT

>NZ_CP021109|16|16|4232971-4233066|CRISPRCasFinder
GGGAAGCGCGCCAGCGCTTCGGGGGTGGGCTT	CCCTTCCGGTCCGCAGGCGCGCCCCCTTGAGC
GGGAAGCGCGCCAGCGCTTCGGGGGTGGGCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086073277.1\|4239808_4241329_+\|anthranilate-synthase-component-I	unknown	unknown	gnl\|CDD\|184146
NZ_CP021109.1\|WP_086058840.1\|4225106_4225397_-\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|238126
NZ_CP021109.1\|WP_086073271.1\|4227586_4227967_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236776
NZ_CP021109.1\|WP_086058842.1\|4225825_4226128_-\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|223706
NZ_CP021109.1\|WP_086073273.1\|4233068_4234022_-\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP021109.1\|WP_086073272.1\|4230195_4232724_+\|glucans-biosynthesis-glucosyltransferase-MdoH	unknown	unknown	gnl\|CDD\|225494
NZ_CP021109.1\|WP_086073274.1\|4234068_4234947_-\|DsbC-family-protein	unknown	unknown	gnl\|CDD\|239318
NZ_CP021109.1\|WP_086073268.1\|4224084_4225014_+\|ornithine-cyclodeaminase-family-protein	unknown	unknown	gnl\|CDD\|225280
NZ_CP021109.1\|WP_086058856.1\|4241954_4242980_+\|anthranilate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234682
NZ_CP021109.1\|WP_086073741.1\|4236162_4237473_-\|murein-transglycosylase-A	unknown	unknown	gnl\|CDD\|377065
NZ_CP021109.1\|WP_086073270.1\|4227229_4227454_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073276.1\|4238009_4238726_+\|ribulose-phosphate-3-epimerase	unknown	unknown	gnl\|CDD\|235515
NZ_CP021109.1\|WP_086073275.1\|4234996_4236166_-\|UbiH/UbiF-family-hydroxylase	unknown	unknown	gnl\|CDD\|181057
NZ_CP021109.1\|WP_086059616.1\|4228703_4230215_+\|glucan-biosynthesis-protein-G	unknown	unknown	gnl\|CDD\|237328
NZ_CP021109.1\|WP_086058843.1\|4226143_4226875_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP021109.1\|WP_086058851.1\|4237538_4237913_-\|Co2+/Mg2+-efflux-protein-ApaG	unknown	unknown	gnl\|CDD\|180098
NZ_CP021109.1\|WP_086058853.1\|4238838_4239546_+\|phosphoglycolate-phosphatase	unknown	unknown	gnl\|CDD\|237310
NZ_CP021109.1\|WP_086058846.1\|4228124_4228388_+\|DUF1488-family-protein	unknown	unknown	gnl\|CDD\|377825
NZ_CP021109.1\|WP_086073269.1\|4225505_4225829_-\|ferredoxin	unknown	unknown	unknown
NZ_CP021109.1\|WP_086073278.1\|4241358_4241931_+\|aminodeoxychorismate/anthranilate-synthase-component-II	unknown	unknown	gnl\|CDD\|235552

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086058840.1\|4225106_4225397_-\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	gnl\|CDD\|238126	cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis and ferredoxins, which participate in redox chains (from bacteria to mammals). Fold is ismilar to thioredoxin.	1.21638e-16
NZ_CP021109.1\|WP_086073271.1\|4227586_4227967_+\|hypothetical-protein	gnl\|CDD\|236776	PRK10856, PRK10856, cytoskeleton protein RodZ.	0.00622986
NZ_CP021109.1\|WP_086058842.1\|4225825_4226128_-\|(2Fe-2S)-binding-protein	gnl\|CDD\|223706	COG0633, Fdx, Ferredoxin [Energy production and conversion].	4.49635e-12
NZ_CP021109.1\|WP_086073273.1\|4233068_4234022_-\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	1.06498e-166
NZ_CP021109.1\|WP_086073272.1\|4230195_4232724_+\|glucans-biosynthesis-glucosyltransferase-MdoH	gnl\|CDD\|225494	COG2943, MdoH, Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane].	0
NZ_CP021109.1\|WP_086073274.1\|4234068_4234947_-\|DsbC-family-protein	gnl\|CDD\|239318	cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.	4.12089e-65
NZ_CP021109.1\|WP_086073268.1\|4224084_4225014_+\|ornithine-cyclodeaminase-family-protein	gnl\|CDD\|225280	COG2423, COG2423, Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism].	2.0184e-62
NZ_CP021109.1\|WP_086058856.1\|4241954_4242980_+\|anthranilate-phosphoribosyltransferase	gnl\|CDD\|234682	PRK00188, trpD, anthranilate phosphoribosyltransferase; Provisional.	0
NZ_CP021109.1\|WP_086073741.1\|4236162_4237473_-\|murein-transglycosylase-A	gnl\|CDD\|377065	pfam03562, MltA, MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.	4.7135e-101
NZ_CP021109.1\|WP_086073276.1\|4238009_4238726_+\|ribulose-phosphate-3-epimerase	gnl\|CDD\|235515	PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated.	5.60668e-126
NZ_CP021109.1\|WP_086073275.1\|4234996_4236166_-\|UbiH/UbiF-family-hydroxylase	gnl\|CDD\|181057	PRK07608, PRK07608, UbiH/UbiF family hydroxylase.	4.40364e-158
NZ_CP021109.1\|WP_086059616.1\|4228703_4230215_+\|glucan-biosynthesis-protein-G	gnl\|CDD\|237328	PRK13274, mdoG, glucan biosynthesis protein G; Provisional.	0
NZ_CP021109.1\|WP_086058843.1\|4226143_4226875_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	2.54995e-36
NZ_CP021109.1\|WP_086058851.1\|4237538_4237913_-\|Co2+/Mg2+-efflux-protein-ApaG	gnl\|CDD\|180098	PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed.	1.36974e-80
NZ_CP021109.1\|WP_086058853.1\|4238838_4239546_+\|phosphoglycolate-phosphatase	gnl\|CDD\|237310	PRK13222, PRK13222, N-acetylmuramic acid 6-phosphate phosphatase MupP.	1.68885e-89
NZ_CP021109.1\|WP_086058846.1\|4228124_4228388_+\|DUF1488-family-protein	gnl\|CDD\|377825	pfam07369, DUF1488, Protein of unknown function (DUF1488). This family consists of several hypothetical bacterial proteins of around 85 residues in length. The function of this family is unknown.	1.70373e-05
NZ_CP021109.1\|WP_086073277.1\|4239808_4241329_+\|anthranilate-synthase-component-I	gnl\|CDD\|184146	PRK13565, PRK13565, anthranilate synthase component I; Provisional.	0
NZ_CP021109.1\|WP_086073278.1\|4241358_4241931_+\|aminodeoxychorismate/anthranilate-synthase-component-II	gnl\|CDD\|235552	PRK05670, PRK05670, anthranilate synthase component II; Provisional.	5.29309e-129

>NZ_CP021109.1|WP_086073272.1|4230195_4232724_+|glucans-biosynthesis-glucosyltransferase-MdoH
MNLKPNNSVPGTDTVEDYLERLALPPQARQRALERAAQAAGEGQPALEAMHRALAGDDAAAAEPELASGLARLRAAEGDDPDIEAMARQLPDSGVCLSSAPPLNRTPMSPEPWITNPLVRGWRRLRGQAPSTAEDYNAIAPRMDPRWRLAGSRRRLVLLVMVALQTAVATYYMKGVLPYQGKQVLEIGILFLFALLFCWVSAGFWTAMMGFLQLLIGRDRYSISARGMSDAPLDPSARTAIVMPICNEDVPRVFAGLRATYESLAQTDALENFDIFVLSDSYKADICVAEQRAWVDLCKTVKGFGRIFYRRRRRRVKRKSGNIDDFCRRWGANYRYMVVLDADSVMTGDCLKRLVQLMEASPDAGIIQSAPQASGMDSLYARIQQFATRVYGPLFTAGMHYWQLGESHYWGHNAIIRLAPFMRHCVLAPLPGKGAFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLEELQRDQRWCHGNLMNFRLFFIEGFHPVHRAVFLTGVMSYLSAPLWFLFLLLSTALLAVHTLTEPQYFIEPRQLFPIWPQWHPDKAIALFSTTAVLLFLPKVLGVLLVWARGARLFGGRQKVLSSMLQEVLFSMLLAPVRMLFHTRFVVAAFLGLSAKWISPARDNNETTWGDAFKRHGSQTLLGLCWAALVAWLNPVFLFWMAPILAALLLIIPLSVYSSRVDLGRRAYLSRLFRIPEETHPPTELQATRRYTAQNRSVPHIPDFEDAIVDPGVNALACAMATARHKPNPLNEAYRRQQVDHVMEYGVDALSEPQKIKLLDDPVSLGRVHGAIWRSREEHAVQLRERTAPREEAEPDLETAEAVL
>NZ_CP021109.1|WP_086059616.1|4228703_4230215_+|glucan-biosynthesis-protein-G
MGLGQSAQAFSFFDVMKQARDLAGQSYKAPEPNLPDSLQELKFAGYQQVRFKNDHLHWRNAGTKFTLSFYHEGMHFNTPVKINEIDAAGVHEIKFDPDDFDYGNLKLDPAALKNLGFAGFRVLYPVNSKDKKDDELASFLGASYFRVIGKGQTYGLSARGLAIDTALPSGEEFPRFREYWIARPAPEDSTLTIYALLDSPRATGAYRFILKPTDDSTVVDVKARIFLRDQVGRLGIAPITSMFLYGSNQPSPIPNYRPEMHDSDGLAIHTGNDEWLWRPLVNPRRLAVSAFSVENPRGFGLLQRGREFSRYEDLDDHYEKRPSLWIEPQGDWGKGSVQLVEIPTKDETNDNIVAFWVPEKQPAKGEPLDADYRMTWTLNENKTHTTPLAWVMQTRRSREEVKGPDLIRRADGSIAYIIDFVGPSLQSLPADATVTADTWVDGNGQIVENTVRPNGVTGGRRLILRVNVKDPTKPVEMRAFLTNGQTPLSETWTYRIPNEPEAK
>NZ_CP021109.1|WP_086058846.1|4228124_4228388_+|DUF1488-family-protein
MGNFANETHARVQDDAIFFTLTQNGETRQFEISGDALRECFGAEDSSGSALLRGFERGCEKIRSVAQAAFNTPTDGITTLGTGDFDG
>NZ_CP021109.1|WP_086073271.1|4227586_4227967_+|hypothetical-protein
MKLRRLTPALAFAAVFATGVATAQSSAPTTPSTTPNDTTATPPNNAKVPPGTASPAPNSTVTPQSNTGKGTATHKSGTSGHGSQHSGSMNKSRSDKSHSGSSSSSSTRSGNSAQPSESVPATGAGK
>NZ_CP021109.1|WP_086073270.1|4227229_4227454_+|hypothetical-protein
MNTHLSPQETYLARPIGEQMAAHLARRAEVRRMVPLLPRSLAELFAAWRRPATNASARPPRENRAAHSWASETK
>NZ_CP021109.1|WP_086058843.1|4226143_4226875_-|iron-containing-redox-enzyme-family-protein
MAELMSRDEFRTALENAIKGKSANASPFSIAWASGKLSREHLCRWAENHYHYVGPFADYLGYLYARTPDHYTEAKDFLLANMYEEEIGGDRHTDLLIRFAEACGTTRERVTNPDNMSPTTRALQSWCYCVAMREDPIVAVAGLVVGLESQVPSIYRKQTPTLREKYGFTDEEVEFFDLHIVSDEIHGERGYQIVLEHANTPELQQRCLKICEIGAQMRLLYTTALYTDYVEKDIPLPELKMAA
>NZ_CP021109.1|WP_086058842.1|4225825_4226128_-|(2Fe-2S)-binding-protein
MPTVVFHKGGETYTDVVQDNANLVVRAGIKRFPYPHLRYECGMGKCAKCACRVIAGGEHLPPVNWKEKKQLGERVEQGYRLACQLWLTADIELAQDDEAS
>NZ_CP021109.1|WP_086073269.1|4225505_4225829_-|ferredoxin
MTTPTGPAFYAVLTSKPGIYHSEPGADVEVVETYDYVFCGKTKAVFQIVRAPGPTRVRIVEDAPPHTVNVVPTRVLERFATLEEARCAIGQLANFGTLDAALVRREG
>NZ_CP021109.1|WP_086058840.1|4225106_4225397_-|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein
MVEITFLTNGGKVVTAPPNSNLLRVSLKEKGGIPFKCGGGLCGTCKCLIEEGLENTDAVKPKERRHLTPEDFEKGYRMACQTFVNGNIKVSWEPGR
>NZ_CP021109.1|WP_086073268.1|4224084_4225014_+|ornithine-cyclodeaminase-family-protein
MLHISDEMVDAAVSPSDAQNILLDAFRQFGQGQAAMQKRERTDSGGVKLSTLGAVIPGQDVVGAKVYTTIQGQFSFVILLFSARDGRPLATFDAAALTRRRTAACSVLAARALARPDAATLGLYGAGTQGAEHAAQMTAAFGLKQVLVHDPHAPRGYTDTLSARIGVPVVETDPQEIAAAADIVVTASRSTTPLFSGGALKNGAFVAAIGSSLPHTRELDDEALRRAARLVVEWKPQSLTEAGDIVLASRDALPPEKIVELAEVLSDKVVRQHADQIFIYKSVGVGLEDIAVAGLAYRRIAESRGLPQP
>NZ_CP021109.1|WP_086073273.1|4233068_4234022_-|D-2-hydroxyacid-dehydrogenase-family-protein
MKIAILDDYHGVAADYADWASLGPQATVQVFREYLPDGPGRIAALQPFDVIVIMRERTPFPAELINALPALKLLVTTGLRNNAIDMEACKARGIVVSGAPGAPNAVNATAELSWALILALFKNLCTENQNMRQGQWQTGMPLPLKGKRLGVIGLGKLGSAVARVGRAFDMDVVAWSPNLTPERAEQGGARYAGKQELFATSDVVSVHLILSASTRHVVDAASIAAMKPTAFFVNTSRAGLVDQDALMDALRNGRLAGAGLDVFPAEPLPPDDPVRQLRNVVLTPHLGYVSEDNFKAFYANALEAIKAWGAGSPLRVL
>NZ_CP021109.1|WP_086073274.1|4234068_4234947_-|DsbC-family-protein
MTIRAWLSAACLAVAAASLAATSSAADKSVSTQSAGRPAAGETVTNTSGLAPAAKSTSTDGPNPGEKVVSTTQAAPTDADAVAARFHERFPDLNVTAVRRTPYGLFEVQVGMDLIYTDASVGWVMEGPLIDAVTRRDVTRERQEQIGSIAFSQLPLDLAIKRVNGDGSRVVAIFEDPNCGYCKQLRQTLEDVPNLTIYTFIYPILAPDSRVKARDIWCAPKPGQAWDDWMVRGKTPPTGSCNAPIDQVLALGQRLMVRGTPTLFFADGSRVSGALPRDELMTYLDKSSQKGG
>NZ_CP021109.1|WP_086073275.1|4234996_4236166_-|UbiH/UbiF-family-hydroxylase
MSEGIVVCGAGIVGLATALALARRRQPVSVLAPAAAVPPAPAAHYHPRVYALSPASQRFLAELGIWDALPAARMAPVDAMEVHGDADGAVTLTAWQAAQPHLAWIVEASEIERVLAQAVRLSGIPWITDRCVGYQRGMLLTEGGAQLRAGLAVGADGASSPLRSAAGLDHRSVPYDAVGLVTHLDADLPHHGTAMQWFRDDGVLALLPLPDTERGPQVSMVWSAPAAQARALQALPAEEQARQLSRHLAHITAGRLGEVRMNIGLHGFPLFVEHAQMVAPGVALAGDAAHRVHPLAGQGLNLGLGDAEALATIVAQREPYRGPGDLRVLRRYQRARAEPVLAMRLVTDGLHRLFASRGAPAAWLRNAGMRWVDAMPSIKRLLIEQASRG
>NZ_CP021109.1|WP_086073741.1|4236162_4237473_-|murein-transglycosylase-A
MSRLFPVALLLSMALAGCSTIAPDVPPEESPAAAPGAPQPSSAEAPLAVPPLTRLPDTPARPLAGRFQRVSYAEIPGWRDDDLAQFWPVFLRNCKGLMRPTSGNLTLPARAAPRAWQPVCAAAVDPARRPVATDPESVRRFLQTYLQPWRLLAADGKPAANLVTGYYEPLVRGSRRQGGLHQWPLYSPPDDLLTVDLGAIYPELAGKRVRGKLEGKRVVPYDTRAELENPGRRPPALVYIDDPVDNFFLQVQGSGRVLLTDGPDAGKTIRVVYADHNGQPYVSIGRWLIDKGELSADQASMQGIRAWAQRNPQRVREMLNANPAVVFFKEEPLVDPEAGPRGAYGVPLTPRRSVAVDASFVPLGTPVFLGTTWPGSDRALERLVFAQDTGTAIRGAARADFYWGTGDAAGQMAGRMKQRGQMWVLWPKQAGEPSAR
>NZ_CP021109.1|WP_086058851.1|4237538_4237913_-|Co2+/Mg2+-efflux-protein-ApaG
MKPYDLTVAVEPRYVPEQSDPAEQQYVFAYTVRITNTGEHPAQVISRHWIITDGNQRVQEVRGLGVVGQQPLLAPGETFEYTSGCPLPTPVGTMRGTYHCVGENGIPFEVPIAEFLLAMPRILH
>NZ_CP021109.1|WP_086073276.1|4238009_4238726_+|ribulose-phosphate-3-epimerase
MPPTMSFLSPATRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPMVCAAIRPHVDVPIDVHLMVEPVDELVPQFAKAGANIISFHPEATRHVDRTLSLIRDHGCMAGLVFNPATPLDYMDYVMDKLDVVLIMSVNPGFGGQSFLPSALTKLREARGRIDRWTQSGGQHIALEVDGGVKVDNIGEIRAAGADTFVAGSAIFGHPDYAAIIGAMRQQIAKATTLPA
>NZ_CP021109.1|WP_086058853.1|4238838_4239546_+|phosphoglycolate-phosphatase
MTSIKAALLDLDGTLLDSVPDLAMAANGMRLELGMGPLREDVIATFVGKGVDRLVQRALAGAQEHGELDPQLFARGRESFYRHYHLVNGDKAVVFDGVLEGLKAMRDMGLRLAVVTNKPTEFTLPLLQRTGLAGFFAAAVCGDTCARKKPDPQPVLHACTLLGVSPAQAVTIGDSLNDTQAGRDAGTRVLVVPYGYNEGVDVRTLEVDGIVSSLVEAAQWIARDGNVLPASAAHG
>NZ_CP021109.1|WP_086073277.1|4239808_4241329_+|anthranilate-synthase-component-I
MTELEFKALATQGYNRIPLIADTYADLDTPLGIYLKLAHSGPENGRMTCLLESVVGGERFGRYSFIGLPARTVIQARGTVTEVLHDGEVVETHHGDPLAFIEQYQSRFKVALRPGMPRFAGGLAGYFGYDTVRHIEPRLGPAVKPFPAGMEEGTPDIMLLHVDELVIVDNLAGRIYLVVYADPAQPEAYARAQQRLRELRQKLRKPVEIPYSHASMQTEERRDFQKEDYLAAVRRAKEYIAAGDLMQVQVGQVIAKPFRDSPLSLYRSLRSLNPSPYMYFWNFGDFHVVGSSPEILVRQERVVDNGQPKSRITIRPLAGTRKRGATPEEDVALAAELQADPKEIAEHVMLIDLARNDVGRVAETGSVKVTDTMSIERYSHVMHLVSNVTGDLDPRMTSMDVLRAAFPAGTLTGAPKVRAMEIIDELEPVRRGIYGGAAGYLSYGGEMDVAIAIRTGVIKDGTLYVQAAAGIVADSNPEAEWAETEAKARAVLRAAEQVQNGLDQPI
>NZ_CP021109.1|WP_086073278.1|4241358_4241931_+|aminodeoxychorismate/anthranilate-synthase-component-II
MSLLMIDNYDSFTYNLVQYFGELGEDVRVARNDQITLEEIAAMKPDRICVSPGPCSPAEAGISVSVIREFGGKIPILGVCLGHQAIGAAFGGDIVRAPRIMHGKTVRIAHKGTDIFAGLPTPYTVIRYNSLTIDPGTLPDCLEATAVAEEDGDIMGVRHKTLPIYGVQFHPESVLSEHGHALMRNFLAIR
>NZ_CP021109.1|WP_086058856.1|4241954_4242980_+|anthranilate-phosphoribosyltransferase
MTISPTEALTRCIEHREIFHDEMLHLMRMLMRGEMSPQMASALLMGLRVKKETIGEITAAAQVMREFATPVQTPYPEQLLDMCGTGGDGSHTFNISTAAMFVAAAAGVKVAKHGGRSASSSSGSADVLEALGANVQIPSEGVAECIDRVGIGFMFAPAHHSAMKNIAAVRKEMGVRTIFNILGPLTNPAGALNQLMGVFHPDLVGIQVRVLQRLGSRHVLIVHGKDGMDEASLGAATMIGELKNGEVLEYEIHPEDYGLSMMSNRGIKVSNREESRDLILEALNDKPGPARDIVALNAGLAIYAGNAAPSIDAGLKLAVETIANGAARGKLEEFCAYTRKF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021109_17

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021109_17

4434102-4434209

Orphan

Consensus_repeat	Method
GCTGCCGTTGACGTTGATCGTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021109_17

>merge|NZ_CP021109|17|4434102-4434209|CRISPRCasFinder
GCTGCCGTTGACGTTGATCGTGCCCGTCGATTCGGCATTGGCCGCGGTGCCGGGATTCGCGTTGACCATGACGCCGACGCCGTTGATGCCGTTGACGTTGATCGTGCC

>NZ_CP021109|17|17|4434102-4434209|CRISPRCasFinder
GCTGCCGTTGACGTTGATCGTGCC	CGTCGATTCGGCATTGGCCGCGGTGCCGGGATTCGCGTTGACCATGACGCCGACGCCGTT
GATGCCGTTGACGTTGATCGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021109.1\|WP_086073375.1\|4422844_4424059_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP021109.1\|WP_086059638.1\|4429883_4430864_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP021109.1\|WP_086059024.1\|4443984_4444635_+\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238497
NZ_CP021109.1\|WP_157664535.1\|4420893_4421679_-\|UTRA-domain-containing-protein	unknown	unknown	gnl\|CDD\|225099
NZ_CP021109.1\|WP_086059016.1\|4428137_4428926_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213191
NZ_CP021109.1\|WP_086059012.1\|4424182_4425046_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP021109.1\|WP_086059020.1\|4437844_4438720_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
NZ_CP021109.1\|WP_086059639.1\|4439674_4440433_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186
NZ_CP021109.1\|WP_086059637.1\|4421894_4422770_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP021109.1\|WP_086057532.1\|4442920_4443964_+\|2,5-dihydroxypyridine-5,6-dioxygenase	unknown	unknown	gnl\|CDD\|225191
NZ_CP021109.1\|WP_086073383.1\|4440429_4441227_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP021109.1\|WP_086073382.1\|4436696_4437830_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380635
NZ_CP021109.1\|WP_086073384.1\|4444670_4445891_+\|NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|181262
NZ_CP021109.1\|WP_157664906.1\|4428918_4429866_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP021109.1\|WP_086073757.1\|4438719_4439682_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP021109.1\|WP_086072475.1\|4441352_4442105_+\|Asp/Glu-racemase	unknown	unknown	gnl\|CDD\|226004
NZ_CP021109.1\|WP_086057533.1\|4442108_4442930_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP021109.1\|WP_086073379.1\|4426852_4428082_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380561
NZ_CP021109.1\|WP_086073377.1\|4425042_4426062_+\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
NZ_CP021109.1\|WP_086073378.1\|4426072_4426777_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213186

Protein	Function_ID	Function_description	E-value
NZ_CP021109.1\|WP_086073375.1\|4422844_4424059_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.78081e-141
NZ_CP021109.1\|WP_086059638.1\|4429883_4430864_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	1.27581e-83
NZ_CP021109.1\|WP_086059024.1\|4443984_4444635_+\|isochorismatase-family-protein	gnl\|CDD\|238497	cd01015, CSHase, N-carbamoylsarcosine amidohydrolase (CSHase) hydrolyzes N-carbamoylsarcosine to sarcosine, carbon dioxide and ammonia. CSHase is involved in one of the two alternative pathways for creatinine degradation to glycine in microorganisms.This CSHase-containing pathway degrades creatinine via N-methylhydantoin N-carbamoylsarcosine and sarcosine to glycine. Enzymes of this pathway are used in the diagnosis for renal disfunction, for determining creatinine levels in urine and serum.	1.79467e-81
NZ_CP021109.1\|WP_157664535.1\|4420893_4421679_-\|UTRA-domain-containing-protein	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	5.34397e-44
NZ_CP021109.1\|WP_086059016.1\|4428137_4428926_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213191	cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter. LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.	3.02291e-99
NZ_CP021109.1\|WP_086059012.1\|4424182_4425046_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.07545e-65
NZ_CP021109.1\|WP_086059020.1\|4437844_4438720_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	3.72566e-72
NZ_CP021109.1\|WP_086059639.1\|4439674_4440433_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	2.80066e-109
NZ_CP021109.1\|WP_086059637.1\|4421894_4422770_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	3.35255e-83
NZ_CP021109.1\|WP_086057532.1\|4442920_4443964_+\|2,5-dihydroxypyridine-5,6-dioxygenase	gnl\|CDD\|225191	COG2309, AmpS, Leucyl aminopeptidase (aminopeptidase T) [Amino acid transport and metabolism].	8.60002e-10
NZ_CP021109.1\|WP_086073383.1\|4440429_4441227_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	1.34828e-114
NZ_CP021109.1\|WP_086073382.1\|4436696_4437830_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380635	cd19980, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.	1.01074e-154
NZ_CP021109.1\|WP_086073384.1\|4444670_4445891_+\|NAD(P)-binding-protein	gnl\|CDD\|181262	PRK08163, PRK08163, 3-hydroxybenzoate 6-monooxygenase.	7.83705e-99
NZ_CP021109.1\|WP_157664906.1\|4428918_4429866_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	5.35161e-66
NZ_CP021109.1\|WP_086073757.1\|4438719_4439682_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	6.53208e-76
NZ_CP021109.1\|WP_086072475.1\|4441352_4442105_+\|Asp/Glu-racemase	gnl\|CDD\|226004	COG3473, COG3473, Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism].	2.40926e-88
NZ_CP021109.1\|WP_086057533.1\|4442108_4442930_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.00155e-23
NZ_CP021109.1\|WP_086073379.1\|4426852_4428082_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380561	cd06338, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT); however, their ligand specificity has not been determined experimentally.	2.76169e-124
NZ_CP021109.1\|WP_086073377.1\|4425042_4426062_+\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	2.40413e-62
NZ_CP021109.1\|WP_086073378.1\|4426072_4426777_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213186	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system. The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).	5.19981e-100

>NZ_CP021109.1|WP_086059638.1|4429883_4430864_+|CoA-ester-lyase
MPPASHRPERLHRSELAVPATNPRFFAKAAASAADVVFLDLEDAVAPHAKDEARANAVAALNEVDWGGKTMAVRVNGLDTPWAHRDIVDVARLAPRLDLILLPKAGSGFDVRFVDQLLTLIERETGRPTQIGIEVLIETAMGVANAEAIAQGSPRLEAMIFGVGDYTVDMRTYDDVFGLPSPRYAVLTGNAHGGARERHWNDQWHFAMARIANACRAYGLRPVDGPYTDFRDAEGYRASAQRAAALGFEGKWAIHPSQIELANEAFSPTPAQREWAARIAKLIEDTNRTGQGAVGDDGVLVDMAHLKQARQIARRQALIERMAAGA
>NZ_CP021109.1|WP_157664906.1|4428918_4429866_+|CoA-ester-lyase
MPEPRLRRTLLMTPGNREDRLRKAATYAADALVYDLEDGVPPAQKARARECVAAVLAERASSGPERCVRINPLQSGLGAEDLAALPLDRIDSIMVPKVESADALRDIDAWLARSGADRGRQRPIELIALIETPRGVLRALDIADATPRTSALFFGSGDYTSALGAALDAATLQYPRCVIAAAAAAAGIQAIDAAFFLDVKDAQAARQDALTAKALGYAGKVVFHPNQIAAVNDAFSPTADEIARARRIVQAYEDQARRGHGTGVADGMFVAIDLVPPARRLLAIAEMLHLAPSAPAAVAPSDRPAAPRPSDMDLS
>NZ_CP021109.1|WP_086059016.1|4428137_4428926_+|ABC-transporter-ATP-binding-protein
MNEETGPYLEMQGVTTGYGDVPVVRNATMRFARGGITAVIGSNGAGKSTAIKAAAGLLRVWKGNVRIGGVDVTQEAPHKRLGRGLAFVPQGRIVLPEMTVRENLDIGAYILGNDRARIERALDRVVATFPVIGQRLRQLAGTMSGGEQQMLAIGRALMTDPTAIILDEPSLGLSPKFVNTVFEKLSELAASGLTVIMVEQKASRALQIADSGYVMHTGQVVYAGPGRELLDNPNVQRLFLGEVPEEIDRLVAAAHDEEAEHA
>NZ_CP021109.1|WP_086073379.1|4426852_4428082_+|ABC-transporter-substrate-binding-protein
METQRDDNMIDAPRRKWITRTGAALAVAAACAAGLAGPAGAADKPIRVGVALSQSGNLADSAKHYWEGVALWRDQVNARGGLLGRQVELIVYDDRSDPATAARLYEKLISDDNVDLLFGPWGSASAATASGVANRHKRIFFNSGGASEQIQERGYKYLFQTAAPISAYVASIGPLAEQRQLKSIAFFGRDYPAARDMEKSIKAIAQQRELKVTASEFFPAGTTDFSSMIAQARQQQPDIWVSVGYPNEAIEMVRQFKASNYLPKVFIHNGVSIDDFLKASGKDGEYAFGMSLYEPSLKTKGNAEFVKAYREQYKSDPGYYSAFSYAGATVMEAAVKAAGSLDQDKLRDVLTTLEVDTVMGHHKVDPKTGKQVGVTGLLVQVRDGKREIVMPTDVKTADAVIPMPPWNKR
>NZ_CP021109.1|WP_086073378.1|4426072_4426777_+|ABC-transporter-ATP-binding-protein
MQEDILVVENVRKSFGGRVALDGASLRIAKGSITGVIGPNGSGKSTLFNIVAGTLPPDAGRVLFDGQDLAHASPADICRRGLGRTFQISRLFAEMTVLENLVVVAHGLSDADAVQRALELLDFLEITPLRDKWGAELSYGQRKLVEIARALMLAPRVMLLDEPFAGINPRLQNRIVDHLQILRAQGLTLFFIDHEMRIVLEICDDLYVLSEGQVIAHGDAAAIRADERVKEAYF
>NZ_CP021109.1|WP_086073377.1|4425042_4426062_+|branched-chain-amino-acid-ABC-transporter-permease
MKTVLILAVAVIAAAIAPRYAGSYPMSFLVQTFIFIGLAYSWNLIGGYAGYTHFGQVTFFGIGAYIGAIAIGKDMPWMWATLLAAVCASLCAAVLGAIMLRLKGPFFAIGMFGIARVCESLALGLDNITQGGTGLYLAAVDLDLVYYAAGAIALVLIVATWRLDNSRLGLQLLSIREDETAAAALGVRTTRLKIGTFIASAFMPGALGSLYACYLGFIDPTTAFAPMTELTVIAMVLLGGMGTVLGPLAGAVALSVVNEVLWARLPEIYLSLVGVIILVAVLFMPRGIVNFAQRHAWSWMPVARGHLRRLADRRGKPAAQARKPMPKASRPAPKQFIKP
>NZ_CP021109.1|WP_086059012.1|4424182_4425046_+|branched-chain-amino-acid-ABC-transporter-permease
MPFLELFVGGILLGGLYALMACGLNLVFGVMRVINFAHGDLLAVGALTTVSIVAGMHLPYFAALVLVPLLTAALGLAMQWLVIRRIADAPMIMSLLATFALSTIIVNVSILIWGGGYRGLPTVLGGSVALAGMDIPLSRLVSFVVAMAATLGVWWFLQTTRYGKAIRSVSQAPELAVISGISIEQVRNVTFALGAAMAGLAGVLLAPTFASDAQLGARFGIKAFAVIIVGGMGSYPGAMLAALLMGILEVFAGYLYGQVLGAATVFLAMLVVLVVRPRGIFGMGARA
>NZ_CP021109.1|WP_086073375.1|4422844_4424059_+|CoA-transferase
MSNAAAAVRPLDHLKVIDVSSFLAGPFCSTQLAEFGADVIKLELPRVGDPLRRFGTITPCGDSLPWLSECRNKKSATLDLRTPEGAELLKALVKESDVLVENFQPGTLEKWNLGWDVLKEVNPRLIMVRISGYGQTGPYSGRPGFGRIGNAFGGLSYLAGYPDRPPVTPGSATIPDYMAGLYGALGVLLALQSLAKTGRGQVVDIGLYEPIFRILDELAPAYHMKGYVRQRMGPGTVNVVPHSHYPTADGRWVAIACTSDKIFERLAHAMGVPEVAGTGKWGTIAQREAERAQVDEYVGAWSSQYTRDEVLRRCEEHQVPCGPVYAIDEIFEDPQYAARGNIVRFQDARVGEYAVPNVVPRLTDTPGGIDRLGPALGEHNDEVYRERLGLSPERIEALAKAGVI
>NZ_CP021109.1|WP_086059637.1|4421894_4422770_+|CoA-ester-lyase
MTVFRSFLFAPANHARRVEKALALDADAVILDLEDACAVSEKAASRAKVVEAMRQPRRCLGYVRVNPLHTVFAYGDLTETIRPGLDGVVLPKVESASDVRTADWLMRQLERERGMPEGGVDLIPIIETAQGVARLPEILTAAPRVRRVAFGAGDFTLDLDLTWTRDETELAPYRAQIVMQSRAAGLEPPLDTVWVDLKDPEGCEASARKARELGFQGKLCIHPDQIAMVNRAFSPSDAQIERARRVLDAFAQAEAQGSSAIQLDGQFIDYPIVYAAQRVVAMAERLSGRAA
>NZ_CP021109.1|WP_157664535.1|4420893_4421679_-|UTRA-domain-containing-protein
MRTNPSADGSDYAGALAGGRNPLYVALAKTLAADIHGGRYPIGSTLPTEGELSLRYGVSRHTVRQALRELKEEGLLWSRPGIGTKVRARPESPRFFSGIHNISDLLQFVDATEMHVKSRREIVADDAFAELLHCQPGQAWSETNIVRKVPGGDTPLCYLQAYLRPEYAGAIGRTRIIKRPIYSLVEERYGVRIVEVLQEITAAQLTREMAQALKADEGQAALRISRYYLDRQGTIVEVGIGHYPSGRYTQSTRFRAHSAEE
>NZ_CP021109.1|WP_086073382.1|4436696_4437830_+|ABC-transporter-substrate-binding-protein
MRRGFVGYAALAALVAGHAAYAADTVKVGLIQPLTGSVAYNGIADVNGAKLAVAQRNAKGGVLGKQVELIVEDGQCQPAKSVNAAEKLIQKDQVPVISGAFCSSATIAVMSVAEKYKVPLLSGVSSKTDLTERGNQWFFRSAETDSLMAHAFAEILVKNLKLKTIAYIGVNDDWGRGGVDEFSRQIESMGGKTVLKEYFDHGTTDFYTLLTRVRAAKPDGIFVAAETQDGSIVVKQMKELGLTSKVFGVGSWATADFVKLTGDASEGIHAAVPYAATIDTPANQAFVADYKAAYKEAPGKYSAAGYNALNIIMDAIERAGAADPAKIREAMQKTDYKGPNGHFRFDAKHQAYGFDAVLVQLKNGTPEIVSRTTVQEP
>NZ_CP021109.1|WP_086059020.1|4437844_4438720_+|branched-chain-amino-acid-ABC-transporter-permease
MFDLLLQFLVNGLVNGTFYALSALGLTLVFGLMRLVNFAHGEFYMMGGLLGWALTTSLHLNFFAGLALVIVVMGAVGWVVDRLLIERVRGQGEEPGILLTIGLSIFLTNTALLLVGTAPQKVAAPVAGTPVFLGPVVITQVRVFAVAACAVVIVAAHLLIQRTRLGKAMRATFQDPMAARLAGIPTARIYAATFAMGTALAGTAGMLLGSIYVAQASIGGLVSLKAFVVVILGGMGSFAGAIAGGLILGVAEALWGGYLSTGSVDLVGFALVILILFFRPYGLFPTRAERA
>NZ_CP021109.1|WP_086073757.1|4438719_4439682_+|branched-chain-amino-acid-ABC-transporter-permease
MNGERNFLAGFVLLMLAFALGVNNEYLLHIAVLILLYAILATSLNLIVGYVGEFPLGHVAFFGIGAYTLALGATKLGLAPGLLLPLAGVVSAIAGLVIGGVTLRLKGPFFVIVTLAFAEVLRLVANNWIDLTNGPMGISGVPHPAFLDAAGWLAGKRGYAVLGVALAAVTLFIAYRLVHSNAGRAAITLRENRYVAVSIGIDPVRYALFVFTVAAFLAGLAGAYYAAYISYVGPEVFGFPFTVSMIIMVLLGGKGTLSGPLIGAVVVTLLEEYLREFKELRLSLFGLIVMGVVLFSPNGIMGYARRLAPRRAPAAEKRHA
>NZ_CP021109.1|WP_086059639.1|4439674_4440433_+|ABC-transporter-ATP-binding-protein
MLEVQGLCKSFGGIHAVRDIDFRVEPGQIVSLIGPNGAGKTTCFNLVTGFYAPSAGRVRYQGRDVTGTRPHEMARMGVVRTFQKTNVLKNLTVRENLKAAQYLHARAPLWRTFWPGPAQRAAEREIEERAGQIAALMNLQARCDTPAHALSCGELRLLEVGVALGARPRLLMLDEPAAGLNSHEAVVLARLLKTLPGAWVESILLVEHNMNLVMHVSDHVVVMNFGQKLAAGAPRDIQNDPAVLEAYIGRAA
>NZ_CP021109.1|WP_086073383.1|4440429_4441227_+|ABC-transporter-ATP-binding-protein
MSAPGRPKGASSPGEEVAQRQENTPVSGAPLLSLSNVHAGYGKLKALHGVSMEIAQGEVVALIGANGAGKSTILRTVSGLIAPMAGDVRFDGRPIGGMQAPDILAMGLAHCPEERHIWPEMTVQENLELGAYLCRSRAEVQRRVGIAFHRFPRLKERQRQLAGTLSGGEQQMLAIARALMSEPRLLMLDEPSLGLSPKMALEVFQVVREISAHGVTVLVVEQNVHNALSVASRAYVVETGRIAAEKESNALLGDPELLNAYLGGG
>NZ_CP021109.1|WP_086072475.1|4441352_4442105_+|Asp/Glu-racemase
MQKTYRIGQIVPSSNTTMETEIPAMLLARQQIRPERFTFHSSRMRMKKVVKEELAAMDAESDRCAVELSDARVDVLGYACLVAIMAMGPGYHRQSESRLQAHTAANGADAPVITSAGALIEGLKVIGARRIAVVAPYMKPLTQLVIDYIASEGYEVVDSRALEIPDNLEVGRHDPARLPGIVAGMDLSKADAIVLSACVQMPSLPVVAQVEAMTGKPVITAAIATTYAMLKALDLDRIVPGAGALLSGAY
>NZ_CP021109.1|WP_086057533.1|4442108_4442930_+|alpha/beta-hydrolase
MQSTFLYGAHVHANGIRQHYLRYGGQRPGMDPVIIVPGITSPAVTWGFVGERFGQVFDTYILDVRGRGLSQAGDDLDYGLDAQAADLNAFAQALGLTRYSVVGHSMGGRIAIRAASAHPPGLARIVAVDPPVSGPGRRAYPAQLPWYVDSIAQARHGMGVEEMRKFCPTWTEAQLRLRAQWLHTCDERAIRQSFEEFHTQDIHANLPAVQAPLLLMTAARGDVVKDEDVAEIQALKPGTEHVRVPDAGHMIPWDNEAGFYAAFGDFLGASTWR
>NZ_CP021109.1|WP_086057532.1|4442920_4443964_+|2,5-dihydroxypyridine-5,6-dioxygenase
MAISDFEMVRAWKQVLELSRLQRGQTVTILTSAGTHPQTLSTALIACQDMGAIVNRLDLPPVNGEKSLSRDALAYLGTTPLTGNRAAIAALKASDLVLDLMTLLFSPEQHDILQSGTKILLAVEPPEVLARLVPTAQDKARVTAAAARISAAREMRVTSAAGTDLSCPLGEFPAISEYGFVDEPGRWDHWPSGFVLTWPNEGGANGTIVIDRGDILLPQKSYANDRITLTVENGYATRIEGGVDAELLREYMRSFNDPEAYAISHIGWGLQPRAHWTTLSLYDREASIGMDARAYEGNFLFSLGPNNEAGGARTTACHIDIPLRACTVSLDGQEVVRQGKVIDAAQP
>NZ_CP021109.1|WP_086059024.1|4443984_4444635_+|isochorismatase-family-protein
MTHQEEAVYRQQGFGADMDLSGPAGLLIVDFVNGFADPARFGGGNIPAAIEATIALLAHARDRRWPVAHTRIVFADDDGDANVFTLKVPGMLTLKEHDPASAVVDVLAPRAGELVVRKTLPSAFFGTGLAPWLTQRGVRTLVVAGCTTSGCVRASVVDAMSHGFKPLVASDCVGDRAIGPHEANLFDMRQKYAAVMTRDEALRILDSARAEGDGNR
>NZ_CP021109.1|WP_086073384.1|4444670_4445891_+|NAD(P)-binding-protein
MSRKQRVGIIGGGIGGVALANALALRGIEVRLFERTAAFGQVGAGIQMTPNAVKVLKALGLGDDLREIGFLPQALVGRNWKTAREQFRMPLVTECPRLYGAEFYHVHRADLHQIMVRRIPESSVSLSAACASVRNEGGAAVATFEDGSQYEADAIVGCDGVRSIVRRDLFGDEAPRFTGNMCYRAVVPFDAMPSFVSPDSSFWMGPHGHVVTYYVSRGKAVNIVAVNETAEWVEESWNAPSSREELLGAFRGWHPNLMRLFERADTVFKWGLFDRDPMTTWHQGRIALLGDAAHPMLPFLSQGAAMAIEDSWVLATALDAHGADVAAALRDYEAERLPRTSRVQLESRERGRTYHLPSRWEQLKRDVGYWWRGLFNPHAGGIRANWVYEYDATAFRPCTEPQRRAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP021109_10	10.1\|2138869\|25\|NZ_CP021109\|CRISPRCasFinder	2138869-2138893	25	NZ_CP021109.1	567679-567703	0	1.0
NZ_CP021109_10	10.1\|2138869\|25\|NZ_CP021109\|CRISPRCasFinder	2138869-2138893	25	NZ_CP021109.1	4078863-4078887	0	1.0
NZ_CP021109_14	14.1\|3798967\|45\|NZ_CP021109\|CRISPRCasFinder	3798967-3799011	45	NZ_CP021109.1	3798751-3798795	0	1.0
NZ_CP021109_5	5.1\|719156\|28\|NZ_CP021109\|CRISPRCasFinder	719156-719183	28	NZ_CP021109.1	735484-735511	1	0.964
NZ_CP021109_10	10.1\|2138869\|25\|NZ_CP021109\|CRISPRCasFinder	2138869-2138893	25	NZ_CP021109.1	1929361-1929385	1	0.96
NZ_CP021109_5	5.1\|719156\|28\|NZ_CP021109\|CRISPRCasFinder	719156-719183	28	NZ_CP021109.1	1929395-1929422	2	0.929
NZ_CP021109_5	5.1\|719156\|28\|NZ_CP021109\|CRISPRCasFinder	719156-719183	28	NZ_CP021109.1	1929461-1929488	2	0.929
NZ_CP021109_5	5.1\|719156\|28\|NZ_CP021109\|CRISPRCasFinder	719156-719183	28	NZ_CP021109.1	4265701-4265728	2	0.929
NZ_CP021109_10	10.1\|2138869\|25\|NZ_CP021109\|CRISPRCasFinder	2138869-2138893	25	NZ_CP021109.1	1929426-1929450	2	0.92
NZ_CP021109_13	13.1\|3764152\|28\|NZ_CP021109\|CRISPRCasFinder	3764152-3764179	28	NZ_CP021109.1	735539-735566	2	0.929
NZ_CP021109_14	14.1\|3798967\|45\|NZ_CP021109\|CRISPRCasFinder	3798967-3799011	45	NZ_CP021109.1	3798859-3798903	2	0.956
NZ_CP021109_15	15.1\|3915104\|27\|NZ_CP021109\|CRISPRCasFinder	3915104-3915130	27	NZ_CP021109.1	735474-735500	2	0.926

1. spacer 10.1|2138869|25|NZ_CP021109|CRISPRCasFinder matches to position: 567679-567703, mismatch: 0, identity: 1.0

tcgcccccttgagggggaagcgcgg	CRISPR spacer
tcgcccccttgagggggaagcgcgg	Protospacer
*************************

2. spacer 10.1|2138869|25|NZ_CP021109|CRISPRCasFinder matches to position: 4078863-4078887, mismatch: 0, identity: 1.0

tcgcccccttgagggggaagcgcgg	CRISPR spacer
tcgcccccttgagggggaagcgcgg	Protospacer
*************************

3. spacer 14.1|3798967|45|NZ_CP021109|CRISPRCasFinder matches to position: 3798751-3798795, mismatch: 0, identity: 1.0

atccgcggcgccccggtcagcggagcttcttgagtgaggatgggg	CRISPR spacer
atccgcggcgccccggtcagcggagcttcttgagtgaggatgggg	Protospacer
*********************************************

4. spacer 5.1|719156|28|NZ_CP021109|CRISPRCasFinder matches to position: 735484-735511, mismatch: 1, identity: 0.964

gggggtgggctttccctccggtccgcca	CRISPR spacer
gggggtgggctttccccccggtccgcca	Protospacer
****************.***********

5. spacer 10.1|2138869|25|NZ_CP021109|CRISPRCasFinder matches to position: 1929361-1929385, mismatch: 1, identity: 0.96

tcgcccccttgagggggaagcgcgg	CRISPR spacer
tcgccccctcgagggggaagcgcgg	Protospacer
*********.***************

6. spacer 5.1|719156|28|NZ_CP021109|CRISPRCasFinder matches to position: 1929395-1929422, mismatch: 2, identity: 0.929

gggggtgggctttccctccggtccgcca	CRISPR spacer
gggggtgggcttcccttccggtccgcca	Protospacer
************.**.************

7. spacer 5.1|719156|28|NZ_CP021109|CRISPRCasFinder matches to position: 1929461-1929488, mismatch: 2, identity: 0.929

gggggtgggctttccctccggtccgcca	CRISPR spacer
gggggtgggcttcccttccggtccgcca	Protospacer
************.**.************

8. spacer 5.1|719156|28|NZ_CP021109|CRISPRCasFinder matches to position: 4265701-4265728, mismatch: 2, identity: 0.929

gggggtgggctttccctccggtccgcca	CRISPR spacer
gggggtgggctccccctccggtccgcca	Protospacer
***********..***************

9. spacer 10.1|2138869|25|NZ_CP021109|CRISPRCasFinder matches to position: 1929426-1929450, mismatch: 2, identity: 0.92

tcgcccccttgagggggaagcgcgg	CRISPR spacer
tcgccccctcgagcgggaagcgcgg	Protospacer
*********.*** ***********

10. spacer 13.1|3764152|28|NZ_CP021109|CRISPRCasFinder matches to position: 735539-735566, mismatch: 2, identity: 0.929

aaggggaagtccacccccgaagcgctga	CRISPR spacer
aaggggaggcccacccccgaagcgctga	Protospacer
*******.*.******************

11. spacer 14.1|3798967|45|NZ_CP021109|CRISPRCasFinder matches to position: 3798859-3798903, mismatch: 2, identity: 0.956

atccgcggcgccccggtcagcggagcttcttgagtgaggatgggg	CRISPR spacer
atccgcggcgccctggtcagcggagcttctttagtgaggatgggg	Protospacer
*************.***************** *************

12. spacer 15.1|3915104|27|NZ_CP021109|CRISPRCasFinder matches to position: 735474-735500, mismatch: 2, identity: 0.926

gaagcgcttcgggggtgggcctacccc	CRISPR spacer
gaagcgcttcgggggtgggctttcccc	Protospacer
********************.* ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021109_2	2.1\|385435\|25\|NZ_CP021109\|CRISPRCasFinder	385435-385459	25	KF626665	Phage Sano, complete genome	30684-30708	3	0.88
NZ_CP021109_10	10.1\|2138869\|25\|NZ_CP021109\|CRISPRCasFinder	2138869-2138893	25	NC_014754	Sulfuricurvum kujiense DSM 16994 plasmid pSULKU01, complete sequence	72859-72883	4	0.84
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	289849-289877	5	0.828
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	52064-52092	5	0.828
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	119547-119575	5	0.828
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	KX641262	Mycobacterium phage Nazo, complete genome	22996-23026	6	0.806
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NC_023692	Mycobacterium phage BigNuz, complete genome	22996-23026	6	0.806
NZ_CP021109_6	6.1\|1411378\|29\|NZ_CP021109\|CRISPRCasFinder	1411378-1411406	29	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	155868-155896	6	0.793
NZ_CP021109_6	6.1\|1411378\|29\|NZ_CP021109\|CRISPRCasFinder	1411378-1411406	29	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	34761-34789	6	0.793
NZ_CP021109_6	6.1\|1411378\|29\|NZ_CP021109\|CRISPRCasFinder	1411378-1411406	29	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	228547-228575	6	0.793
NZ_CP021109_6	6.1\|1411378\|29\|NZ_CP021109\|CRISPRCasFinder	1411378-1411406	29	NC_023136	Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence	32009-32037	6	0.793
NZ_CP021109_16	16.1\|4233003\|32\|NZ_CP021109\|CRISPRCasFinder	4233003-4233034	32	NZ_CP054030	Rhizobium sp. JKLM19E plasmid pPR19E03	90587-90618	6	0.812
NZ_CP021109_16	16.1\|4233003\|32\|NZ_CP021109\|CRISPRCasFinder	4233003-4233034	32	NZ_CP022670	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence	96748-96779	6	0.812
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1016855-1016883	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	440603-440631	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1018554-1018582	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	208622-208650	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1224210-1224238	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	800030-800058	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	780429-780457	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1419852-1419880	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	348473-348501	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	317587-317615	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	317587-317615	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1617385-1617413	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1653296-1653324	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1683334-1683362	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1729576-1729604	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1858945-1858973	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1334441-1334469	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1614061-1614089	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	226461-226489	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	600632-600660	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1692822-1692850	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1400434-1400462	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1624539-1624567	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1651981-1652009	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1619357-1619385	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1697550-1697578	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1572766-1572794	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1618834-1618862	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1704302-1704330	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1697517-1697545	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1608077-1608105	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1681323-1681351	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1696311-1696339	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1729591-1729619	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1595103-1595131	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1608389-1608417	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1681323-1681351	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1696347-1696375	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1608077-1608105	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1595749-1595777	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1607280-1607308	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1681323-1681351	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1681323-1681351	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1681323-1681351	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1696347-1696375	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1696336-1696364	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1595125-1595153	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1608376-1608404	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1589023-1589051	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1644018-1644046	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1682059-1682087	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1678638-1678666	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1696336-1696364	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1595125-1595153	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1608388-1608416	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1708265-1708293	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1697337-1697365	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1595125-1595153	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1595125-1595153	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1696347-1696375	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1681326-1681354	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1696358-1696386	7	0.759
NZ_CP021109_3	3.1\|567718\|29\|NZ_CP021109\|CRISPRCasFinder	567718-567746	29	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1696159-1696187	7	0.759
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	NZ_CP010990	Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence	34765-34793	7	0.759
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	NZ_CP012186	Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence	155864-155892	7	0.759
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	NC_023136	Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence	32013-32041	7	0.759
NZ_CP021109_12	12.1\|3527523\|30\|NZ_CP021109\|CRISPRCasFinder	3527523-3527552	30	NZ_CP015738	Shinella sp. HZN7 plasmid pShin-02, complete sequence	68829-68858	7	0.767
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	2884-2914	8	0.742
NZ_CP021109_2	2.3\|385543\|34\|NZ_CP021109\|CRISPRCasFinder	385543-385576	34	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	574318-574351	8	0.765
NZ_CP021109_8	8.1\|1597075\|29\|NZ_CP021109\|CRISPRCasFinder	1597075-1597103	29	CP001770	Spirosoma linguale DSM 74 plasmid pSLIN01, complete sequence	31782-31810	8	0.724
NZ_CP021109_11	11.1\|2723872\|32\|NZ_CP021109\|CRISPRCasFinder	2723872-2723903	32	NZ_LN907828	Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence	539729-539760	8	0.75
NZ_CP021109_11	11.1\|2723872\|32\|NZ_CP021109\|CRISPRCasFinder	2723872-2723903	32	NZ_AP017656	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence	275354-275385	8	0.75
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018472	Xanthomonas perforans strain LH3 plasmid pLH3.1, complete sequence	194031-194061	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP023286	Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pCuR, complete sequence	32362-32392	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018859	Xanthomonas citri pv. citri strain LH201 plasmid pLH201.1, complete sequence	24324-24354	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018848	Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.1, complete sequence	66479-66509	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018855	Xanthomonas citri pv. citri strain LH276 plasmid pLH276.1, complete sequence	53464-53494	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018729	Xanthomonas gardneri strain JS749-3 plasmid pJS749-3.1, complete sequence	53631-53661	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018726	Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.1, complete sequence	45419-45449	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018732	Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.1, complete sequence	152553-152583	9	0.71
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NZ_CP018851	Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.1, complete sequence	112757-112787	9	0.71
NZ_CP021109_11	11.1\|2723872\|32\|NZ_CP021109\|CRISPRCasFinder	2723872-2723903	32	NZ_CP032318	Hymenobacter oligotrophus strain sh-6 plasmid unnamed1, complete sequence	11795-11826	9	0.719
NZ_CP021109_12	12.1\|3527523\|30\|NZ_CP021109\|CRISPRCasFinder	3527523-3527552	30	NZ_CP021082	Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence	251498-251527	9	0.7
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	JQ182733	Enterobacterial phage mEp213, complete genome	17961-17991	10	0.677
NZ_CP021109_2	2.2\|385486\|31\|NZ_CP021109\|CRISPRCasFinder	385486-385516	31	NC_019706	Enterobacteria phage mEp043 c-1, complete genome	17961-17991	10	0.677

1. spacer 2.1|385435|25|NZ_CP021109|CRISPRCasFinder matches to KF626665 (Phage Sano, complete genome) position: , mismatch: 3, identity: 0.88

gccgttggaaaacacgtcgacgata	CRISPR spacer
gccgttggtgaacacgtcgacgatc	Protospacer
******** .**************

2. spacer 10.1|2138869|25|NZ_CP021109|CRISPRCasFinder matches to NC_014754 (Sulfuricurvum kujiense DSM 16994 plasmid pSULKU01, complete sequence) position: , mismatch: 4, identity: 0.84

tcgcccccttgagggggaagcgcgg	CRISPR spacer
tctccccctagagggggaagcgctt	Protospacer
** ****** *************

3. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 5, identity: 0.828

gcccttcccctcggctttgccggtccgca-	CRISPR spacer
tcccgtcccctcggcttagccggt-ggcag	Protospacer
 *** ************ ******  ***

4. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 5, identity: 0.828

gcccttcccctcggctttgccggtccgca	CRISPR spacer
ggcgtgcccctcggcttcggcggtccgca	Protospacer
* * * ***********.* *********

5. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 5, identity: 0.828

gcccttcccctcggctttgccggtccgca-	CRISPR spacer
tcccgtcccctcggcttggccggt-ggcag	Protospacer
 *** ************ ******  ***

6. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to KX641262 (Mycobacterium phage Nazo, complete genome) position: , mismatch: 6, identity: 0.806

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
cagcgcaccggcctgatcctgcgaatccaag	Protospacer
 ********* ******** ******* *

7. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NC_023692 (Mycobacterium phage BigNuz, complete genome) position: , mismatch: 6, identity: 0.806

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
cagcgcaccggcctgatcctgcgaatccaag	Protospacer
 ********* ******** ******* *

8. spacer 6.1|1411378|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 6, identity: 0.793

acaccctcggctttgccggtccgcaggcg	CRISPR spacer
ccaccctcggctatgccggtccgcacctc	Protospacer
 *********** ************  .

9. spacer 6.1|1411378|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 6, identity: 0.793

acaccctcggctttgccggtccgcaggcg	CRISPR spacer
ccaccctcggctatgccggtccgcacctc	Protospacer
 *********** ************  .

10. spacer 6.1|1411378|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 6, identity: 0.793

acaccctcggctttgccggtccgcaggcg	CRISPR spacer
gcgctgccggctttgccggtctgcaggcg	Protospacer
.*.*. .**************.*******

11. spacer 6.1|1411378|29|NZ_CP021109|CRISPRCasFinder matches to NC_023136 (Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

acaccctcggctttgccggtccgcaggcg	CRISPR spacer
tcgccttcggctttgccggtccgcaactg	Protospacer
 *.**.*******************. .*

12. spacer 16.1|4233003|32|NZ_CP021109|CRISPRCasFinder matches to NZ_CP054030 (Rhizobium sp. JKLM19E plasmid pPR19E03) position: , mismatch: 6, identity: 0.812

cccttccggtccgcaggcgcgcccccttgagc	CRISPR spacer
cccttccggtccgcaggcgcggcccgtcattc	Protospacer
********************* *** *..  *

13. spacer 16.1|4233003|32|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022670 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence) position: , mismatch: 6, identity: 0.812

cccttccggtccgcaggcgcgcccccttgagc	CRISPR spacer
cccttccggtccgcaggcgcggcccgtcattc	Protospacer
********************* *** *..  *

14. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

15. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

16. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

17. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

18. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

19. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

20. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

21. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

22. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

23. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

24. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

25. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

26. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

27. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

28. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

29. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

30. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

31. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

32. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

33. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

34. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

35. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

36. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

37. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

38. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

39. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

40. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

41. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

42. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

43. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

44. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

45. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

46. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

47. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

48. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

49. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

50. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

51. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

52. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

53. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

54. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

55. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

56. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

57. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

58. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

59. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

60. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

61. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

62. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

63. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

64. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

65. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

66. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

67. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

68. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

69. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

70. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

71. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

72. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

73. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

74. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

75. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

76. spacer 3.1|567718|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.759

gagggaaaggcccacccccgaagcgctga	CRISPR spacer
gccgcaaaggcccacgcccgaagcgcgag	Protospacer
*  * ********** ********** ..

77. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP010990 (Pseudonocardia sp. EC080625-04 plasmid pFRP1-1, complete sequence) position: , mismatch: 7, identity: 0.759

gcccttcccctcggctttgccggtccgca	CRISPR spacer
tcggccaccctcggctatgccggtccgca	Protospacer
 *  .. ********* ************

78. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to NZ_CP012186 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-1, complete sequence) position: , mismatch: 7, identity: 0.759

gcccttcccctcggctttgccggtccgca	CRISPR spacer
tcggccaccctcggctatgccggtccgca	Protospacer
 *  .. ********* ************

79. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to NC_023136 (Leisingera methylohalidivorans DSM 14336 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

gcccttcccctcggctttgccggtccgca	CRISPR spacer
tttatcgccttcggctttgccggtccgca	Protospacer
 .. *. **.*******************

80. spacer 12.1|3527523|30|NZ_CP021109|CRISPRCasFinder matches to NZ_CP015738 (Shinella sp. HZN7 plasmid pShin-02, complete sequence) position: , mismatch: 7, identity: 0.767

gacacacaggcgggagacacacgggcggga	CRISPR spacer
ccgtcgccggcgggagacagacgggcggga	Protospacer
    *.* *********** **********

81. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 8, identity: 0.742

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
caggtagccgctctgatccagcgactcgata	Protospacer
 **   .****.************ *****

82. spacer 2.3|385543|34|NZ_CP021109|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 8, identity: 0.765

gaccccgtcggcggtacgaatggcgccgcgcacg	CRISPR spacer
gtcggcgacggcggtacggatggcgccgcggctg	Protospacer
* *  ** **********.***********  .*

83. spacer 8.1|1597075|29|NZ_CP021109|CRISPRCasFinder matches to CP001770 (Spirosoma linguale DSM 74 plasmid pSLIN01, complete sequence) position: , mismatch: 8, identity: 0.724

gcccttcccctcggctttgccggtccgca	CRISPR spacer
cggcttccaatcggctttgccggtccctt	Protospacer
   *****  **************** .

84. spacer 11.1|2723872|32|NZ_CP021109|CRISPRCasFinder matches to NZ_LN907828 (Erwinia gerundensis isolate E_g_EM595 plasmid pEM01, complete sequence) position: , mismatch: 8, identity: 0.75

tctccccgccggtccgctggcgtcgccccctt	CRISPR spacer
tatcgccgccggtccgctggcctcgcgctggc	Protospacer
* ** **************** **** *.  .

85. spacer 11.1|2723872|32|NZ_CP021109|CRISPRCasFinder matches to NZ_AP017656 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_2, complete sequence) position: , mismatch: 8, identity: 0.75

tctccccgccggtccgctggcgtcgccccctt	CRISPR spacer
accgcgcgcgggtccgctggcgccgccccagt	Protospacer
 *. * *** ************.******  *

86. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018472 (Xanthomonas perforans strain LH3 plasmid pLH3.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

87. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP023286 (Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pCuR, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

88. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018859 (Xanthomonas citri pv. citri strain LH201 plasmid pLH201.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

89. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018848 (Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

90. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018855 (Xanthomonas citri pv. citri strain LH276 plasmid pLH276.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

91. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018729 (Xanthomonas gardneri strain JS749-3 plasmid pJS749-3.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

92. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018726 (Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

93. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018732 (Xanthomonas gardneri strain ICMP 7383 plasmid pICMP7383.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

94. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NZ_CP018851 (Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.1, complete sequence) position: , mismatch: 9, identity: 0.71

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
aagcgcatcgccctgatccagcacgatgtca	Protospacer
*******.**************. . .* .

95. spacer 11.1|2723872|32|NZ_CP021109|CRISPRCasFinder matches to NZ_CP032318 (Hymenobacter oligotrophus strain sh-6 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tctccccgccggtccgctggcgtcgccccctt	CRISPR spacer
ctttcccgccggtccgctggccccgccgtttg	Protospacer
..*.***************** .**** ..*

96. spacer 12.1|3527523|30|NZ_CP021109|CRISPRCasFinder matches to NZ_CP021082 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI1, complete sequence) position: , mismatch: 9, identity: 0.7

gacacacaggcgggagacacacgggcggga	CRISPR spacer
cagtcacaggcgggagacgcacgggaaaag	Protospacer
 *  **************.****** ....

97. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to JQ182733 (Enterobacterial phage mEp213, complete genome) position: , mismatch: 10, identity: 0.677

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
gctgataccgccctgggccagcgaatcgaca	Protospacer
.   ..*********. ************.

98. spacer 2.2|385486|31|NZ_CP021109|CRISPRCasFinder matches to NC_019706 (Enterobacteria phage mEp043 c-1, complete genome) position: , mismatch: 10, identity: 0.677

aagcgcaccgccctgatccagcgaatcgatc	CRISPR spacer
gctgataccgccctgggccagcgaatcgaca	Protospacer
.   ..*********. ************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1197799 : 1245301

uncultured_Mediterranean_phage(12.5%)

tRNA,tail,terminase,head,portal,protease,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086056484.1\|1197799_1199116_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-88	48.7
WP_086071768.1\|1199212_1199533_-	hypothetical protein	NA	NA	NA	NA
WP_086056486.1\|1199963_1200206_+	hypothetical protein	NA	NA	NA	NA
WP_086071769.1\|1200246_1200516_+	hypothetical protein	NA	NA	NA	NA
WP_086071770.1\|1200535_1201414_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_086071771.1\|1201524_1202244_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_086071772.1\|1202382_1203357_-	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_157664808.1\|1203199_1204144_+	UTRA domain-containing protein	NA	NA	NA	NA
WP_157664809.1\|1204158_1205121_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_086056493.1\|1205141_1206050_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_086071774.1\|1206114_1206249_-	DUF2474 domain-containing protein	NA	NA	NA	NA
WP_086071775.1\|1206279_1207287_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_086071776.1\|1207289_1208732_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_086056497.1\|1208867_1209050_-	hypothetical protein	NA	NA	NA	NA
WP_086071777.1\|1209140_1210283_-	acetate/propionate family kinase	NA	NA	NA	NA
WP_086071778.1\|1210334_1212728_-	phosphoketolase family protein	NA	NA	NA	NA
WP_086071779.1\|1212947_1214135_+	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_086071780.1\|1214125_1215913_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	3.5e-30	29.9
WP_086056502.1\|1215914_1216658_-	response regulator transcription factor	NA	NA	NA	NA
WP_157664810.1\|1217183_1217435_+	hypothetical protein	NA	NA	NA	NA
WP_086071782.1\|1217486_1218539_-	aldo/keto reductase	NA	NA	NA	NA
WP_086056505.1\|1218789_1219794_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_086071783.1\|1219810_1220416_-	response regulator transcription factor	NA	NA	NA	NA
WP_086056507.1\|1220423_1221728_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_086071784.1\|1221743_1222595_-	SURF1 family protein	NA	NA	NA	NA
WP_086056509.1\|1222618_1223023_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_086056510.1\|1223019_1223667_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_086071785.1\|1223659_1225669_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_086071786.1\|1225711_1226788_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_086059274.1\|1227032_1228367_+	MFS transporter	NA	NA	NA	NA
WP_086071787.1\|1228720_1230055_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_086071788.1\|1230124_1233328_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_086059275.1\|1233363_1234863_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_086071789.1\|1235091_1236495_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_086056516.1\|1236525_1236861_+	hypothetical protein	NA	NA	NA	NA
WP_086056518.1\|1237676_1237955_+	hypothetical protein	NA	NA	NA	NA
WP_086056519.1\|1238160_1238433_+	hypothetical protein	NA	NA	NA	NA
WP_086071791.1\|1238918_1239200_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_086071792.1\|1239336_1240842_-\|terminase	terminase large subunit	Q9MCV7	Escherichia_phage	2.0e-183	63.1
WP_086071793.1\|1240838_1241303_-	TerS protein	A0A0F7L441	uncultured_marine_virus	2.1e-19	40.9
WP_157664917.1\|1241351_1241753_-	HNH endonuclease	NA	NA	NA	NA
WP_086071794.1\|1241670_1242906_-\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	1.7e-63	38.3
WP_086071795.1\|1242896_1243454_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	7.3e-27	43.2
WP_086071796.1\|1243450_1244038_-\|tail	tail assembly protein	A4JX15	Burkholderia_virus	1.2e-59	64.9
WP_086071797.1\|1244047_1245301_-\|capsid	phage major capsid protein	A0A2I5ARA4	Synechococcus_phage	5.7e-43	34.8

DBSCAN-SWA_2

1849681 : 1912380

Pseudomonas_phage(18.18%)

tRNA,tail,terminase,transposase,head,portal,integrase,protease,capsid

attL 1866083:1866103|attR 1907318:1907338

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086072090.1\|1849681_1852543_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.6e-72	25.4
WP_086057035.1\|1852532_1853501_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_086073567.1\|1853568_1854237_+	phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_086059341.1\|1854274_1855756_+	RsmB/NOP family class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_157664824.1\|1855727_1856180_-	hypothetical protein	NA	NA	NA	NA
WP_086059342.1\|1856428_1857637_+	acyl-CoA desaturase	NA	NA	NA	NA
WP_086072092.1\|1857633_1859922_+	AAA family ATPase	A7KV33	Bacillus_phage	1.4e-111	37.1
WP_086072093.1\|1859940_1861890_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.0e-67	32.8
WP_086059343.1\|1861886_1862783_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_086072094.1\|1862791_1863931_-	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_086057040.1\|1863930_1864752_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_086072095.1\|1864772_1865972_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
1866083:1866103	attL	NA	NA	NA	NA
WP_086072096.1\|1866267_1867257_+\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	1.7e-79	47.3
WP_086073568.1\|1867240_1867450_-	hypothetical protein	NA	NA	NA	NA
WP_086072097.1\|1867571_1867964_-	hypothetical protein	NA	NA	NA	NA
WP_086072098.1\|1867967_1868345_-	hypothetical protein	Q6J1Q1	Burkholderia_virus	2.5e-10	44.0
WP_086072099.1\|1868337_1868574_-	hypothetical protein	NA	NA	NA	NA
WP_086072100.1\|1868573_1868765_-	hypothetical protein	NA	NA	NA	NA
WP_086072101.1\|1868761_1869760_-	hypothetical protein	NA	NA	NA	NA
WP_157664825.1\|1870431_1871001_-	HNH endonuclease	K7PL52	Enterobacteria_phage	4.9e-26	40.4
WP_157664826.1\|1870997_1871297_-	hypothetical protein	NA	NA	NA	NA
WP_086072103.1\|1871390_1871999_-	hypothetical protein	NA	NA	NA	NA
WP_157664827.1\|1872005_1872149_-	hypothetical protein	NA	NA	NA	NA
WP_086072104.1\|1872159_1872663_-	siphovirus Gp157 family protein	A6M981	Geobacillus_virus	5.8e-23	40.9
WP_086072105.1\|1872675_1873293_-	hypothetical protein	NA	NA	NA	NA
WP_086072106.1\|1873295_1873949_-	AAA family ATPase	A0A2D1GLT5	Escherichia_phage	1.8e-64	54.2
WP_086072107.1\|1874176_1874449_-	hypothetical protein	NA	NA	NA	NA
WP_086056564.1\|1874596_1874869_-	hypothetical protein	NA	NA	NA	NA
WP_086072108.1\|1874865_1875078_-	hypothetical protein	NA	NA	NA	NA
WP_086072109.1\|1875091_1875415_-	hypothetical protein	NA	NA	NA	NA
WP_157664828.1\|1875439_1876156_-	hypothetical protein	NA	NA	NA	NA
WP_157664829.1\|1876226_1876490_-	hypothetical protein	NA	NA	NA	NA
WP_086072111.1\|1876734_1877001_+	hypothetical protein	NA	NA	NA	NA
WP_086072112.1\|1877493_1877733_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_086072114.1\|1878230_1878704_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157664830.1\|1879093_1879738_-	hypothetical protein	R9TNM0	Vibrio_phage	4.1e-05	32.5
WP_086072116.1\|1879906_1880131_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_086072117.1\|1880223_1880661_+	hypothetical protein	Q3HQZ3	Burkholderia_phage	1.2e-27	46.6
WP_086072118.1\|1880660_1881134_+	hypothetical protein	NA	NA	NA	NA
WP_086072119.1\|1881130_1881490_+	recombinase	NA	NA	NA	NA
WP_086073569.1\|1881501_1882254_+	helix-turn-helix domain-containing protein	A0A0U4IBP5	Pseudomonas_phage	6.0e-16	50.5
WP_086073570.1\|1882240_1882996_+	DNA replication protein DnaC	A0A059WFK9	Vibrio_phage	4.3e-54	46.9
WP_157664831.1\|1883043_1883343_+	hypothetical protein	NA	NA	NA	NA
WP_086073571.1\|1883360_1883801_+	hypothetical protein	NA	NA	NA	NA
WP_086072121.1\|1883954_1884476_+	hypothetical protein	NA	NA	NA	NA
WP_086072122.1\|1885226_1885406_+	hypothetical protein	NA	NA	NA	NA
WP_086072123.1\|1885796_1886243_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	3.2e-41	60.7
WP_086072124.1\|1886221_1887748_+\|terminase	terminase	B5WZR8	Pseudomonas_phage	2.1e-225	77.5
WP_086072125.1\|1887744_1888980_+\|portal	phage portal protein	A0A2H4PI10	Pseudomonas_phage	9.2e-147	62.1
WP_086072126.1\|1888985_1889843_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	5.3e-85	62.6
WP_086072127.1\|1889849_1891055_+\|capsid	phage major capsid protein	A0A2H4PI18	Pseudomonas_phage	2.7e-143	67.9
WP_086072129.1\|1891268_1891793_+	hypothetical protein	H2BDB2	Pseudomonas_virus	5.3e-51	54.3
WP_086072130.1\|1891789_1892101_+\|head,tail	phage gp6-like head-tail connector protein	H2BDB3	Pseudomonas_virus	4.2e-24	61.3
WP_086072131.1\|1892100_1892457_+\|head,tail	head-tail adaptor protein	Q9XJT0	Pseudomonas_phage	1.1e-31	55.0
WP_086072132.1\|1892453_1893017_+	hypothetical protein	NA	NA	NA	NA
WP_086073572.1\|1893025_1893388_+	DUF3168 domain-containing protein	K7PHI9	Enterobacteria_phage	6.7e-13	33.1
WP_086072133.1\|1893447_1893915_+	hypothetical protein	Q9MCA5	Pseudomonas_phage	1.1e-18	37.9
WP_086072134.1\|1893918_1894296_+	hypothetical protein	NA	NA	NA	NA
WP_086072135.1\|1894313_1894523_+	hypothetical protein	NA	NA	NA	NA
WP_086072136.1\|1894532_1896680_+\|tail	phage tail tape measure protein	B7SYE7	Stenotrophomonas_phage	1.9e-38	43.1
WP_086056599.1\|1896679_1897030_+	hypothetical protein	NA	NA	NA	NA
WP_086072137.1\|1897089_1898223_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	2.1e-121	59.4
WP_086072138.1\|1898348_1898825_+	DUF1833 domain-containing protein	I7GYA2	Xanthomonas_virus	3.1e-10	30.1
WP_086072139.1\|1898901_1899501_+	hypothetical protein	NA	NA	NA	NA
WP_086073573.1\|1899952_1903855_+	hypothetical protein	Q52PQ3	Xanthomonas_phage	2.2e-48	28.5
WP_086072141.1\|1904263_1904500_+	hypothetical protein	NA	NA	NA	NA
WP_157664832.1\|1904855_1905428_+	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_086072143.1\|1905470_1905737_+	hypothetical protein	A5A3W1	Burkholderia_phage	1.5e-09	42.0
WP_086072144.1\|1905733_1905994_+	hypothetical protein	NA	NA	NA	NA
WP_086072145.1\|1905980_1906406_+	glycoside hydrolase family protein	A0A1J0GVQ7	Pseudoalteromonas_phage	4.9e-31	54.5
WP_086072146.1\|1906661_1906916_+	hypothetical protein	I6NLI6	Burkholderia_phage	1.7e-15	53.2
WP_157664833.1\|1907516_1907678_+	hypothetical protein	NA	NA	NA	NA
1907318:1907338	attR	NA	NA	NA	NA
WP_086057113.1\|1907866_1908073_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	9.6e-17	65.2
WP_086057114.1\|1908134_1908662_-	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.7e-20	33.1
WP_086057116.1\|1909017_1910328_+	trigger factor	NA	NA	NA	NA
WP_086057117.1\|1910327_1910984_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.4e-55	56.8
WP_086057118.1\|1911081_1912380_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.4e-131	55.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021109

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection