CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP021133	Pseudomonas fragi strain NMC25 plasmid unnamed1, complete sequence	0 crisprs	NA	0
NZ_CP021135	Pseudomonas fragi strain NMC25 plasmid unnamed3, complete sequence	0 crisprs	NA	0
NZ_CP021134	Pseudomonas fragi strain NMC25 plasmid unnamed2, complete sequence	0 crisprs	PD-DExK	4
NZ_CP021132	Pseudomonas fragi strain NMC25 chromosome, complete genome	3 crisprs	csa3,DEDDh,RT,PD-DExK,DinG,cas3,WYL	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13400

Salmonella_phage(100.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086799812.1\|898_3871_-	conjugative relaxase	NA	NA	NA	NA
WP_086799849.1\|3881_5345_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_048377551.1\|5434_5821_-	hypothetical protein	NA	NA	NA	NA
WP_086799813.1\|6250_6700_+	TraD protein	NA	NA	NA	NA
WP_086799814.1\|6696_7419_+	plasmid stabilization protein	NA	NA	NA	NA
WP_086799815.1\|7424_7814_+	hypothetical protein	NA	NA	NA	NA
WP_086799816.1\|7948_8740_+	SprT-like domain-containing protein	NA	NA	NA	NA
WP_032901700.1\|9440_9662_-	hypothetical protein	NA	NA	NA	NA
WP_001138014.1\|9713_12680_-\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0
WP_001161490.1\|12683_13244_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
WP_001323888.1\|13232_13400_+	hypothetical protein	A0A1B0V7I9	Salmonella_phage	2.3e-24	98.2

DBSCAN-SWA_2

17922 : 32575

Brucella_phage(11.11%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032901694.1\|17922_18225_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.5e-21	53.7
WP_032901693.1\|18221_18515_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	1.2e-12	47.6
WP_086799820.1\|19571_20492_+	DUF2971 domain-containing protein	J9Q7Y9	Salmonella_phage	5.3e-06	29.3
WP_086799821.1\|20681_23804_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	8.0e-62	28.3
WP_086799822.1\|23800_24853_-	DUF1016 family protein	Q9JMP5	Wolbachia_phage	1.1e-103	53.7
WP_086799823.1\|24849_26070_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_086799824.1\|26059_27796_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	6.0e-43	28.3
WP_086799851.1\|27996_28371_+	DUF2513 domain-containing protein	A0A0H4TJ44	Erysipelothrix_phage	1.0e-08	29.6
WP_086799825.1\|28612_29164_-	hypothetical protein	NA	NA	NA	NA
WP_086799826.1\|29695_30319_-	recombinase family protein	NA	NA	NA	NA
WP_086799827.1\|30541_30892_-	ParR	NA	NA	NA	NA
WP_086799828.1\|30888_31797_-	ParB/RepB/Spo0J family partition protein	S5WII0	Leptospira_phage	1.6e-07	30.8
WP_086799829.1\|31807_32575_-	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	9.8e-14	26.2

DBSCAN-SWA_3

48022 : 48790

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009682424.1\|48022_48790_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.8e-22	37.4

DBSCAN-SWA_4

53236 : 53455

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019410174.1\|53236_53455_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	1.0e-08	43.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021132_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021132_1

142796-142879

Orphan

Consensus_repeat	Method
CACCCCCAATCTGCTCCCTCTCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021132_1

>merge|NZ_CP021132|1|142796-142879|CRISPRCasFinder
CACCCCCAATCTGCTCCCTCTCCCAAAGGGAGAGGGACTGACCGCATGCGGTTTCGCGAACACCCCCAATCTGCTCCCTCTCCC

>NZ_CP021132|1|1|142796-142879|CRISPRCasFinder
CACCCCCAATCTGCTCCCTCTCCC	AAAGGGAGAGGGACTGACCGCATGCGGTTTCGCGAA
CACCCCCAATCTGCTCCCTCTCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021132.1\|WP_086795611.1\|139937_140531_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_086795617.1\|151365_153747_+\|penicillin-acylase-family-protein	unknown	unknown	gnl\|CDD\|376618
NZ_CP021132.1\|WP_083369710.1\|138876_139926_-\|COX15/CtaA-family-protein	unknown	unknown	gnl\|CDD\|367131
NZ_CP021132.1\|WP_086795610.1\|137989_138889_-\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|235293
NZ_CP021132.1\|WP_086795612.1\|140505_141243_-\|SURF1-family-protein	unknown	unknown	gnl\|CDD\|119401
NZ_CP021132.1\|WP_016782729.1\|146823_147537_-\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|238449
NZ_CP021132.1\|WP_016782742.1\|134680_135688_+\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236863
NZ_CP021132.1\|WP_016782734.1\|141239_142127_-\|cytochrome-c-oxidase-subunit-3	unknown	unknown	gnl\|CDD\|238834
NZ_CP021132.1\|WP_086795615.1\|147580_148075_-\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|377367
NZ_CP021132.1\|WP_016782727.1\|148071_148707_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|226274
NZ_CP021132.1\|WP_016782725.1\|149690_150632_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_CP021132.1\|WP_016782730.1\|146072_146708_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_016782732.1\|142932_144522_-\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|238833
NZ_CP021132.1\|WP_016782741.1\|135687_136362_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP021132.1\|WP_086795613.1\|142139_142712_-\|cytochrome-c-oxidase-assembly-protein	unknown	unknown	gnl\|CDD\|235341
NZ_CP021132.1\|WP_086795616.1\|148859_149612_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_016782724.1\|150740_151328_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_016782739.1\|137357_137993_-\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266
NZ_CP021132.1\|WP_086795609.1\|136442_137213_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270315
NZ_CP021132.1\|WP_086795614.1\|144604_145729_-\|cytochrome-c-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|224537

Protein	Function_ID	Function_description	E-value
NZ_CP021132.1\|WP_086795617.1\|151365_153747_+\|penicillin-acylase-family-protein	gnl\|CDD\|376618	pfam01804, Penicil_amidase, Penicillin amidase. Penicillin amidase or penicillin acylase EC:3.5.1.11 catalyzes the hydrolysis of benzylpenicillin to phenylacetic acid and 6-aminopenicillanic acid (6-APA) a key intermediate in the the synthesis of penicillins. Also in the family is cephalosporin acylase and aculeacin A acylase which are involved in the synthesis of related peptide antibiotics.	0
NZ_CP021132.1\|WP_083369710.1\|138876_139926_-\|COX15/CtaA-family-protein	gnl\|CDD\|367131	pfam02628, COX15-CtaA, Cytochrome oxidase assembly protein. This is a family of integral membrane proteins. CtaA is required for cytochrome aa3 oxidase assembly in Bacillus subtilis. COX15 is required for cytochrome c oxidase assembly in yeast.	2.85217e-82
NZ_CP021132.1\|WP_086795610.1\|137989_138889_-\|protoheme-IX-farnesyltransferase	gnl\|CDD\|235293	PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional.	8.55342e-147
NZ_CP021132.1\|WP_086795612.1\|140505_141243_-\|SURF1-family-protein	gnl\|CDD\|119401	cd06662, SURF1, SURF1 superfamily. Surf1/Shy1 has been implicated in the posttranslational steps of the biogenesis of the mitochondrially-encoded Cox1 subunit of cytochrome c oxidase (complex IV). Cytochrome c oxidase (complex IV), the terminal electron-transferring complex of the respiratory chain, is an assemblage of nuclear and mitochondrially-encoded subunits. Its assembly is mediated by nuclear encoded assembly factors, one of which is Surf1/Shy1. Mutations in human Surf1 are a major cause of Leigh syndrome, a severe neurodegenerative disorder.	6.76119e-50
NZ_CP021132.1\|WP_016782729.1\|146823_147537_-\|carbonic-anhydrase	gnl\|CDD\|238449	cd00884, beta_CA_cladeB, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	9.36568e-94
NZ_CP021132.1\|WP_016782742.1\|134680_135688_+\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236863	PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional.	0
NZ_CP021132.1\|WP_016782734.1\|141239_142127_-\|cytochrome-c-oxidase-subunit-3	gnl\|CDD\|238834	cd01665, Cyt_c_Oxidase_III, Cytochrome c oxidase subunit III. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. CcO catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, is believed to play a role in assembly of the multimer complex. Rhodobacter CcO subunit III stabilizes the integrity of the binuclear center in subunit I. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit III contains bound phospholipids in several crystal structures and is proposed to contain a "lipid pool." These phospholipids are believed to intrinsic constituents similar to cofactors of the enzyme.	1.8698e-88
NZ_CP021132.1\|WP_086795615.1\|147580_148075_-\|DUF523-domain-containing-protein	gnl\|CDD\|377367	pfam04463, DUF523, Protein of unknown function (DUF523). Family of uncharacterized bacterial proteins.	2.29629e-62
NZ_CP021132.1\|WP_016782725.1\|149690_150632_-\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	7.77625e-47
NZ_CP021132.1\|WP_016782727.1\|148071_148707_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	7.7393e-47
NZ_CP021132.1\|WP_016782732.1\|142932_144522_-\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|238833	cd01663, Cyt_c_Oxidase_I, Cytochrome C oxidase subunit I. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Only subunits I and II are essential for function, but subunit III, which is also conserved, may play a role in assembly or oxygen delivery to the active site. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Subunit I contains a heme-copper binuclear center (the active site where O2 is reduced to water) formed by a high-spin heme (heme a3) and a copper ion (CuB). It also contains a low-spin heme (heme a), believed to participate in the transfer of electrons to the binuclear center. For every reduction of an O2 molecule, eight protons are taken from the inside aqueous compartment and four electrons are taken from cytochrome c on the opposite side of the membrane. The four electrons and four of the protons are used in the reduction of O2; the four remaining protons are pumped across the membrane. This charge separation of four charges contributes to the electrochemical gradient used for ATP synthesis. Two proton channels, the D-pathway and K-pathway, leading to the binuclear center have been identified in subunit I. A well-defined pathway for the transfer of pumped protons beyond the binuclear center has not been identified. Electrons are transferred from cytochrome c (the electron donor) to heme a via the CuA binuclear site in subunit II, and directly from heme a to the binuclear center.	0
NZ_CP021132.1\|WP_086795609.1\|136442_137213_+\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270315	cd13597, PBP2_lipoprotein_Tp32, The substrate-binding domain of the 32-kilodalton lipoprotein (Tp32) from Treponema pallidum binds L-methionine; the type 2 periplasmic-binding protein fold. This group includes the lipoprotein Tp32, a periplasmic component of a methionine uptake transporter system, and its closely related homologs. The Tp32 has both structural and sequential homology to the MetQ family of substrate-binding protein, and thus it belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea.	8.44893e-130
NZ_CP021132.1\|WP_086795613.1\|142139_142712_-\|cytochrome-c-oxidase-assembly-protein	gnl\|CDD\|235341	PRK05089, PRK05089, cytochrome C oxidase assembly protein; Provisional.	2.46045e-98
NZ_CP021132.1\|WP_016782739.1\|137357_137993_-\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	9.90662e-57
NZ_CP021132.1\|WP_016782741.1\|135687_136362_+\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	2.13086e-102
NZ_CP021132.1\|WP_086795614.1\|144604_145729_-\|cytochrome-c-oxidase-subunit-II	gnl\|CDD\|224537	COG1622, CyoA, Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion].	6.59596e-73

>NZ_CP021132.1|WP_086795613.1|142139_142712_-|cytochrome-c-oxidase-assembly-protein
MNNSTPIKRLVLRLSLLVVVMFAFGFALVPIYDVMCKAFGINGKTAGQYEGEQVVDPSRQVRVQFLSTNAIDMVWDFYPKGDQLVVNPGAVNEMVFVAYNPTDHPMSAQAVPSISPAEAAQYFHKTECFCFTQQVLQPGERIEMPMRFIVDRAMPKDVKHLTLAYTLFDITARHPPVAAVSGKDADQPSR
>NZ_CP021132.1|WP_016782734.1|141239_142127_-|cytochrome-c-oxidase-subunit-3
MATHDQYYVPAQSKWPIIATIGLLVTVYGLGTWFNDLKAARPESHGPLIFFVGGLIVAYMMFGWFGAVIKESRAGLYSSQLDRSFRWGMTWFIFSEVMFFLAFFGALFYVRHFAGPWLGGEGSKAVAHMLWPDFQFAWPLLHTPDPALYPPPKGTISPWGLPLLNTVLLVSSSVTLTIAHHALNKGHRGALKFWLGLTVLLGAGFLGFQAEEYVHAYKELGLTLGSGIYGATFFMLTGFHGAHVTIGALILLIMLIRIVRGHFNAEHQFGFQAATWYWHFVDVVWLGLFLFVYVL
>NZ_CP021132.1|WP_086795612.1|140505_141243_-|SURF1-family-protein
MTHFRPGIAPTLTVLALLPLLVFLGFWQLGRAEQKRVLLDNYAERQVAAPVAVGQLLGLADPAFRRVQLRGHFDGQHSLLLDNRVRDGQVGVELLQPVQDQASGQWLLLNRGWLPWPSRRTPPQFSTPGQILDIQAWVYESPGTPFQLHADPLDAPWPRLVTAVMPAKLWAELGREGFADEVRIAPGPAAYQADWPLIATGMGPEKHTAYAVQWFAMALALVGLYLYLGWHTAQEKRHGNGHQSA
>NZ_CP021132.1|WP_086795611.1|139937_140531_-|hypothetical-protein
MGTAINPPDSAPASSPVTRRRGRLQLVLILLLTVGPMVLATGMYKLKFWLPESRSYHGELLGNGQSRAALGVTADEQRWQLLVTAPQACAADCQQLVYLARQLQIGLGRDASRASHALASTQPVDAAYAATLQLEYPQLQRYTLDLPTYTQGAEGNGAAQLWIIDPHGNLVLRYGPGVIGKDVLNDLRLLLKLSNIG
>NZ_CP021132.1|WP_083369710.1|138876_139926_-|COX15/CtaA-family-protein
MAKAGFRLALLATLLALVVVLLGAYTRLTHAGLGCPDWPGCYGFISVPKTEAQLAHAELHFPDTPVEADKGWSEMTHRYFAGTLGLLIVLLAARAWRQRHLPDQPLKLPLFILLVVIAQAAFGMWTVTLKLWPQVVTGHLLGGFATLSLLFLLTLRLSGVLPALAVPRRLQRWATAGLVLAILQIALGGWVSSNYAAVACVDVPTCHGQWWPEADFANGFHLTQHIGPNYLGGQLDSEARTAIHLTHRLGAVLLTGVLLGLAWQLRKVGMTRLAGLLLVALAAQISLGLSNVLLGLPLAVAVAHNAGGAALLLTLVLVNYHTRTALVRVKAPRFARWSFSLKGEQPWRP
>NZ_CP021132.1|WP_086795610.1|137989_138889_-|protoheme-IX-farnesyltransferase
MATVMGEHIQRALWRDYLELTKPKVLVLMLITSLIGMFLATRAGVPWPVLIFGNLGIGLCAGAAAVVNHVVDRRIDAVMARTHKRPLARGRVSPLAALAFALLLALAGMALLLVFTNPLTAWLTLASLLGYAVIYTGFLKRATPQNIVIGGLAGAAPPLLGWVAVTGQVTAEPLLLVLIIFAWTPPHFWALAIYRKEEYAKADIPMLPVTHGEHYTKVHILLYTFVLLAVSLLPFVIHMSGLLYLGCALGLGARFLHWAWVLYRGTQPHAAINTFKYSIYYLFLLFIALLVDHYLMLNL
>NZ_CP021132.1|WP_016782739.1|137357_137993_-|SCO-family-protein
MTKTQKTVFILVALVALVMGLTFNKMMSGKSQGDNTSLIDAGIILLPQSRQLPDVTMTNQDGQPVVMNELKGKWSMLFFGYTFCPDICPTTLAQLRQIKSELPKEVQDKLQIVLVSVDPHRDTPQQLKQYLGYFDPQFVGLTPGSIDELQTLANAVSIPFIPADTSKANYTVDHSGNLALIGPDGTQRGFIRAPFNNQKMVAQLPGLVERK
>NZ_CP021132.1|WP_086795609.1|136442_137213_+|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLFAAVAAVAAFSAHAGDLSVAATPVPHAEILEFVKPALAKEGVNLKVKVFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTHLVSVAAVHLEPLGAYSSKYKKLDEIKDGSTVVIPNDATNGGRALLLLDKAGLITLKDKTNILSTPKDITANPKNLKFRELEAATIPRVLTQVDLALINTNYALEAKLNPEKDALVIEGSDSPYVNILVARPDDKDSADMQKLVAALHTPEVKAFILEKYKGAIVPAF
>NZ_CP021132.1|WP_016782741.1|135687_136362_+|ABC-transporter-permease
METLLSFFSNIDWYEIWLATGDTMVMLGGSLLFTVLLGLPLGILLFLCSPRQLLEQKTLYAALSFIVNILRSLPFIILLVVMIPLTVVITGTSLGVAGAIPPLVVGATPFFARLIETAFREVDRGIIEATQAMGATTRQIITNALLPEARPGIFAAITVTAITLVGYTAMAGVVGAGGLGDLAIRFGYQRFQPDVMIVTVVLLLILVQILQTVGDRLVVHFSRK
>NZ_CP021132.1|WP_016782742.1|134680_135688_+|methionine-ABC-transporter-ATP-binding-protein
MIEFHNVHKTYRVAGKDIPALHSTSLRVESGQVFGLIGHSGAGKSTLLRLINRLETPSGGKIIVDNEDVTAMDANGLRRFRQQVGMIFQHFNLLASKTVADNVAMPLTLAGELSRSAIDKRVAELLERVGLSDHAKKYPAQLSGGQKQRVGIARALATKPKVLLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDEVAVMDAGVIVEQGPVADVFLHPKHPTTKRFVQEDEQIDESEQRDDFAHVPGRIVRLTFQGEATYAPLLGTIARETGVDYSILAGRIDRIKDTPYGQLTLAITGGDMEAAFASFVAADVHMEVLR
>NZ_CP021132.1|WP_016782732.1|142932_144522_-|cytochrome-c-oxidase-subunit-I
MSAVIDDHGHADGQAHGPAKGLMRWVLTTNHKDIGTLYLWFSFCMFLLGGSFAMVIRAELFQPGLQIVAPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLMIGAPDMALPRMNNFSFWLLPAAFLLLVSTLFTAGGGPNFGWTFYAPLSTTYAPESVTYFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFSRKPLFGYTSMVYATASIAFLSFIVWAHHMFVVGIPLVGELFFMYATLLIAVPTGVKVFNWASTMWQGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVPGAIFGIFASTYYWLPKWTGHMYDETLGKLHFWLSFVGMNLTFFPMHFVGLAGMPRRIPDYNLQFADFNMVSSIGGFMFGATQFLFLFIVIKCIRGGPPAPAKPWDGAEGLEWSVPSPAPYHTFTTPPEIK
>NZ_CP021132.1|WP_086795614.1|144604_145729_-|cytochrome-c-oxidase-subunit-II
MRHPHLWMGLLLWSVFGQAQAAWTVNMAPGATEVSHAVFDLHMTIFWICVVIGIIVFGAMFWSMIVHRRSTGQEPARFHESTKVEILWTVIPLVILIAMAVPATRTLIHIYDSSDSDVDIQVTGYQWKWHYKYLGQDVEFFSNLATPADQIHNQAPKGEHYLLEVDEPLVLPIGAKVRFLVTSADVIHSWWVPAFAVKRDAIPGFINEAWTRVEKPGIYRGQCAELCGKDHGFMPIVVDVKTRADYDTWLAERKAQAAQLKELTSKEWTLDELVARGDKVYHTACVACHQAQGQGLPPMFPALKGSPIATGPAADHLHRVFFGKPGTAMAAFGKQLSEVDIAAVVTYERNAWGNNKGDMVTPKDVLALKQAQGK
>NZ_CP021132.1|WP_016782730.1|146072_146708_+|hypothetical-protein
MNTAAIRVQISRAQEHEASTGLLAKHLAAQLPHLHTAIQLPEVDRNVVMTRFVSAYIDQVPDLLDAANEVAREAGIESQITPILKIAEQFFAQPLPLLDGHEGLEGLLDEAYLAHRLVEEVNDLYIKHFQQPLIPLDMTVANLIAHQLIGEDFANQLDAAVHHAVDLMLNEESFALESVEAYRERLTSPETGAAWKRWPCLSKQLGVGLAL
>NZ_CP021132.1|WP_016782729.1|146823_147537_-|carbonic-anhydrase
MTDKPKPQASAAAESADTALHHIVDGFLHFHHEIFPEQEAFFKKLATAQNPRAMFIACADSRIVPELITQSAPGDLFVTRNVGNVVPPYGQMNGGVSTAIEYAVLALGVQHIIICGHSDCGAMRAVLNPASLKKMPTVKAWLHHVEVAKTMVQDNCNCANESESMHVLTEENVIAQLQHLRTHPSVASRMANGHLFIHGWVYDIETSAIKAYDADKGAFLPLDGTSPIPSATPKARF
>NZ_CP021132.1|WP_086795615.1|147580_148075_-|DUF523-domain-containing-protein
MTPKVLVSRCLLGHRVRYDGGASGPYAQLAQWQAEGRVIALCPEVAGGLPTPRAAAEIPGGQGVEVLAGKAAVITTEGEDVTEAFVSGARQALALVERHGIRLAILKANSPSCGNRLTYDGSFSGVKVEGQGVTAALLTRAGVQVFSELELEEAAKALGILTEK
>NZ_CP021132.1|WP_016782727.1|148071_148707_-|2OG-Fe(II)-oxygenase
MRAMHIPSDHPLLLRIVDDLYTQGWSQQTIFLPEALTLELAAECHKRSAEGELTPAAVGRGVTQEVREGIRGDHIQWLEPGEALACDSYLGLMESLRIAMNRRLFLGLEDFESHFALYPPGAFYLKHLDRFRDDDRRMVSAVVYLNQGWLPEHGGHLRMYLDGNVDYDVLPTGGCLVVFLSGEIPHEVMPATRDRLSLTGWFRRRATEVFV
>NZ_CP021132.1|WP_086795616.1|148859_149612_+|hypothetical-protein
MHRLFLLLMMFCTLPAWADNLDDLFTVAGWPQQRAHFNDALSAAQERYRNNLPPAVYQALVNNSNQRFEAAAMDKRARDQMRSNLPDPKPALMFFRSPLGGKIVSAELLATRRDQLAQHAQGLPRMEADATRQLLINHLSRALPAREAGAEVSLAIAGVAADSLSSMIPGLLGGGQAQSMLNSQRQRLMDQIGGELDNTLLYVYRDLSDPELEEFVTFAQSPDGKTYYQAALAAVRAGLAVGQSTANLNP
>NZ_CP021132.1|WP_016782725.1|149690_150632_-|alpha/beta-hydrolase
MPAPFSPDSLRASLQPLAAGQPLSSEALAYQRFYGLDFAQRSPAVKRQLGRFNAGGYEIVSQVWWPDAPPVATLFVIHGFYDHMGLYRHVIEWGLNRGFVVIACDLPGHGLSSGERASIDDFAQYQAVLQGLFIEAQSLQLPQPWHLCGQSTGGAIVLDHLLRYGEQSPAQGKAILLSPLVRPKDWGWSKLSYYLLRPFVKGIARRFSENSNDPAFLPFLQADPLQPLRLPTAWVGALARWIPRIENASPSARQPLVVQGQADKTVDWQHNLEVLKTRFNQPRVLLLPEARHHLANETAAIREQYFGFLDQYL
>NZ_CP021132.1|WP_016782724.1|150740_151328_+|hypothetical-protein
MPLPTPKTLLACLLALICAAGLWAAYDWFQGRYIRAFSEQTAVFAGDILSLPAELSGPGAIRVVHFWDPACPCNVGNQQHLSELLAHYAPQGVEFYSLQKPGSRGQLPATLGAIKPLHSLPGAERLSASPAVAIWDRSGQLAYFGPYSEGATCNASNSFIEPILQALSEGRPVKATHTMAVGCYCAWQDERSARP
>NZ_CP021132.1|WP_086795617.1|151365_153747_+|penicillin-acylase-family-protein
MKRSLTVIAVVVAALAGGGFWYVQSKLPTRQGQVSLATLQGPVTVRYDERGVPHIRAGNQADMYRALGYVQAQDRLFQMEIMRRLARGELAEVLGPKLVDTDKLFRSLRIRERAASYLAELDPQSPAFLALQAYLDGINQYQAHHARPVEFDLLGIKPRPFTAEDTISVAGYMAYSFAAAFRTEPLLTYVRDQLGSDYLKIFDLDWQPQGVLAPALAASDWKTLGALAQLSDQALSQAGLPQFEGSNAWVVSGKRTQSGKPLLAGDPHIRFAVPSVWYEAQLSAPDYDLYGYHQALVPFAFLGNNRDFGWSLTMFQNDDLDLIAEKTNPANPNQVWYHGQWVDMTRSEQQIAVKGEAPVTLTLRQSPHGPIINDVLGATAGNTPIAMWWGFLETKNPILEGFYQLNRADTLSKARTAATFIQAPGLNLVWANAKGDIGWWAAAQLPKRPAGVNPAFILDGSTSQADKDGFYPFSANPQEENPARGYIVSANFQPLSPAGIEIPGYYNLADRGQQLDRQLSDASVKWNLKNSQALQLGTATGYAQRVLKPLLPVLREVVTDPGERKLVEQLAQWKGDYPLDSTAATLFNQFLYSLTEATMRDKLGDSFFDAMLTTRVIDAALPRMAASPDSPWWDNRSTARTETRADTVKVAWQASIAHLKATLGDDPGQWRWGVAHTLTHEHPLGRQKPLDWLLNVGPFAAPGGHEVPNNLSAKLGNAPWPVSYGPSTRRLIDFAEPSHGLTINPVGQSGVPFDKHYRDQAESYIEGDYDKPHMDENEIQLNTRSTLRLVPAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021132_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021132_2

879423-879515

Orphan

Consensus_repeat	Method
GGGAGAGGGGGCTGATCTGTGGAGGTATTGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021132_2

>merge|NZ_CP021132|2|879423-879515|CRISPRCasFinder
GGGAGAGGGGGCTGATCTGTGGAGGTATTGAGACCGCGTGCGGTCAGTTCCCTCTACCGGCGGGAGAGGGGGCTGATCTGTGGAGATATTGAG

>NZ_CP021132|2|2|879423-879515|CRISPRCasFinder
GGGAGAGGGGGCTGATCTGTGGAGGTATTGAG	ACCGCGTGCGGTCAGTTCCCTCTACCGGC
GGGAGAGGGGGCTGATCTGTGGAGATATTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021132.1\|WP_016779483.1\|873639_874356_-\|SIMPL-domain-containing-protein	unknown	unknown	gnl\|CDD\|226002
NZ_CP021132.1\|WP_086795871.1\|882952_883159_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_029611239.1\|884804_885065_+\|DUF2007-domain-containing-protein	unknown	unknown	gnl\|CDD\|378182
NZ_CP021132.1\|WP_016779488.1\|878958_879246_+\|PA4642-family-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_086795872.1\|883337_884504_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|366704
NZ_CP021132.1\|WP_086795866.1\|866329_867925_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP021132.1\|WP_086795870.1\|881917_882151_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_016779491.1\|882307_882892_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367729
NZ_CP021132.1\|WP_016779482.1\|871600_873226_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP021132.1\|WP_086795867.1\|874684_875947_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP021132.1\|WP_086795875.1\|885777_886596_+\|M48-family-metallopeptidase	unknown	unknown	gnl\|CDD\|320690
NZ_CP021132.1\|WP_016779489.1\|879715_881224_-\|malate-dehydrogenase-(quinone)	unknown	unknown	gnl\|CDD\|183983
NZ_CP021132.1\|WP_016779480.1\|868010_869375_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_CP021132.1\|WP_086799543.1\|886701_887286_-\|TMEM165/GDT1-family-protein	unknown	unknown	gnl\|CDD\|225030
NZ_CP021132.1\|WP_086795869.1\|878412_878907_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_086795868.1\|876641_878357_+\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|226646
NZ_CP021132.1\|WP_016779481.1\|869703_871302_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP021132.1\|WP_086795873.1\|884609_884792_+\|CPXCG-motif-containing-cysteine-rich-protein	unknown	unknown	gnl\|CDD\|379524
NZ_CP021132.1\|WP_086795874.1\|885116_885743_+\|SOS-response-associated-peptidase	unknown	unknown	gnl\|CDD\|376837
NZ_CP021132.1\|WP_016779485.1\|875939_876500_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|226933

Protein	Function_ID	Function_description	E-value
NZ_CP021132.1\|WP_016779483.1\|873639_874356_-\|SIMPL-domain-containing-protein	gnl\|CDD\|226002	COG3471, COG3471, Predicted periplasmic/secreted protein [Function unknown].	1.29032e-63
NZ_CP021132.1\|WP_086795872.1\|883337_884504_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|366704	pfam01553, Acyltransferase, Acyltransferase. This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function. This family also includes tafazzin, the Barth syndrome gene.	1.75124e-08
NZ_CP021132.1\|WP_029611239.1\|884804_885065_+\|DUF2007-domain-containing-protein	gnl\|CDD\|378182	pfam09413, DUF2007, Putative prokaryotic signal transducing protein. This is a family of putative prokaryotic signal transducing proteins of Pii-type.	0.00299573
NZ_CP021132.1\|WP_086795866.1\|866329_867925_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021132.1\|WP_016779491.1\|882307_882892_+\|hypothetical-protein	gnl\|CDD\|367729	pfam03923, Lipoprotein_16, Uncharacterized lipoprotein. The function of this presumed lipoprotein is unknown. The family includes E. coli YajG.	1.0096e-08
NZ_CP021132.1\|WP_016779482.1\|871600_873226_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021132.1\|WP_086795867.1\|874684_875947_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.19768e-35
NZ_CP021132.1\|WP_086795875.1\|885777_886596_+\|M48-family-metallopeptidase	gnl\|CDD\|320690	cd07331, M48C_Oma1_like, Peptidase M48C, integral membrane endopeptidase. This subfamily contains peptidase M48C Oma1 (also called mitochondrial metalloendopeptidase OMA1) protease homologs that are mostly uncharacterized. Oma1 is part of the quality control system in the inner membrane of mitochondria, with its catalytic site facing the matrix space. It cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Oma1 can cleave the misfolded multi-pass membrane protein Oxa1, thus exerting a function similar to the ATP-dependent m-AAA protease for quality control of inner membrane proteins; it cleaves a misfolded polytopic membrane protein at multiple sites. It has been proposed that in the absence of m-AAA protease, proteolysis of Oxa1 is mediated by Oma1 in an ATP-independent manner. Oma1 is part of highly conserved mitochondrial metallopeptidases, with homologs present in higher eukaryotes, eubacteria and archaebacteria, all containing the zinc binding motif (HEXXH). It forms a high molecular mass complex in the inner membrane, possibly a homo-hexamer.	4.53677e-81
NZ_CP021132.1\|WP_016779489.1\|879715_881224_-\|malate-dehydrogenase-(quinone)	gnl\|CDD\|183983	PRK13339, PRK13339, malate:quinone oxidoreductase; Reviewed.	0
NZ_CP021132.1\|WP_016779480.1\|868010_869375_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	2.66966e-148
NZ_CP021132.1\|WP_086799543.1\|886701_887286_-\|TMEM165/GDT1-family-protein	gnl\|CDD\|225030	COG2119, COG2119, Predicted membrane protein [Function unknown].	3.39837e-60
NZ_CP021132.1\|WP_086795868.1\|876641_878357_+\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	0
NZ_CP021132.1\|WP_016779481.1\|869703_871302_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP021132.1\|WP_086795873.1\|884609_884792_+\|CPXCG-motif-containing-cysteine-rich-protein	gnl\|CDD\|379524	pfam14255, Cys_rich_CPXG, Cysteine-rich CPXCG. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length. There are 5 conserved cysteines which occur in a CPXCG motif and a DCXXCCXP motif.	1.10686e-19
NZ_CP021132.1\|WP_086795874.1\|885116_885743_+\|SOS-response-associated-peptidase	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	7.37525e-59
NZ_CP021132.1\|WP_016779485.1\|875939_876500_+\|response-regulator-transcription-factor	gnl\|CDD\|226933	COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription].	1.91152e-93

>NZ_CP021132.1|WP_016779488.1|878958_879246_+|PA4642-family-protein
MRKDKKQLIGDEIGDEQIKLFLDFEPVDATSPSLHKLIKAYRGLRIDDFGRFLTFFKEAGYDLDGKDEQGQTFVDIIKDQRNADEYIELIDQARG
>NZ_CP021132.1|WP_086795869.1|878412_878907_+|hypothetical-protein
MSLLFRSAALSLLLASLPLAAAPVATPLLHGQFLPADDLQLRSEVPEQQQLMLVTSYSVVVGSQRQSNQQPIPVTSPLLVRLKGKPMSQGATVRQVLISFDGESKSLKKPVFDSKTRTLSLSYPQSQYRVVIDLLRNDTLYVQFLTYANGHIWADLHTGSVRAR
>NZ_CP021132.1|WP_086795868.1|876641_878357_+|ABC-transporter-ATP-binding-protein/permease
MNQNAEPSVVNDAVRGNFIPRVWRLITPYWRSEERAKAWLLLIAVVALSLFSVGISVWINHWYKDFYNALENKDAKAFWSLIGYFGIIAAAGIVGAVYRLYLTQMLTIRWRRWLTEQHFSRWLALKNYYQLEQGGYTDNPDQRISEDINSFTDSTLTLGLGLIRNVVSLVSFSIILWGVSGSIEVFGITIPGYMFWCALLYAAVGSWLAHLIGRRLIGLSNQQQRFEADLRFSMVRVRENAESIALYNGEANEHERLSTRFNKVWKNFWTQMKVQKRLTFFTAGYSQIAIIFPFVVAAPRYFAGKIELGELMQINSAFSNVQENFSWFIDAYVTLAAWRATCDRLLSFRQAMTDNEQRLPAIDVQHQGEELQIKDLSLDLADGRPLLHGASLQVQDGERLMLSGRSGSGKSTLLRAMGGLWPRGGGAIRLPRERALFLPQKPYLPIGTLRDALSYPQTGETYSNECYEQVLRTCRLEHLISKLDEVNHWQRLLSGGEQQRLAFARALLYRPQWLYMDESTSAMDEEDEAMVYQALIDQLPGLSIISVGHRSSLARFHPQHVRIVEGQLVAQ
>NZ_CP021132.1|WP_016779485.1|875939_876500_+|response-regulator-transcription-factor
MSEEIQVEGEELPHLLLVDDDATFTRVMARAMSRRGFRVSTAGSAEEGLILAQQDLPDFAALDLKMDGDSGLVLLPKLLELDPEMRVVILTGYSSIATAVEAIKRGACNYLCKPADADDVLAALLSQHADLETLVPDNPMSVDRLQWEHIQRVLGEHEGNISATARALGMHRRTLQRKLQKRPVRR
>NZ_CP021132.1|WP_086795867.1|874684_875947_+|HAMP-domain-containing-histidine-kinase
MLAPVQLLSATRQNLWRLTFIRMLVLAAQAGSVGFAYLFNLLPLPWFQLSITLGFSMLLCAFTAIRLRTTWPVTELEYALQLTCDLFIHSALLYFSGGSANPFVSYYLVPLTIAAVTLPWRYSLVLTGIALALYTLLLSQSFPIDTVPFFREKLQIYGMWLSFALSAAVITFFAAKMGEELRRQEELRALRREEGLRDQQLLAVATQAAGAAHELGTPLSTMSVLLKEMRRDHLDPELQDDLSVLQDQVKLCKETLQQLVRAAEANRRLAIEVQDVTQWLDEALNRWHLMRPEATYRFQCLGHAPVPRLAPPPDLTQALLNLLNNAADACPEGLEVTVDWDAVDLTISIRDHGPGVPLAIAEQIGKPFFTTKGKGFGLGLFLSKASVTRAGGSVKLYSHEDGGTLTELRLPRVARGNENE
>NZ_CP021132.1|WP_016779483.1|873639_874356_-|SIMPL-domain-containing-protein
MSNFQRTAALLTLSIGALASLPALADDIHYNQISLRAEASQEVPRDLMIVTLYTEAQNTDAAKLAAEITTAMNKAIGQAKSVKEVTLRQGNRNSYPIYDNKTQKITGWRERAELRLESTDFAALSKLTGDLMQTLKMGSMQFTVANATRKTSEDALLKDAVNAFKARAQLATDALGGKGYKIVNLNLNTNGYPQPYLRSAMMMKAAAPAMDSAPTPEVEAGTSEVSMSADGVIEVQMQ
>NZ_CP021132.1|WP_016779482.1|871600_873226_-|ABC-transporter-substrate-binding-protein
MFKHAVIPFLVGASLLASAPFAHAASNLVFCSEGSPAGFDPGQYTTGTDFDASAETIFNRLSQFERGGTKVEPGLATSWDVSPDNLTWTFHLRDGVKFHTTPYFKPTRDFNADDVLFTFNRMLDKDMPFRKAYPTEFPYFTDMGMDKNIAKVEKIDDKTVKFTLNSVDAAFIQNMAMHFASIQSAEYADKLLKEGKPADINQKPIGTGPFVFKSYQKDSNIRYTGNKDYWKPEDVKIDNLIFAITTDPSVRVQKLKKNECQVTLFPRPADLKALSEDPNLKMPHQAGFNLGYIAYNVMDKIKGSNEPNPMAQLKVRQALDMSVNKQQIIDSVYQGAGQLAVGAMPPTQWSYDTSIKDAPFDPEKAKQLLKEAGVKEGTEIVLWAMPVQRPYNPNAKLMAEMLQSDWSKIGIKAKITSYEWGEYIKRSKGGENGAMLIGWSGDNGDPDNWLGTLFGCDSLEGNNFSKWCDPEFDKLVKAAKATTDIAERTKLYQQAQQRLKSQVPMTPIAHSTVYQPMRKNVEDFKISPFGLNSFYGVSVGK
>NZ_CP021132.1|WP_016779481.1|869703_871302_-|ABC-transporter-substrate-binding-protein
MRNPLVLSVLISAGVLAGSPLASAANSLVFCSEGSPAGFDTAQYTTATDNDASEPIYNRLAEFEKGGTAAIPALATSWDVSEDGLTWTFHLRDGVKFHTTKWFTPTRNFNADDVLFTFNRMLNPEHPFRKAYPTEFPYFTGMSLDKNIASVEKTDPMTVVMKLNTVDAAFIQNLAMSFAAILSAEYADQLLKSGKPSDINQKPVGTGPYVFQRYQKDSNIRYAANKDYWDPSQVKLDNLIFSISVDASARMQKLRKNECQVSLNPRPADVAGLKADPKLQVIEKPGFNLGYIAYNVQHKPFDQLQVRQALDMAVNKDEILKAVYQGAGQKAVNAMPPTQWSYDETITDAAYNPEKAKELLKAAGVKDGTEITLWAMPVQRPYNPNAKLMAEMLQSDWAKIGLKVKIVSYEWGEYIKRTKNGEHDISLIGWTGDNGDPDNWLGTLYSCDAIGGNNYSMWCNKEYDTLVKNAKVVTDRDQRTVLYKQAQQLLKQQVPITPIAHSTVNQPLSAKVEGFTVSPFGRNAFSGVSLKD
>NZ_CP021132.1|WP_016779480.1|868010_869375_-|OprD-family-porin
MKLTSSALLALSISSITAMANADEFMPTELKATSAQSETKGFIEDQTLGGTTRNWYANELRRRDDRFSYNNHGTRESTPRRINWVQGTILNYTSGFTEGTVGFSTQVAAYNAVALDRDAKDIAGPNNRTLTHSDGDAVGQWSKLGLANLSARISNTTLTVGRQNFSSPTIDVIGNRALPSSFQGVGLHSEEFNNLSFDAGSFDRVSPRTESSLSKFRSEYGPSTIETDRASVAGLNYQPLKSLKTTLYATHVEDFWNQYYFGAVHDMGDSATLALNTNFNYYKTLDTGSKALGNINNDAYSLAFALNHQAHTVSLSFQQIVGDEYFDYLHETNGIYLANSLLSDFNGPNEKSLQLAYSINMAQYGIPGLKFNAYHARGWDIDGTKYTGTAYDVKNMDGETHYEYSVGTSYAIQSGPLKATAIRATYTTHRASKNQSDGNINEFRLVTTIPFNIL
>NZ_CP021132.1|WP_086795866.1|866329_867925_-|ABC-transporter-substrate-binding-protein
MKRLPLRTALAAALLSTAVSVSAKNLVVCTEASPEGFDIVQFTTAVTADASAETILNRLADFAPGSTDVEPALAERWDISPDGLEYTFYLRPGVKFHSTDYFKPTRNLNADDVIWSFQRQLDPNHPWHKLSLVGYPYFESMGFKNLLKSVEKVDDMTVKITLNHPEAPFLRDVAMPFNSIYSAEYADQLLKSGKTADLNNKPIGTGPFIFVRYNKDAQVRFKANPDYFRGKPPSDNLIFAIATDSNVRLQKLKANECQIALYPKPDDVKNIRKDPNLKVDELAALMTSYIAMNTSHKYLSDVRVRKAIDMAFDKQTYLNSVHGEGNALLAINPYPPTMLGYNTSIPRPPRDLDKARALLKEAGVPEGTVLTLFTRNGGGPTNPNPMLGAQLLQSDLAQIGLKLDIRVMEWGEMLKRAKNGEHDLVSTGWGGDNGDPDNFLTPMLSCEAAKNGENYARWCNKDFEALITKARGITEPSQRAGLYQQAQVIFNQDQPWINVTHPMLFTAMRKNVEGYTLSPLTNNNFATTQVK
>NZ_CP021132.1|WP_016779489.1|879715_881224_-|malate-dehydrogenase-(quinone)
MAHNEAVDVVLVGAGIMSATLAVLLKELDPGIKLEVVEQMDSGAAESSNPWNNAGTGHAGLCELNYTPQAADGSIDIKKAVHINAQFEVSKQFWAYLAQKGTFGSCKSFISPVPHLSYVEGEKGVSFLKKRFEVLSKHHAFADMEYTEDKARMTEWMPLMMPGRPADQHISATRVEHGTDVNFGALTQQLLKHLASAPDTQIKYSKKVTGLKRNGSGWTVSIKDTNSGNTRHVDAKFVFLGAGGAALPLLQASGIEESKGYGGFPVSGQWLRCDNPEVVKLHQAKVYSQAAVGSPPMSVPHLDTRVVDGKKSLLFGPYAGFTTKFLKHGSFLDLPMSIRLGNIGPMLAVARDNMDLTKYLVSEVRQSMEQRLESLRRFYPQAKAEDWRLEIAGQRVQIIKKDPKKGGVLQFGTELVAAKDGSLAALLGASPGASVTVSIMLDLIERCFAQKATGEWAAKLKEIFPAREKVLETDADLYREISTRNSELLELVAPQSANTSIA
>NZ_CP021132.1|WP_086795870.1|881917_882151_-|hypothetical-protein
MNMLLTLLGLNRPNRCFARLDPAGRCQAFKQCKQPPVGDSWVEIEEIRLIWLHQVLPANARIASPARRSAVQPLLGL
>NZ_CP021132.1|WP_016779491.1|882307_882892_+|hypothetical-protein
MLQRLLFGLITVTSLTLVGCAHSPQQLSPQPKLTTQLAPVGRGQPVVVRVVDGRPSPTLGTRGGMYPETSAISVSSADLIPKLQAQAEAAVRLLGFTPTANAMNAPTLTVTLAELKYQSPKDTMYVTEATIGATFRSDVKNGGRTYSGRYGASLDQRFGMAPNQETNTKLVSDVLSDALTRVFKDPTIGRLLSE
>NZ_CP021132.1|WP_086795871.1|882952_883159_-|hypothetical-protein
MLHSENQDRLYLIAPSDEQQALIEGLAFNVQDRHWLVYCALSGHAHADLPETDLLTGVSRLELYAEAA
>NZ_CP021132.1|WP_086795872.1|883337_884504_-|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MMGQFDSIRPYDDAEVPAVLARLLSDKAFLDILTHFRFPRLAGAFGWLLKPLIAHRLRKEFASVNSVASLQDKVEVYVDRTIEHATDGVTYTGVEQLKSGSAYLFLANHRDIVMDPAFVNYAVYHAGLPTPRIAIGDNLLQKPFVSDLMRLNKSFIVHRSITGRREKLAAYQLLSAYINHSIRNDCQSIWIAQAEGRAKDGDDRTDSAILKMFHMSRKDEPFAEVIQSLNLTPVSISYEYDPCDQAKARELYIRATTGTYSKAPGEDDTSIANGITGYKGRVHVNFAAPVTEPFEDSKLLAAEMDRHILSGYRLFPAHYLAYAQWAEAEPELQVPTAAEVFGAEELAKAQQEWQRRLDACPAEHRPYLVLQYAMPVRNQYRIKAGLPL
>NZ_CP021132.1|WP_086795873.1|884609_884792_+|CPXCG-motif-containing-cysteine-rich-protein
MLETERYECPYCGEPAEAVLDLSGGDQSYIEDCPVCCRPILFHLQTDGHEWMLDVHTENE
>NZ_CP021132.1|WP_029611239.1|884804_885065_+|DUF2007-domain-containing-protein
MQRIYEPENLMEAELLLGMLASEGIAATLQGRDLIGGTGELPALGLLGLAVADDQARCARALIDAYNAATPVAGDEPESVADVLIC
>NZ_CP021132.1|WP_086795874.1|885116_885743_+|SOS-response-associated-peptidase
MCGRFALFRWNPAFAALPGFPADQQAQWNISPNDSVLILRAGAEPGQRELARARWGLTPAWLTDLSRTPAHARAETVVEQPMFRDALRERRCLIPANGFYEWRGTTRKRPYWLTPGEGSSLFFAGIWEAYPVAGHVWLSTAVITQAAASQRRPLILDEAGQQAWLDPQTPLHVLQALLASPQMPLRERPLANLVNDPKLNAPECLTPG
>NZ_CP021132.1|WP_086795875.1|885777_886596_+|M48-family-metallopeptidase
MGKLAVVCAVGAGLLLGGCQAVNTTNGGAVGVERKQYMFSMLSSQQVDQMYAQSYQQTVSEASTKGALDKTSANAKRLQAIANRLIAQAPAFRPDAAQWNWEVNLIKSDELNANCGPGGKIIFYSGIIEQLKLSDDEIAAIMGHEIAHALREHGRESMSKAYGIEIAKQGAGALLGLGQDSLGLADTVVNYSLTLPNSRSNENEADLIGLELAARAGYNPNAAITLWQKMAQQSQNAPPEFMSTHPASSSRIAALQAAIPKVMPLYQQAPKS
>NZ_CP021132.1|WP_086799543.1|886701_887286_-|TMEM165/GDT1-family-protein
MLDSLLVPTAIVALAEIGDKTQLLALILAARFRKPWPIIAGIVVATLANHAAAGAVGAWFSTFFSDAMLHWILAASFTATALWTLVPDKMDDDEASTARKYGPFVTTLITFFIAEIGDKTQVATVMLAAQYPDLWLVIIGTTLGMLIANVPVVLAGNFAADKLPLTLIRRLAATAFVVLAVVAVYKAMQISGWV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021132_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021132_3

4591516-4591599

Orphan

Consensus_repeat	Method
GGGAGAGGGAGCTGATTGGCGGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021132_3

>merge|NZ_CP021132|3|4591516-4591599|CRISPRCasFinder
GGGAGAGGGAGCTGATTGGCGGTGCTCTTGAAATCGCGTGCGGTCAATCCCCTCTCCCTTTGGGAGAGGGGCTGATTGGCGGTG

>NZ_CP021132|3|3|4591516-4591599|CRISPRCasFinder
GGGAGAGGGAGCTGATTGGCGGTG	CTCTTGAAATCGCGTGCGGTCAATCCCCTCTCCCTT
TGGGAGAGGGGCTGATTGGCGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021132.1\|WP_086799168.1\|4599902_4603856_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|236989
NZ_CP021132.1\|WP_086799152.1\|4579444_4580566_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP021132.1\|WP_086799158.1\|4583763_4586706_-\|bifunctional-[glutamate--ammonia-ligase]-adenylyl-L-tyrosine-phosphorylase/[glutamate--ammonia-ligase]-adenylyltransferase	unknown	unknown	gnl\|CDD\|236836
NZ_CP021132.1\|WP_016783245.1\|4587089_4589732_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	unknown	unknown	gnl\|CDD\|236500
NZ_CP021132.1\|WP_086799160.1\|4589743_4591372_+\|dihydrolipoyllysine-residue-acetyltransferase	unknown	unknown	gnl\|CDD\|237000
NZ_CP021132.1\|WP_086799148.1\|4577155_4577908_-\|lipopolysaccharide-kinase	unknown	unknown	gnl\|CDD\|283861
NZ_CP021132.1\|WP_086799167.1\|4593421_4596115_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645
NZ_CP021132.1\|WP_086799156.1\|4582721_4583645_-\|branched-chain-amino-acid-transaminase	unknown	unknown	gnl\|CDD\|235841
NZ_CP021132.1\|WP_016783234.1\|4609986_4611450_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
NZ_CP021132.1\|WP_016783236.1\|4604749_4606492_+\|potassium/proton-antiporter	unknown	unknown	gnl\|CDD\|235410
NZ_CP021132.1\|WP_086799150.1\|4577904_4578639_-\|heptose-kinase	unknown	unknown	gnl\|CDD\|237915
NZ_CP021132.1\|WP_029611699.1\|4580565_4581627_-\|lipopolysaccharide-heptosyltransferase-I	unknown	unknown	gnl\|CDD\|236809
NZ_CP021132.1\|WP_086799165.1\|4591860_4593246_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|277335
NZ_CP021132.1\|WP_016783251.1\|4578638_4579445_-\|lipopolysaccharide-core-heptose(I)-kinase-RfaP	unknown	unknown	gnl\|CDD\|237915
NZ_CP021132.1\|WP_016783240.1\|4596182_4596830_+\|peptide-methionine-(S)-S-oxide-reductase-MsrA	unknown	unknown	gnl\|CDD\|234604
NZ_CP021132.1\|WP_086799170.1\|4603922_4604504_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021132.1\|WP_016783239.1\|4596948_4597785_-\|23S-rRNA-(adenine(2030)-N(6))-methyltransferase-RlmJ	unknown	unknown	gnl\|CDD\|225509
NZ_CP021132.1\|WP_016783238.1\|4597954_4599442_-\|sodium/proline-symporter-PutP	unknown	unknown	gnl\|CDD\|185317
NZ_CP021132.1\|WP_086799154.1\|4581627_4582662_-\|lipopolysaccharide-heptosyltransferase-II	unknown	unknown	gnl\|CDD\|274026
NZ_CP021132.1\|WP_086799172.1\|4606527_4609875_+\|mechanosensitive-channel-MscK	unknown	unknown	gnl\|CDD\|236892

Protein	Function_ID	Function_description	E-value
NZ_CP021132.1\|WP_086799168.1\|4599902_4603856_+\|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase	gnl\|CDD\|236989	PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed.	0
NZ_CP021132.1\|WP_086799152.1\|4579444_4580566_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.69745e-43
NZ_CP021132.1\|WP_086799158.1\|4583763_4586706_-\|bifunctional-[glutamate--ammonia-ligase]-adenylyl-L-tyrosine-phosphorylase/[glutamate--ammonia-ligase]-adenylyltransferase	gnl\|CDD\|236836	PRK11072, PRK11072, bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase.	0
NZ_CP021132.1\|WP_016783245.1\|4587089_4589732_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	gnl\|CDD\|236500	PRK09405, aceE, pyruvate dehydrogenase subunit E1; Reviewed.	0
NZ_CP021132.1\|WP_086799160.1\|4589743_4591372_+\|dihydrolipoyllysine-residue-acetyltransferase	gnl\|CDD\|237000	PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed.	0
NZ_CP021132.1\|WP_086799148.1\|4577155_4577908_-\|lipopolysaccharide-kinase	gnl\|CDD\|283861	pfam06293, Kdo, Lipopolysaccharide kinase (Kdo/WaaP) family. These lipopolysaccharide kinases are related to protein kinases pfam00069. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of S. enterica.	8.46417e-53
NZ_CP021132.1\|WP_086799167.1\|4593421_4596115_+\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	5.70189e-117
NZ_CP021132.1\|WP_086799156.1\|4582721_4583645_-\|branched-chain-amino-acid-transaminase	gnl\|CDD\|235841	PRK06606, PRK06606, branched-chain amino acid transaminase.	0
NZ_CP021132.1\|WP_016783234.1\|4609986_4611450_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
NZ_CP021132.1\|WP_016783236.1\|4604749_4606492_+\|potassium/proton-antiporter	gnl\|CDD\|235410	PRK05326, PRK05326, potassium/proton antiporter.	0
NZ_CP021132.1\|WP_086799150.1\|4577904_4578639_-\|heptose-kinase	gnl\|CDD\|237915	PRK15123, PRK15123, lipopolysaccharide core heptose(I) kinase RfaP; Provisional.	2.75479e-11
NZ_CP021132.1\|WP_029611699.1\|4580565_4581627_-\|lipopolysaccharide-heptosyltransferase-I	gnl\|CDD\|236809	PRK10964, PRK10964, lipopolysaccharide heptosyltransferase RfaC.	1.43273e-158
NZ_CP021132.1\|WP_086799165.1\|4591860_4593246_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|277335	cd07389, MPP_PhoD, Bacillus subtilis PhoD and related proteins, metallophosphatase domain. PhoD (also known as alkaline phosphatase D/APaseD in Bacillus subtilis) is a secreted phosphodiesterase encoded by phoD of the Pho regulon in Bacillus subtilis. PhoD homologs are found in prokaryotes, eukaryotes, and archaea. PhoD contains a twin arginine (RR) motif and is transported by the Tat (Twin-arginine translocation) translocation pathway machinery (TatAyCy). This family also includes the Fusarium oxysporum Fso1 protein. PhoD belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	3.18414e-31
NZ_CP021132.1\|WP_016783251.1\|4578638_4579445_-\|lipopolysaccharide-core-heptose(I)-kinase-RfaP	gnl\|CDD\|237915	PRK15123, PRK15123, lipopolysaccharide core heptose(I) kinase RfaP; Provisional.	0
NZ_CP021132.1\|WP_016783240.1\|4596182_4596830_+\|peptide-methionine-(S)-S-oxide-reductase-MsrA	gnl\|CDD\|234604	PRK00058, PRK00058, peptide-methionine (S)-S-oxide reductase MsrA.	7.56357e-150
NZ_CP021132.1\|WP_016783239.1\|4596948_4597785_-\|23S-rRNA-(adenine(2030)-N(6))-methyltransferase-RlmJ	gnl\|CDD\|225509	COG2961, ComJ, Protein involved in catabolism of external DNA [General function prediction only].	5.41259e-137
NZ_CP021132.1\|WP_016783238.1\|4597954_4599442_-\|sodium/proline-symporter-PutP	gnl\|CDD\|185317	PRK15419, PRK15419, sodium/proline symporter PutP.	0
NZ_CP021132.1\|WP_086799154.1\|4581627_4582662_-\|lipopolysaccharide-heptosyltransferase-II	gnl\|CDD\|274026	TIGR02195, ADP-heptose--LPS_heptosyltransferase_2, lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
NZ_CP021132.1\|WP_086799172.1\|4606527_4609875_+\|mechanosensitive-channel-MscK	gnl\|CDD\|236892	PRK11281, PRK11281, mechanosensitive channel MscK.	0

>NZ_CP021132.1|WP_086799160.1|4589743_4591372_+|dihydrolipoyllysine-residue-acetyltransferase
MSELIRVPDIGSGDGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGIVKSLKIKLGDRLKEGDELLELEAEGAAAAPEAPAPAAAPAVAEKPAAAPAAEAPAAPAAPAAATIQDIHVPDIGSSGKAKIIEILVKAGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLDDEVGTGDFILKLKVQGAAAPAAPAQTAPAPAKAEAPAAAPAPAAKAEAPAPAAAPAPKGGKVHAGPAVRQLAREFGVELSAVSPSGPHGRIIKEDVQAHVKAMMQKAKEAPAAGATGGAGIPPIPAVDFSRFGEVEEVAMTRLMQIGASSLHRSWLNIPHVTQFDQADITELEAFRVAQKAVAEKAGVKLTVLPLLLKSCAHLLKEMPDFNSSLAPSGKAIIRKKYVNIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAAKARDKKLTADDMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTQRLSQLLGDIRTILL
>NZ_CP021132.1|WP_016783245.1|4587089_4589732_+|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type
MQDLDPVETQEWLDALESVLDKEGEDRAHYLMTRMGELATRTGSQLPYAITTPYRNTIPVTHEARMPGDLFMERRIRSLVRWNAMAMVMRTNLKDSDLGGHISSFASSATLYDIGFNYFFQAPTDAHGGDLIYFQGHTSPGVYARAFMEGRISEEQMNNFRQEVDGQGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGYIPAGQKVWCFLGDGECDEPESLGAISLAGRENLDNLIFVINCNLQRLDGPVRGNGKIIQELEGVFRGAQWNVTKVIWGRFWDPLLAKDVDGILQRRMDEVIDGEYQNYKAKDGAFVREHFFNSPELKAMVADLSDDEIWKLNRGGHDPYKVYAAYHEAVNHKDQPTVILAKTIKGYGTGAGEAKNTAHNTKKVDVESLKLFRDRFDIPVKDDEIENLPFFKPEEGSAEARYLSERRAALGGFVPQRRAQSISIPTPPLETLKAILDGSGDREISTTMAFVRILAQLVKDKEIGPRIVPIIPDEARTFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAGAMSSFIAAGTSYSNHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHEDGHSHILAGTIPNCRTFDPTYGYELAVIIQDGMKKMTEEQQDVFYYITVMNESYQQPAMPAGVEEGIVKGMYLLEEDTKEAAHHVQLMGSGTILREVREAAIILREQFNIGADVWSVTSFNELRRDGLAVERHNRLHPGQKPQLSYVEECLTGRKGPVIASTDYMKLFAEQIRQWVPVKEFKVLGTDGFGRSDSRKKLRHFFEVDRHFVVLAALEALADRGDIEPKVVAEAIVKFGINPEKRNPLDC
>NZ_CP021132.1|WP_086799158.1|4583763_4586706_-|bifunctional-[glutamate--ammonia-ligase]-adenylyl-L-tyrosine-phosphorylase/[glutamate--ammonia-ligase]-adenylyltransferase
MSLPSLAPIPALLQPLASRAEQSWRAAVAGLEGGQGLDAWSPERWSAFNRVSAASDFFIEQSLRDPLMLLELARSGELDRSFGPGELCGQIAAAAQAASSDDELGRALRRQRTRQQIRIIWRDLNRQADLIETCRDLSDMADASIDQAYRWLYQRHCQQFGTPVGNRSGEPQEMVILGMGKLGAVELNLSSDIDLIFAYPEGGETVGAKRPLDNQEFFIRLGQRLIKALDPMTVDGFVFRVDMRLRPYGSSGALVLSFNALEQYYQDQGRDWERYAMIKARVVAGDQVMGAQLLSLLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMADNIKLGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLTILEGQGYLPAEVVSELREGYEFLRYTEHAIQAIADRQTQMLPDNQQDQARIAFMMGFDSWAAFHEQLMAWRGRIDWHFRQVIADPDEEEVIDEGELIVGGEWLPLWEEVQDDAAACVQLEEAGFVDAPKALKQLAALRSSPQLRSMQRLGRERLDAFIPRLLAQAVEHANPDLVLERVLPLVEAVARRSAYLVLLTENPDALRRLLTLCAASPWIAEQITRFPLLLDELLNERRLFKPPLAPELAAELRERLTRIPEDDLEQQMEALRNFKLAHRLRVAASEISGSLPLMKVSDYLTWLAEAILEQVLALAWRQTVAKYGTPQRTDGSLCDPGFIIVGYGKVGGIELGHGSDLDLVFIHDGDPNAETDGAKPIDGAQFFTRLGQRIIHLLTAQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQENEAWTWEHQALVRARVLVGCKQVGAAFEQVRASVLGRERDLPTLRQEVSEMRAKMRDNLGTRITAAGTAENAYEATVPFDLKQDAGGIVDIEFMVQYAALAWSREHPALLRYTDNIRILEGLEQVGLMPATDASLLREAYKAFRAVAHRQALQKEAGVVTGDQFVVERQHVRRIWSELGLS
>NZ_CP021132.1|WP_086799156.1|4582721_4583645_-|branched-chain-amino-acid-transaminase
MSMADRDGVIWYDGKLVPWRDATTHVLTHTLHYGMGVFEGVRAYETPQGAAIFRLQAHTDRLFDSAHIMGMKIPFSKDEINEATRIAVRENNLDSAYIRPMVFYGSEAMGLRATGLKVHVIIAPWSWGAYMGAEALEVGIKVRTSSFTRHHVNISMTRAKANGHYINSMLALQEAISGGADEALLLDPEGFVAEGSGENVFLVKDGVIYTPDVTACLNGITRSTILTLATELGYKFVEKRITRDEVYIADEAFFTGTAAEVTPIREVDGRQIGIGRRGPITEKLQKAYFDLVTGKTTDHPEWRTLVK
>NZ_CP021132.1|WP_086799154.1|4581627_4582662_-|lipopolysaccharide-heptosyltransferase-II
MNILIVGPSWVGDMVMAQTLFQCLKQRHPQCEIDVLAPEWSRPILERMPEVRKALSFPLGHGALELATRRKIGKSLKGQYDQAILLPNSLKSALVPFFAGIPTRTGWRGEFRYGLLNDVRKLDKQRYPLMIERFMALAYEPGADLPKPYPRPDLQIDPQSRAGALTKFGLELDRPVLALCPGAEFGESKRWPSEHYAKVAEQKIREGWQVWLFGSKNDHGVGEEIRSRLIPGLREESVNLSGETSLAEAIDLLSCADAVVSNDSGLMHVAAALNRPLVAVYGSTSPGFTPPLADKVEIVRLGLDCSPCFDRTCRFGHYNCLRELMPHLVVEALQRLQGSPVEVN
>NZ_CP021132.1|WP_029611699.1|4580565_4581627_-|lipopolysaccharide-heptosyltransferase-I
MRVLLVKTSSLGDVIHALPALTDAARAIPGITFDWVVEEGFAEIPTWHPAVGKVIPVAIRRWRKNIWQTLKSGEWSRFKQSLRAEKYDLVIDAQGLVKSAWLTRYVKAPVAGLDKDSAREPLASRFYQRRLAVARGQHAVERLRQLFAVALGYDLPKGLGDYGLDVERLVELPRTKPFVLFLHGTTWDTKHWPEVYWRDLAQRMGHLGVEVRLPWGNPAEKARAERIANGLNNAVVLPKLNLAGVAKVLASASACVAVDTGLGHLAAALDVPTISLFGPTNPGLTGAYGKVQIHLASDFPCAPCLQKKCTYTPTAQDQQRFDLKNEWPLCFTRLNPERVASRLSTLLLAEELR
>NZ_CP021132.1|WP_086799152.1|4579444_4580566_-|glycosyltransferase-family-4-protein
MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTMIWEGDIPPGFEVLVAPVKAFHNHTRNEKMLAWMQADLAKRPVDRLIGFNKMPGLDVYYAADGCFEDKAQNLRHSFYRFFKRYKHFAEYERAVFAKDAKTEILMISEVQQPLFIKHYDTPLERFHLLPPGIALDRRAPANAAEIRAEFRREFNLADDDLLLVQIGSGFKTKGVDRSLKALAALPGELKKRTKLFVIGQDDPKVFQLQSATLGLGDHVQFLKGRSDIPRFLLGADLLIHPAYNENTGTVLLEALVAGLPVLVSAVCGYAHYISDADCGRVLDEPFEQAQLNEYLTHMLSDDTARAAWSRNGLAYAQTADLYSMPQHAADVILAEQH
>NZ_CP021132.1|WP_016783251.1|4578638_4579445_-|lipopolysaccharide-core-heptose(I)-kinase-RfaP
MKLILAEPFKSLWAGRDAFAEVERLEGEVYRELEGRRTLRTEVDGRGFFVKIHRGIGWGEVFKNLLTAKLPVLGAGQEWRAIKRLHEVGVPTMTAVAYGEKGSNPAAQHSFIITEELAPTVSLEDFSLNWVKQPPQPRLKHALIAEVARMTGMMHRAGVNHRDCYICHFLLHTDKPVTADNFRLSVIDLHRAQTRAVISKRWRNKDLAALYFSALDIGLTQRDKLRFLRGYFQMPLRQILREEARLLAWLEGKASKLYERKQRYGDAL
>NZ_CP021132.1|WP_086799150.1|4577904_4578639_-|heptose-kinase
MAGWNLDPAYSALASDFGSLEAVFALQGEHLTRDPLSEVIRVQRDGVNYYVKRYTVAGKGLRRYLGRPRVKSEWQNLKRFAKWGIPTAEVVAWGLERSGFAYSRGAMITRELPNTRDLSELADNHDPLLKDRAWVDCVSRQLARYTKTMHDHRFTHNDLKWRNLLIDDQSRLFLIDCPNGDFWRGFWLKYRITKDLACLDKVAKYHLSWTQRLRFYFQYTGRTTLNAADKERVRHIVRFFEGRE
>NZ_CP021132.1|WP_086799148.1|4577155_4577908_-|lipopolysaccharide-kinase
MTDFIAEADRALLERNGLADFDALWAVQLEAVDEPNTSGGGWSSVFRMDLEGRGFYLKRQSNYLTRTLHSPLGEPTFAREFRNIQRYQQMGIPALEAVFFGERKVPGERRAVLLTRALDGWHDLDSLLEQWPQLTPAQQQAIVRECGLLARRVHAARQVHGCFYPKHIFLQADGAGYRAQLIDLEKTRPLLLGQRDRVKDIEPLLRRAHAWGEAEVRALLAAYLDQPMDSGLVDAWLARLNLRRNHKGAR
>NZ_CP021132.1|WP_086799165.1|4591860_4593246_+|alkaline-phosphatase-family-protein
MISPTVGPIVGFTTAQHARIFVRGDSDKNNAVFAGIRHRKAGDSQWSAGVFSRLSPEFDMSDTLVLHNLRSDTLYEYQAGWFATSSPGHTPETVKQIALQWPATVYTFKTDSTARNRTRRYVTGSCRYLRLTAGIPSAAHLGDEIFASIHALARQQGLDAVVMTGDQVYVDDLNIIAPDNDYPAITRKYRAAFSQPNIRSLMARTPTYMILDDHEIEDNWPANRSNGDTALYNNAMRAYEAYQCSHGPAHALQPDGRINRNLSRYWYMFANADIDWFVMDCRTERILAGRDKRMIGVAQEQALLKWLVNSTARVKFIVSSVMFMPDQRRDSDGWKAFTTQRNRILETIRSNAVKNVVFVSGDIHGSLCCQLTHDKSPDFIVHSVVSSPLCNTRLLPYANVGDLLVNTPLTTVGTGTYSLTLNSRVVSEDNFACLTITGQQLKVDFHNKKGRIIETATIALK
>NZ_CP021132.1|WP_086799167.1|4593421_4596115_+|EAL-domain-containing-protein
MKSQPDAAPRLAAEVVTQLPVPSRLGMLRFERLNEASWAMLYLDPHCERQFGMPAADLCALVGSPYASLMEPQARYRLHDAIEQQLRTRHHYVVHYTLHTALGPLNLMELGEAYKQHNRHFLRGYLLAIEDSAASPLPAPVAELETQNSRLQIALALNQRTQADQLQHLERVRAQQDLILRLARHRYSQHNSLQEAAELITRSACDIYQIDGASLWNLEGSQLLPVSAFQREAQAHIAQDTFDASLFPDYLEALHTSRSIDATNASRDPRTRELVASLGRHDANAMLDAGIRIDGQVVGVLCLEQVGRTRAWQADEIAFAGELADQFAQVINNHNRRAATNALHLFQRAVEQSANAFLLVNCDGVVEYANPSFTAITQYTTEEVRGHKLSELPALENLSDLLFDAHSSLSKGNSWQGEFKSRRKNLEPYWGQMSISKVYGDNRELTHYIGIYEDITETKLAQQRIERLAYTDNLTNLGNRPAFIRNLDERFARNSNTPVCLLLVDIDNFKRINDSLGHQTGDKLLISLARRLRNSLSVSDGLARFASNEFAVLLDDTDLATGQQIASQLLMTLDKPMFVDNQLISVTGSVGVACAPLHGRDPQTLMRNAGLALHKAKACGKHQVQVFTEALNAEASYKLFVENNLRRALTQNELEVFYQPKLCLRTGRLLGMEALLRWNHPKNGMIRPDQFISVAEETGLIIPIGKWVARQACRMSRQLSIAGLGNLQVAINVSPKQFSDPDLVASIASILKEEQLPAALLELELTEGLLLEATDDTRLQLDQLKKLGLTLAMDDFGTGYSSLSYLKKFPIDIIKIDRSFIKDIPDNQNDMEITSAVIAMAHNLKLKVVAEGIETAAQLAFLRRHRCDVGQGYLFDRPIPGSELIEKLKRYPRGPLA
>NZ_CP021132.1|WP_016783240.1|4596182_4596830_+|peptide-methionine-(S)-S-oxide-reductase-MsrA
MVLRSEILVNKNVLPTKEQALPGRDTHVQLPETHYVTGQPLLGPFPKNVDFAIFGLGCFWGAERKFWEREGVVSTVVGYAGGYTPNPTYEEVCSGLTGHTEVVLVVYEPEVVSYKQLLAMFWELHNPTQGMRQGNDIGTQYRSVIYCTTPEQLEQALESKKVFQAELDKAGLGTITTEIDQAPTVYFAEAYHQQYLAKNPQGYCGIGGTGVTCPI
>NZ_CP021132.1|WP_016783239.1|4596948_4597785_-|23S-rRNA-(adenine(2030)-N(6))-methyltransferase-RlmJ
MNYRHAFHAGNHADVFKHIVLTRLIALMSRKEQPFAYLDTHAGIGLYDLKGDQANRTGEYLEGIARLWGQKDLPAVTDDYMQVLHKMNPDGELRYYPGSPEWARRLTRSQDRVLLNEKHPEDGVLLKDNMKGDRRVAVHLGEGWHVPRALLPVAEKRGLMLIDPPFEKLDEMKRCAESLKDAISRMRQTVVAIWYPIKDKRQLRRFYQDLAGSGAPKLLQVELFVHPLDTPNSLNGSGLAIANPPWGLEEELRELLPWLAKKLGQTQGGWQMEWLIAE
>NZ_CP021132.1|WP_016783238.1|4597954_4599442_-|sodium/proline-symporter-PutP
MSVSNPTLITFVIYIAAMVLIGLMAYRSTNNLSDYILGGRSLGSVVTALSAGASDMSGWLLMGLPGAIYMSGLSESWIAIGLVTGAYLNWLFVAGRLRVQTEHNGDALTLPDYFSSRFEDNSGLLRIISAIVILVFFTIYCASGIVAGARLFESTFGMSYESALWAGAAATIAYTFIGGFLAVSWTDTVQATLMIFALILTPIIVLLATGGVDTTFLAIEANDPSNFDMLKGTSFIGIISLMGWGLGYFGQPHILARFMAADSVKSIAKARRISMTWMILCLAGTVAVGFFGIAYFSAHPEVAGPVTENPERVFIELAKLLFNPWIAGVLLSAILAAVMSTLSCQLLVCSSALTEDFYKSFLRKNASQLELVWVGRIMVLVVALIAIALASNPENRVLGLVSYAWAGFGAAFGPVVLISVLWKGMTRNGALAGILVGAITVIVWKHFALFGLYEIIPGFILGSLAIVLASLAGKGPTQGMVERFNAAEKDFQQNH
>NZ_CP021132.1|WP_086799168.1|4599902_4603856_+|trifunctional-transcriptional-regulator/proline-dehydrogenase/L-glutamate-gamma-semialdehyde-dehydrogenase
MATTTLGVKLDDPTRERLKAAATSIDRTPHWLIKQAIFNYLEKLEGGATLTELSGIPGTASDDADDVQADHAHQCFLEFAESILPQSVLRAAITSAYRRPEPEVVPMLLEQARLPAPMAEATQTLAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRDALIRDKISTGNWHPHLGNSPSLFVNAATWGLLLTGKLVSTHNEAGLTSSLSRIIGKSGEPMIRKGVDMAMRLMGEQFVTGETIAEALANATRFEAKGFRYSYDMLGEAALTEHDAQKYLASYEQAIHSIGKASHGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPRLLSLTLLAKKYDIGLNIDAEEADRLEISLDLLERLCFEPQLAGWNGIGFVIQAYQKRCPYVIDYVIDLARRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYLACAKKLLAVPEAIYPQFATHNAQTLSAIYHIAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADHTIAIHELVADPVSQIEQMATAEGGFGLPHPRIPLPRDLYGSERANSSGIDMSNEHRLASLSCALLATAHNDWKAAPMLGCDSSSETPAAVLNPADLRDVVGHVQEATVEDADNAIQCALSAAPIWQATPPAERAAILERAADLMEGEIQPLMGLLAREAGKTFANAIAEVREAVDFLRYYAVQARNDFTNDAHRPLGPVVCISPWNFPLAIFSGQVAAALAAGNPVLAKPAEQTPLVAAQAVRILLEAGIPQGVLQLLPGRGETVGARLVGDDRVKGVMFTGSTEVARLLQRNIAGRLDAQGRPIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAESRMGNPERLNVDIGPVIDAEAKAGIEQHIQGMRDKGRTVYQMAIADIEECKRGTFVMPTLIELESFDELEREIFGPVLHVVRYKRKDIDQLIAQINASGYGLTLGVHTRIDETIAKVVNNVNAGNVYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLSTRPGNAIEQSFAKVDAVTAPDTQAREAMSKPLSALQAWASSNQQPALAELCSEYAAHSQSGITRLLNGPTGERNSYAILPREHVLCLAEVESDLLTQLAAVLAVGSSAVLPQSELAKALLARLPKEVQARITLVADWTKDDVIFDAVLHHGDCDQLRDVCQQVAQRAGAIVGVQGLSQGETNIALERLVIERALSVNTAAAGGNASLMTIG
>NZ_CP021132.1|WP_086799170.1|4603922_4604504_-|hypothetical-protein
MNPATEAGNRLSNTPSQCDDQRINLYVVSVSKFLLLYGFTAGGYMVYWSYRNWASYKAVSGASITPGVRGVLWPFFILPLFEVVQNGLDRSGRYYFWQPETRGLVIMGLVMFSVLVNTFFTRPSDEAYVLFANVALIAVCCAMLVAAQRAINTLAGDPQGSLNKALNGINIAWMVVGALLMAAVAYVAFTGQR
>NZ_CP021132.1|WP_016783236.1|4604749_4606492_+|potassium/proton-antiporter
MNATTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMTAGVDGGGIIFDNYPTAYLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATVGVMITTGLTGLMAAWLFNLNLIQGLLVGAIVGSTDAAAVFSLLGGKGLNERVSASLEIESGSNDPMAVFLTVTLIDMLASGETGLHWSLLFNLVREFAIGGAVGLAGGWLMLQMVNRINLANGLYPILVIAGGLVVFSLTNALHGSGFLAVYLCGLVIGNSPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIAIPALALALWMILFARPLSVMVGLLPFKAFHGREKAFISWVGLRGAVPIILAVFPLMAGLPNAQLYFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPDLAPVSRSALEVHVTSEWELFVYRLDAQNWCIGAALRELKMPDGTRIAALFRDKKLLHPSGSTTLEVGDLLCVIGHEHDLPALGKLFSQPPSRGLDLRFFGDFVLEGDAQLGAVAALYGLKLDGINPDTSLSSFIAHKVGGAPVVGDQVEWNNTIWTVAMMEGNKIAKVGVRFPEGSAPGPGLFL
>NZ_CP021132.1|WP_086799172.1|4606527_4609875_+|mechanosensitive-channel-MscK
MPTLRTFIATVLLGLSLCIGTLHAAEPPTAEAVQQSLDKIADRKLPDADQKALQAVLQQTLTLLESKADYEQRLNDVKQQLNDAPRQTGENQRELARLKASTPIPVAQRYKDLSVPQLEQMLAERTTQQGELQKALAIANSQSIAAQTRPERAQAEISNSQTRIQQIGNILKTGRDNGKLLTPDQRNQLNAEAASLTALIALRRQELAGNSLLQDLSGSQHDLLLEKTTRQDQEIQDLQTLINQKRLAQSQQTVTEQSIEAQKSGSSSLLATESAINLKLSDYLLRSTDRLNEVTQQNLETKQQLDNVTQSDQALDEQINVLKGSLLLSKILYKQKQALPRLQKMDKNLADEIADIRLYQFEINQQRELISNPTTYVDNLLSTQPADQVTPQLRKTLIDLVNTRSDLLDRLNRELSSLLNESITLQLNQKQLLSTAQSLRATLDEQMFWIPSNKPLDLEWLETAPRQLEQQVTTLPWGSSVSELAEGLVQRPLLFLPFLLVVVALLWKRRYLYSKLNKIHQDIGHFKRDSQWHTPLAILINILLAMPISLALALCGYALQTDARGMNANTGAALIQMAEAWLVFYTAYRILAPGGVAELHFRWEKPLVAFLQNWIRKLGFVVLALVAVVAFAEQQPAALADDVLGILVVLSCYAAMAWLLCRLLLNDFETATKAYRLRKLLGFAFALLPLALFVAVCFGYYYTALKLSDRLINTLYLLMFWLVVEAAFVRGLAVAARRLAYQRALAKRQAAKEAGEGNDAIIEEPTLDIEQVNQQSLRLIRLALLAGFIGVLYWVWADLISVFAYLDNITLYEYTSGTGANMSMVPISIGDVIGALVIIGISIALARNLPGLLEVLVLSRLDLGQGSAYATTTLLTYVIIGIGFVSTLSTLGVSWDKLQWLVAALSVGLGFGMQEIFANFISGIMILFERPVRIGDTITIGNLSGTVSKIRIRATTITDFDRKDIIVPNKTFITGQLINWSLTDTITRVTLKLGVDYGSDLDLVKHLLLKAAQENPRVLKDPEPHVYFLNFGQSTLDHELRMHVRDLGDRNPVIDEVNRFINREFKNHNINISFQQMEVYLKNLQGQEYKLVPVGPEVPPEPTPPPQKPQLGKLD
>NZ_CP021132.1|WP_016783234.1|4609986_4611450_+|YdiU-family-protein
MKALDELTFDNRFARLGDAFSTHVLPEPIDAPRVVVSSDAAMALLDLDPAVAQDPVFAQLFGGHTLWADAEPRAMVYSGHQFGSYNPQLGDGRGLLLGEVYNDAGEHWDLHLKGAGMTPYSRMGDGRAVLRSSIREFLASEALHALGIPSSRALCVIGSDTPVWRETRERAAMVLRLAPSHVRFGHFEYFYYTKRPEQQKLLGEHVLALHFPECLEQPEPYLAMFREIVERNAALIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDANFICNHSDHEGRYSFSNQVPIGQWNLSALAQALTPFISVEALRETLGLFLPLYQAHYLDLMRRRLGLTSAEDADQQLVETLLQKMQGSNIDYTLFFRRLGDEPAEQAVARLREEFVDLKGFDDWAAQYVARVARDGASDEQARRERMHAVNPLYILRNYLAQKAIDAAEAGDYSEVQRLHTVLTQPFTEQPGMEGYAERPPEWGKHLEISCSS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2892993 : 3020380

137

Pseudomonas_phage(63.24%)

capsid,holin,lysis,tRNA,terminase,plate,portal,protease,integrase,tail,transposase,head

attL 2889035:2889051|attR 3012915:3012979

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2889035:2889051	attL	NA	NA	NA	NA
WP_086796152.1\|2892993_2893857_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	9.0e-40	35.6
2889035:2889051	attL	NA	NA	NA	NA
WP_083369542.1\|2893853_2894147_-\|transposase	transposase	NA	NA	NA	NA
WP_086797532.1\|2894343_2895930_-	fatty acid--CoA ligase family protein	A0A2K9L3I8	Tupanvirus	1.5e-11	28.0
WP_086797534.1\|2895949_2896981_-	ferredoxin--NADP reductase	E3SNZ1	Prochlorococcus_phage	3.9e-05	33.3
WP_086797536.1\|2896982_2897744_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	4.4e-14	32.3
WP_086797538.1\|2897801_2899490_-	FAD-binding protein	NA	NA	NA	NA
WP_016781267.1\|2899486_2901232_-	FAD-binding protein	NA	NA	NA	NA
WP_086797540.1\|2901279_2902467_-	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_086797542.1\|2902628_2904194_-	hypothetical protein	NA	NA	NA	NA
WP_086797544.1\|2904349_2905786_-	coniferyl aldehyde dehydrogenase	NA	NA	NA	NA
WP_016781271.1\|2905959_2906943_+	flavin reductase family protein	NA	NA	NA	NA
WP_016781272.1\|2906956_2907730_+	glucose 1-dehydrogenase	NA	NA	NA	NA
WP_086797546.1\|2907867_2908659_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_016781274.1\|2908680_2909610_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	3.1e-38	37.8
WP_016781275.1\|2909620_2910643_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	4.5e-46	32.8
WP_086797548.1\|2910714_2912028_+	MFS transporter	NA	NA	NA	NA
WP_086797550.1\|2912000_2913083_-	nitronate monooxygenase	NA	NA	NA	NA
WP_086797552.1\|2913306_2914866_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_086797554.1\|2914998_2915712_+	murein L,D-transpeptidase catalytic domain family protein	NA	NA	NA	NA
WP_086797556.1\|2915765_2916614_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_086797558.1\|2917113_2917740_-	hypothetical protein	NA	NA	NA	NA
WP_086797560.1\|2918137_2918425_+	hypothetical protein	NA	NA	NA	NA
WP_086797562.1\|2919468_2919726_+	hypothetical protein	NA	NA	NA	NA
WP_086797564.1\|2919808_2920702_+	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_157665675.1\|2921702_2922119_-	hypothetical protein	NA	NA	NA	NA
WP_157665677.1\|2922188_2922443_-	hypothetical protein	NA	NA	NA	NA
WP_086797568.1\|2922466_2924017_-	hypothetical protein	NA	NA	NA	NA
WP_086797570.1\|2924032_2924986_-	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	1.2e-93	57.2
WP_086797572.1\|2924958_2925669_-	hypothetical protein	A0A2I7RNK1	Vibrio_phage	1.6e-42	42.8
WP_086797574.1\|2925665_2926208_-	DNA-binding protein	A0A0U4J942	Pseudomonas_phage	2.1e-58	65.7
WP_086799633.1\|2926204_2927125_-	hypothetical protein	NA	NA	NA	NA
WP_086797576.1\|2927144_2928755_-\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	2.7e-122	47.4
WP_086797578.1\|2928763_2929354_-\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	1.8e-76	77.0
WP_086797580.1\|2929346_2930522_-\|plate	baseplate J/gp47 family protein	A0A0U4JJ14	Pseudomonas_phage	1.3e-161	72.9
WP_086797582.1\|2930518_2930836_-	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	8.4e-36	76.0
WP_086797583.1\|2930832_2932815_-\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	1.1e-128	39.6
WP_167380457.1\|2932821_2932962_-	hypothetical protein	A0A0U4B0S4	Pseudomonas_phage	4.7e-15	76.1
WP_086797585.1\|2932985_2933273_-\|tail	putative phage tail assembly chaperone	A0A0U4B0P2	Pseudomonas_phage	1.3e-22	58.2
WP_086797587.1\|2933304_2933772_-\|lysis	lysis protein	A0A0U4JXC2	Pseudomonas_phage	1.7e-21	47.6
WP_086797590.1\|2933768_2934296_-	lysozyme	NA	NA	NA	NA
WP_086797592.1\|2934292_2934499_-	hypothetical protein	NA	NA	NA	NA
WP_086797594.1\|2934495_2934708_-	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_086797596.1\|2934707_2935157_-	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	9.4e-57	73.0
WP_086797598.1\|2935163_2936279_-	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	1.4e-141	69.5
WP_086797600.1\|2936290_2936971_-	virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	2.2e-65	61.9
WP_086797602.1\|2936960_2937410_-\|tail	phage tail protein	A0A0U4IBS7	Pseudomonas_phage	2.5e-49	66.7
WP_086797604.1\|2937406_2937868_-\|head	head completion/stabilization protein	A0A0U4J933	Pseudomonas_phage	2.1e-48	64.7
WP_086797606.1\|2937968_2938682_-\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	9.6e-80	67.9
WP_086797608.1\|2938681_2939698_-\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	9.0e-132	72.8
WP_086797610.1\|2939699_2940605_-\|capsid	GPO family capsid scaffolding protein	A0A0U4JVV6	Pseudomonas_phage	2.6e-53	55.7
WP_086797612.1\|2940767_2942831_+\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	2.9e-278	76.2
WP_157665679.1\|2942742_2943600_+\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	8.8e-104	78.8
WP_086797616.1\|2943685_2943937_+	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_086797618.1\|2944016_2944202_-	hypothetical protein	NA	NA	NA	NA
WP_086797621.1\|2944304_2944673_-	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	7.2e-23	50.5
WP_086797623.1\|2944760_2944961_+	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	6.9e-12	55.4
WP_086797625.1\|2944960_2945473_+	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	2.1e-36	51.3
WP_086797627.1\|2945560_2945800_+	hypothetical protein	NA	NA	NA	NA
WP_086797629.1\|2945796_2948490_+	toprim domain-containing protein	A0A2H4J936	uncultured_Caudovirales_phage	4.4e-303	55.9
WP_086797631.1\|2948512_2948806_+	hypothetical protein	NA	NA	NA	NA
WP_086797632.1\|2948873_2949113_+	hypothetical protein	NA	NA	NA	NA
WP_086797634.1\|2949112_2949331_+	Arc family DNA-binding protein	A0A0U4B0M9	Pseudomonas_phage	1.3e-08	46.4
WP_086797636.1\|2949327_2949603_+	pyocin activator PrtN family protein	A0A2K8HN48	Pseudomonas_phage	1.2e-19	56.6
WP_086797638.1\|2949604_2950729_-\|integrase	site-specific integrase	L7TP61	Pseudomonas_virus	3.1e-133	64.1
WP_086797640.1\|2950832_2951843_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_086797642.1\|2951905_2953480_-	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_086799635.1\|2953578_2953854_-	Dabb family protein	NA	NA	NA	NA
WP_086797647.1\|2953963_2955565_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_086797649.1\|2956494_2956977_+	OsmC family protein	NA	NA	NA	NA
WP_086797651.1\|2957182_2958505_-	allantoin permease	NA	NA	NA	NA
WP_086797653.1\|2958534_2959533_-	biotin-dependent carboxyltransferase	NA	NA	NA	NA
WP_086797655.1\|2959529_2960402_-	allophanate hydrolase subunit 1	NA	NA	NA	NA
WP_086797656.1\|2960398_2961772_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_086797658.1\|2961781_2962027_-	biotin carboxyl carrier domain-containing protein	NA	NA	NA	NA
WP_086797660.1\|2962083_2962842_-	5-oxoprolinase subunit PxpA	NA	NA	NA	NA
WP_086797662.1\|2962967_2963885_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_086797665.1\|2964153_2965836_+	hypothetical protein	NA	NA	NA	NA
WP_086797668.1\|2965913_2967038_+	hypothetical protein	NA	NA	NA	NA
WP_167380458.1\|2968854_2970051_+	hypothetical protein	NA	NA	NA	NA
2968101:2968117	attR	NA	NA	NA	NA
WP_016781303.1\|2970444_2970690_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
2968101:2968117	attR	NA	NA	NA	NA
WP_016781304.1\|2970682_2970973_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_086799638.1\|2971786_2972005_+	hypothetical protein	NA	NA	NA	NA
WP_157665681.1\|2972005_2973835_+	NACHT domain-containing protein	NA	NA	NA	NA
WP_157665682.1\|2973901_2974798_+	hypothetical protein	NA	NA	NA	NA
WP_167380475.1\|2974831_2975296_-\|lysis	lysis protein	A0A2H4JBH9	uncultured_Caudovirales_phage	2.1e-51	69.5
WP_086797675.1\|2975346_2975952_-	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	2.6e-62	62.1
WP_086797677.1\|2976009_2976426_-	hypothetical protein	NA	NA	NA	NA
WP_157665683.1\|2976499_2976754_-	hypothetical protein	NA	NA	NA	NA
WP_157665684.1\|2976777_2978490_-	hypothetical protein	A0A0H5ARL8	Pseudomonas_phage	5.6e-17	39.4
WP_086797681.1\|2978673_2979138_-	hypothetical protein	B5WZT5	Pseudomonas_phage	1.4e-47	63.0
WP_086797684.1\|2979166_2982196_-	hypothetical protein	A0A0H5ART3	Pseudomonas_phage	3.9e-255	45.3
WP_086797686.1\|2982173_2982572_-	hypothetical protein	A0A0H5AUG1	Pseudomonas_phage	8.3e-33	51.1
WP_086797688.1\|2982584_2983067_-	DUF1833 family protein	B5WZT6	Pseudomonas_phage	6.3e-43	55.6
WP_086797690.1\|2983063_2986657_-	tape measure protein	A0A125RNI9	Pseudomonas_phage	5.4e-62	33.6
WP_086797692.1\|2986744_2987164_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_086797694.1\|2987232_2987490_-	hypothetical protein	A0A286S1P2	Klebsiella_phage	3.2e-09	42.5
WP_086797696.1\|2987519_2987870_-\|tail	phage tail assembly chaperone family protein, TAC	NA	NA	NA	NA
WP_086797698.1\|2987879_2988371_-\|tail	phage tail protein	A0A0U4ISC1	Pseudomonas_phage	4.2e-50	59.9
WP_086799640.1\|2988792_2989266_-	HK97 gp10 family phage protein	A0A2H4JB20	uncultured_Caudovirales_phage	1.2e-30	50.0
WP_086797700.1\|2989258_2989594_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	1.3e-26	58.6
WP_086797702.1\|2989590_2989908_-\|head,tail	phage gp6-like head-tail connector protein	A0A2D1GNK0	Pseudomonas_phage	4.1e-43	76.2
WP_086797704.1\|2989900_2990326_-	hypothetical protein	A0A2D1GNQ9	Pseudomonas_phage	4.9e-47	68.8
WP_086797706.1\|2990368_2991574_-\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	7.5e-218	94.5
WP_086797708.1\|2991583_2992237_-\|head,protease	HK97 family phage prohead protease	A0A2D1GNL2	Pseudomonas_phage	3.7e-110	89.5
WP_086797710.1\|2992214_2993426_-\|portal	phage portal protein	A0A2D1GNU4	Pseudomonas_phage	8.3e-209	87.3
WP_086797714.1\|2993613_2995293_-\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	9.8e-216	65.4
WP_086797716.1\|2995293_2995788_-\|terminase	terminase small subunit	Q3HQS6	Burkholderia_phage	1.8e-24	54.5
WP_086797718.1\|2996030_2996360_-	HNH endonuclease	B5WZZ4	Pseudomonas_phage	1.4e-25	52.8
WP_086797720.1\|2996356_2996554_-	hypothetical protein	NA	NA	NA	NA
WP_019829116.1\|2996614_2996944_-\|holin	phage holin, lambda family	A0A2D1GNJ3	Pseudomonas_phage	3.1e-33	62.0
WP_150628245.1\|2997088_2997511_-	hypothetical protein	NA	NA	NA	NA
WP_086799643.1\|2997732_2998113_-	antitermination protein Q	A0A1W6JTD2	Pseudomonas_phage	4.1e-37	55.2
WP_086797722.1\|2998118_2999414_-\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	9.7e-131	55.3
WP_086797724.1\|2999410_2999620_-	hypothetical protein	NA	NA	NA	NA
WP_086797726.1\|2999612_3000308_-	Replication protein P	B5WZY0	Pseudomonas_phage	1.0e-46	49.5
WP_086797728.1\|3000304_3001078_-	hypothetical protein	A0A2D1GNQ6	Pseudomonas_phage	2.0e-22	48.6
WP_086797730.1\|3001311_3001533_-	helix-turn-helix domain-containing protein	A0A2D1GND2	Pseudomonas_phage	2.0e-20	60.3
WP_086797732.1\|3001629_3002385_+	LexA family transcriptional regulator	A0A2D1GNH0	Pseudomonas_phage	4.3e-46	41.3
WP_086797734.1\|3002410_3003499_+	type I restriction enzyme HsdR N-terminal domain-containing protein	A0A1S5SAB0	Streptococcus_phage	1.1e-66	42.3
WP_086797736.1\|3003917_3004301_+	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	3.7e-14	60.0
WP_086797738.1\|3004696_3005044_+	hypothetical protein	NA	NA	NA	NA
WP_086797740.1\|3005151_3005355_-	hypothetical protein	NA	NA	NA	NA
WP_086799645.1\|3005470_3005722_+	hypothetical protein	NA	NA	NA	NA
WP_157665685.1\|3005788_3006436_-	hypothetical protein	NA	NA	NA	NA
WP_086797744.1\|3006486_3008535_+	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	1.6e-207	55.0
WP_086797746.1\|3008647_3009313_-	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_157665686.1\|3009297_3009705_-	hypothetical protein	NA	NA	NA	NA
WP_086797748.1\|3009854_3010418_-	hypothetical protein	NA	NA	NA	NA
WP_086797750.1\|3011666_3012851_+\|integrase	tyrosine-type recombinase/integrase	A0A059VF45	Pseudomonas_phage	1.7e-206	88.3
WP_016781403.1\|3013091_3013448_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_002553164.1\|3013428_3013731_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.8e-11	38.9
WP_086797752.1\|3013734_3016113_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_016781405.1\|3016139_3017156_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	3.8e-29	39.8
WP_003442184.1\|3017265_3017622_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_002553160.1\|3017651_3017846_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_016781406.1\|3017906_3018440_-	translation initiation factor IF-3	NA	NA	NA	NA
WP_016781407.1\|3018457_3020380_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	8.8e-128	37.9

DBSCAN-SWA_2

3068487 : 3072838

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086797798.1\|3068487_3069159_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	4.9e-110	95.1
WP_016781463.1\|3069552_3069945_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.6e-65	94.6
WP_086797800.1\|3069946_3070309_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.6e-49	80.8
WP_016781465.1\|3070308_3070593_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	6.8e-37	78.8
WP_016781466.1\|3070589_3070925_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	3.4e-51	91.0
WP_016781468.1\|3071942_3072170_+	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	7.1e-37	100.0
WP_086797802.1\|3072166_3072370_-	carbon storage regulator CsrA	A0A2H4J8C6	uncultured_Caudovirales_phage	4.3e-17	62.7
WP_016781470.1\|3072505_3072838_-	YnfA family protein	A0A2H4JF35	uncultured_Caudovirales_phage	4.8e-50	87.3

DBSCAN-SWA_3

3372241 : 3410217

Bacillus_virus(22.22%)

coat,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086798103.1\|3372241_3373204_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_086799661.1\|3373200_3375522_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_086798105.1\|3375666_3376446_-	molecular chaperone	NA	NA	NA	NA
WP_086798108.1\|3376470_3376965_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_016782342.1\|3376969_3377503_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_016782341.1\|3377521_3378058_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_016782340.1\|3378074_3378605_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_086798110.1\|3378799_3380110_+	protein kinase	NA	NA	NA	NA
WP_086798112.1\|3380196_3380901_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_086798114.1\|3381008_3382400_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_086798116.1\|3382415_3383741_-	MFS transporter	NA	NA	NA	NA
WP_086798118.1\|3384031_3384901_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_086798120.1\|3385105_3385963_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_086798122.1\|3386078_3387188_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_016782332.1\|3387260_3388088_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_016782331.1\|3388145_3388694_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	4.1e-14	34.1
WP_029611585.1\|3388890_3389112_+	hypothetical protein	NA	NA	NA	NA
WP_016782329.1\|3389198_3390110_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_016782328.1\|3390152_3390728_-	GNAT family N-acetyltransferase	E4ZFP7	Streptococcus_phage	1.4e-20	39.6
WP_083369580.1\|3390819_3391578_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.2e-35	37.6
WP_016782326.1\|3391570_3392023_-	ribonuclease HI	J9Q745	Salmonella_phage	3.0e-39	54.8
WP_016782325.1\|3392109_3392868_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_086798124.1\|3392977_3393757_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_016782323.1\|3393855_3395256_+	transglycosylase SLT domain-containing protein	U5PW24	Bacillus_virus	3.1e-05	30.4
WP_086798125.1\|3395409_3397242_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_086798127.1\|3397238_3399080_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016782320.1\|3399080_3400154_+	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_016782319.1\|3400155_3401175_+	ABC transporter permease	NA	NA	NA	NA
WP_086798129.1\|3401176_3402787_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-17	32.9
WP_016782317.1\|3402806_3403601_+	enoyl-ACP reductase	NA	NA	NA	NA
WP_086798131.1\|3403855_3405727_-	SurA N-terminal domain-containing protein	NA	NA	NA	NA
WP_016782315.1\|3405956_3406229_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	3.6e-19	57.3
WP_016782314.1\|3406373_3408770_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.2e-221	52.2
WP_016782313.1\|3408933_3410217_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	6.2e-138	58.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021134

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection