CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP021367	Acidovorax carolinensis strain P4 plasmid pACP4.1, complete sequence	0 crisprs	c2c9_V-U4,DEDDh	2
NZ_CP021369	Acidovorax carolinensis strain P4 plasmid pACP4.3, complete sequence	0 crisprs	NA	0
NZ_CP021368	Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence	0 crisprs	NA	1
NZ_CP021370	Acidovorax carolinensis strain P4 plasmid pACP4.4, complete sequence	0 crisprs	cas4	0
NZ_CP021366	Acidovorax carolinensis strain P4 chromosome, complete genome	1 crisprs	DEDDh,csa3,DinG,Cas9_archaeal,cas3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5494 : 68776

uncultured_virus(15.38%)

transposase,integrase

attL 30538:30552|attR 51125:51139

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086911015.1\|5494_6760_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.1e-41	42.2
WP_157896772.1\|6787_7285_-	hypothetical protein	NA	NA	NA	NA
WP_086928893.1\|7343_8066_-	hypothetical protein	NA	NA	NA	NA
WP_157896773.1\|8144_8591_-	hypothetical protein	NA	NA	NA	NA
WP_086928895.1\|8792_9791_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_086914293.1\|9978_11391_-	hypothetical protein	NA	NA	NA	NA
WP_086928896.1\|12024_13437_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_086914300.1\|13557_13953_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_086914299.1\|13949_15113_+	2-methylcitrate synthase	NA	NA	NA	NA
WP_086914306.1\|15133_17761_+	Fe/S-dependent 2-methylisocitrate dehydratase AcnD	NA	NA	NA	NA
WP_086914298.1\|17784_18978_+	2-methylaconitate cis-trans isomerase PrpF	NA	NA	NA	NA
WP_086914297.1\|18992_19853_+	isocitrate lyase/PEP mutase family protein	NA	NA	NA	NA
WP_086914296.1\|19893_20811_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_086914295.1\|20934_21516_+	FMN reductase	NA	NA	NA	NA
WP_086914294.1\|21560_22544_+	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_086914305.1\|22686_23685_+	methionine synthase	NA	NA	NA	NA
WP_024815598.1\|23879_26984_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	1.2e-70	31.1
WP_024815599.1\|27079_28489_-	hypothetical protein	NA	NA	NA	NA
WP_157896633.1\|28485_29562_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_086914290.1\|29788_31339_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	6.8e-46	29.6
30538:30552	attL	NA	NA	NA	NA
WP_008904946.1\|31933_32173_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_024815603.1\|32813_33260_-	hypothetical protein	NA	NA	NA	NA
WP_008905898.1\|33312_33570_-	hypothetical protein	NA	NA	NA	NA
WP_081739433.1\|33651_34446_-	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	3.2e-23	34.2
WP_024815572.1\|34519_35161_-	SOS response-associated peptidase	A0A218MNF5	uncultured_virus	1.3e-40	41.3
WP_024815573.1\|35394_35844_+	hypothetical protein	F1C5A6	Cronobacter_phage	4.4e-14	40.8
WP_086914288.1\|36015_36522_+	micrococcal nuclease	A0A0R6PHV6	Moraxella_phage	3.0e-27	46.2
WP_086914303.1\|36757_37672_+	hypothetical protein	NA	NA	NA	NA
WP_086914287.1\|37668_38520_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_008906444.1\|38885_39632_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_008906445.1\|39621_39972_-	hypothetical protein	NA	NA	NA	NA
WP_086914286.1\|39968_40988_-	precorrin-3B C(17)-methyltransferase	NA	NA	NA	NA
WP_024814081.1\|41031_42156_-	5,6-dimethylbenzimidazole synthase	NA	NA	NA	NA
WP_086914302.1\|42152_42920_-	cobalamin biosynthesis protein CbiG	NA	NA	NA	NA
WP_008906449.1\|42928_43747_-	precorrin-2 C(20)-methyltransferase	NA	NA	NA	NA
WP_008906450.1\|43739_45095_-	bifunctional cobalt-precorrin-7 (C(5))-methyltransferase/cobalt-precorrin-6B (C(15))-methyltransferase	NA	NA	NA	NA
WP_008906451.1\|45091_46291_-	cobalt-precorrin-5B (C(1))-methyltransferase	NA	NA	NA	NA
WP_024814083.1\|46291_46972_-	precorrin-8X methylmutase	NA	NA	NA	NA
WP_008906453.1\|46968_47859_-	sirohydrochlorin chelatase	NA	NA	NA	NA
WP_008906454.1\|47855_48638_-	precorrin-4 C(11)-methyltransferase	NA	NA	NA	NA
WP_008906455.1\|48651_49329_-	cobalt transporter	NA	NA	NA	NA
WP_024814084.1\|50094_50718_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SFD7	Streptococcus_phage	1.3e-11	31.0
WP_086914285.1\|50832_51807_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.6e-80	49.4
51125:51139	attR	NA	NA	NA	NA
WP_157896632.1\|52145_52364_-	hypothetical protein	NA	NA	NA	NA
WP_086914283.1\|52519_53653_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_086914282.1\|53654_56759_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-79	24.3
WP_086914281.1\|56751_57054_+	DUF3240 family protein	NA	NA	NA	NA
WP_086914280.1\|57050_58298_+	TolC family protein	NA	NA	NA	NA
WP_086914279.1\|58378_58648_+	flagellar biosynthesis protein FliQ	NA	NA	NA	NA
WP_008903077.1\|59419_60208_+	UPF0149 family protein	NA	NA	NA	NA
WP_082759088.1\|60241_61837_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.5e-77	36.9
WP_008903079.1\|61938_62289_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_008903080.1\|62264_62708_-\|transposase	transposase	NA	NA	NA	NA
WP_086914278.1\|63535_64351_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	3.7e-19	33.7
WP_056057356.1\|64421_64733_+	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	4.4e-13	44.9
WP_086914277.1\|64881_65343_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_086914276.1\|65385_65622_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_086914275.1\|66272_66641_-	hypothetical protein	NA	NA	NA	NA
WP_063462293.1\|67690_68776_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

75427 : 100936

Burkholderia_phage(13.33%)

integrase,transposase

attL 77090:77103|attR 85685:85698

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086928898.1\|75427_76855_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_157896775.1\|76996_78227_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	1.4e-131	82.1
77090:77103	attL	NA	NA	NA	NA
WP_157896776.1\|78203_78701_-	hypothetical protein	NA	NA	NA	NA
WP_086914301.1\|78678_79335_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_086928900.1\|79428_80382_-	hypothetical protein	H9C0T9	Aeromonas_phage	1.3e-10	42.1
WP_157896777.1\|80637_82110_-	hypothetical protein	NA	NA	NA	NA
WP_157896778.1\|82424_82955_+	AAA family ATPase	A0A2R3UAQ8	Siphoviridae_environmental_samples	7.2e-16	41.1
WP_086928903.1\|83247_83892_+	hypothetical protein	NA	NA	NA	NA
WP_086928904.1\|84034_84550_+	NADAR family protein	A0A1S6UAJ7	Serratia_phage	3.4e-34	48.0
WP_086928905.1\|84739_85420_+\|integrase	site-specific integrase	A0A1W6DWU1	Sphingobium_phage	9.6e-13	28.6
WP_066695292.1\|85495_85738_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
85685:85698	attR	NA	NA	NA	NA
WP_003049909.1\|85734_86130_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_157896779.1\|86147_86306_+	hypothetical protein	NA	NA	NA	NA
WP_162290882.1\|86313_86622_+	hypothetical protein	NA	NA	NA	NA
WP_086928906.1\|86638_86842_+	hypothetical protein	NA	NA	NA	NA
WP_157896781.1\|86857_87043_+	hypothetical protein	NA	NA	NA	NA
WP_094122719.1\|87054_87297_+	hypothetical protein	NA	NA	NA	NA
WP_157896782.1\|87311_87479_+	hypothetical protein	NA	NA	NA	NA
WP_060983853.1\|87703_88468_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	7.7e-27	31.5
WP_087743140.1\|88464_90105_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	5.9e-16	26.5
WP_086928908.1\|90271_90709_+	HD domain-containing protein	A0A2D1A475	Rhodococcus_phage	1.5e-22	49.2
WP_086928909.1\|90721_90976_+	hypothetical protein	NA	NA	NA	NA
WP_157896783.1\|91048_91309_-	hypothetical protein	NA	NA	NA	NA
WP_157896784.1\|91490_91991_-	hypothetical protein	NA	NA	NA	NA
WP_086914285.1\|92065_93040_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.6e-80	49.4
WP_157896785.1\|93221_93359_-	hypothetical protein	NA	NA	NA	NA
WP_086928912.1\|93430_93727_-	hypothetical protein	NA	NA	NA	NA
WP_157896786.1\|93743_94085_-	hypothetical protein	NA	NA	NA	NA
WP_086928914.1\|94124_94355_-	hypothetical protein	W8VUQ4	Pseudomonas_phage	8.3e-09	45.9
WP_157896787.1\|94351_94753_-	hypothetical protein	NA	NA	NA	NA
WP_086928916.1\|95176_96424_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1B0VCD8	Salmonella_phage	4.1e-110	51.8
WP_086929057.1\|96448_96868_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.0e-37	55.9
WP_157896788.1\|97128_97293_-	hypothetical protein	NA	NA	NA	NA
WP_086928917.1\|97289_97514_-	hypothetical protein	NA	NA	NA	NA
WP_157896789.1\|97510_97774_-	hypothetical protein	NA	NA	NA	NA
WP_086928919.1\|97782_98190_-	hypothetical protein	NA	NA	NA	NA
WP_086928920.1\|98375_99032_-	SOS response-associated peptidase	C7BGE4	Burkholderia_phage	2.7e-36	42.0
WP_086928921.1\|99128_99572_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	5.5e-25	47.6
WP_086929058.1\|99625_100936_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	7.1e-97	44.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

43676 : 76040

Burkholderia_phage(33.33%)

transposase,integrase

attL 62548:62607|attR 89891:93095

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086929078.1\|43676_44651_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	5.3e-81	49.7
WP_157896845.1\|44958_45327_+	hypothetical protein	NA	NA	NA	NA
WP_067513015.1\|45254_46121_+	hypothetical protein	NA	NA	NA	NA
WP_067513013.1\|46385_46901_-	hypothetical protein	NA	NA	NA	NA
WP_067513011.1\|47151_47787_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_082763136.1\|47900_48638_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_067513009.1\|48787_49720_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_086929079.1\|49955_50930_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	1.7e-79	50.8
WP_086911694.1\|50997_52377_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_082763120.1\|52568_53726_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_066786398.1\|53729_56807_+	MMPL family transporter	NA	NA	NA	NA
WP_066786401.1\|56799_58311_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_066786404.1\|58314_58893_+	acyloxyacyl hydrolase	NA	NA	NA	NA
WP_067512782.1\|59189_59771_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	4.8e-37	40.9
WP_066785122.1\|59879_60275_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_156445148.1\|60495_61059_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_157896846.1\|61323_61983_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_066785115.1\|62202_62544_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
62548:62607	attL	NA	NA	NA	NA
WP_003049965.1\|62690_65606_-\|transposase	Tn3-like element IS1071 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-52	24.0
WP_086929080.1\|65871_67680_+\|integrase	tyrosine-type recombinase/integrase	A0A142F2H8	Mycobacterium_phage	1.8e-05	28.0
WP_086929081.1\|68615_69284_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	2.0e-15	30.6
WP_086929136.1\|69286_70279_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_157667155.1\|70316_70946_-	hypothetical protein	NA	NA	NA	NA
WP_157667158.1\|72083_72137_+	hypothetical protein	NA	NA	NA	NA
WP_086929083.1\|72902_74249_+	replication initiation protein	NA	NA	NA	NA
WP_086929084.1\|74954_76040_-\|transposase	IS630 family transposase	NA	NA	NA	NA
89891:93095	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP021366

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021366_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021366_1

1931123-1931237

Orphan

Consensus_repeat	Method
AGGGAGCCACGCGCAGCGGGGCGACCGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021366_1

>merge|NZ_CP021366|1|1931123-1931237|CRISPRCasFinder
AGGGAGCCACGCGCAGCGGGGCGACCGTTGGGGCGATCATTTTGCCGCCGGGCCGCCCCAAGGCAAAATGCGGCCCCCTTGGGGGGCAGGGAGCCGCGCGCAGCGGGGCGACCGT

>NZ_CP021366|1|1|1931123-1931237|CRISPRCasFinder
AGGGAGCCACGCGCAGCGGGGCGACCGT	TGGGGCGATCATTTTGCCGCCGGGCCGCCCCAAGGCAAAATGCGGCCCCCTTGGGGGGC
AGGGAGCCGCGCGCAGCGGGGCGACCGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021366.1\|WP_086927179.1\|1931250_1931895_-\|MotA/TolQ/ExbB-proton-channel-family-protein	unknown	unknown	gnl\|CDD\|223881
NZ_CP021366.1\|WP_086927185.1\|1938130_1939390_+\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|180792
NZ_CP021366.1\|WP_086912315.1\|1925976_1926651_-\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688
NZ_CP021366.1\|WP_086927174.1\|1926750_1927698_+\|asparaginase	unknown	unknown	gnl\|CDD\|214873
NZ_CP021366.1\|WP_086927180.1\|1932245_1933571_+\|exodeoxyribonuclease-VII-large-subunit	unknown	unknown	gnl\|CDD\|272979
NZ_CP021366.1\|WP_086912314.1\|1924280_1925288_-\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP021366.1\|WP_086927187.1\|1939749_1941177_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|349922
NZ_CP021366.1\|WP_086927182.1\|1934441_1934873_-\|DUF192-domain-containing-protein	unknown	unknown	gnl\|CDD\|376876
NZ_CP021366.1\|WP_026436501.1\|1929383_1929566_-\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NZ_CP021366.1\|WP_086927177.1\|1929585_1930659_-\|tetraacyldisaccharide-4'-kinase	unknown	unknown	gnl\|CDD\|234808
NZ_CP021366.1\|WP_086927181.1\|1933717_1934299_+\|superoxide-dismutase-[Fe]	unknown	unknown	gnl\|CDD\|182534
NZ_CP021366.1\|WP_086927183.1\|1935099_1935333_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP021366.1\|WP_086927176.1\|1928580_1929387_-\|3-deoxy-manno-octulosonate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|235473
NZ_CP021366.1\|WP_086927184.1\|1935620_1937858_+\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|377178
NZ_CP021366.1\|WP_086927186.1\|1939458_1939635_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235506
NZ_CP021366.1\|WP_086912313.1\|1923026_1924157_+\|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380565
NZ_CP021366.1\|WP_086927173.1\|1922406_1922895_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021366.1\|WP_086927175.1\|1927765_1928422_-\|adenylate-kinase	unknown	unknown	gnl\|CDD\|234711
NZ_CP021366.1\|WP_086927178.1\|1930664_1931102_-\|biopolymer-transporter-ExbD	unknown	unknown	gnl\|CDD\|376792
NZ_CP021366.1\|WP_086927188.1\|1941186_1942176_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270295

Protein	Function_ID	Function_description	E-value
NZ_CP021366.1\|WP_086927179.1\|1931250_1931895_-\|MotA/TolQ/ExbB-proton-channel-family-protein	gnl\|CDD\|223881	COG0811, TolQ, Biopolymer transport proteins [Intracellular trafficking and secretion].	7.85982e-42
NZ_CP021366.1\|WP_086927185.1\|1938130_1939390_+\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|180792	PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed.	0
NZ_CP021366.1\|WP_086927180.1\|1932245_1933571_+\|exodeoxyribonuclease-VII-large-subunit	gnl\|CDD\|272979	TIGR00237, exodeoxyribonuclease_VII_large_subunit, exodeoxyribonuclease VII, large subunit. This family consist of exodeoxyribonuclease VII, large subunit XseA which catalyses exonucleolytic cleavage in either the 5'->3' or 3'->5' direction to yield 5'-phosphomononucleotides. Exonuclease VII consists of one large subunit and four small subunits. [DNA metabolism, Degradation of DNA].	1.00306e-162
NZ_CP021366.1\|WP_086927174.1\|1926750_1927698_+\|asparaginase	gnl\|CDD\|214873	smart00870, Asparaginase, Asparaginase, found in various plant, animal and bacterial cells. Asparaginase catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma. The enzyme is effective in the treatment of human malignant lymphomas, which have a diminished capacity to produce asparagine synthetase: in order to survive, such cells absorb asparagine from blood plasma..- if Asn levels have been depleted by injection of asparaginase, the lymphoma cells die.	2.46161e-106
NZ_CP021366.1\|WP_086927187.1\|1939749_1941177_-\|amidohydrolase	gnl\|CDD\|349922	cd05673, M20_Acy1L2_AbgB, M20 Peptidase Aminoacylase 1-like protein 2 aminobenzoyl-glutamate utilization protein B subfamily. Peptidase M20 family, ACY1L2 aminobenzoyl-glutamate utilization protein B (AbgB) subfamily. This group contains mostly bacterial amidohydrolases, including gene products of abgB that catalyze the cleavage of p-aminobenzoyl-glutamate, a folate catabolite in Escherichia coli, to p-aminobenzoate and glutamate. p-Aminobenzoyl-glutamate is a natural end product of folate catabolism, and its utilization is initiated by the abg region gene product, AbgT, by enabling uptake of its into the cell in a concentration-dependent, saturable manner. It is subsequently cleaved by AbgA and AbgB (sometimes referred to as AbgAB).	0
NZ_CP021366.1\|WP_086912314.1\|1924280_1925288_-\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	7.11873e-160
NZ_CP021366.1\|WP_086912315.1\|1925976_1926651_-\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	4.14079e-108
NZ_CP021366.1\|WP_086927182.1\|1934441_1934873_-\|DUF192-domain-containing-protein	gnl\|CDD\|376876	pfam02643, DUF192, Uncharacterized ACR, COG1430. Two structures have been solved for members of this large (>500 members) family of bacterial proteins present mostly in environmental bacteria and metagenomes (distant homologs are also present in several Plasmodium species). TOPSAN analysis for Structure 3pjy shows that there is much similarity with the other solved structure, Structure 3m7a, solved for UniProt:Q2GA55 (Saro_0823), a homolog of Thermotoga maritima TM1668, UniProt:Q9X1Z6., The homolog in Caulobacter crescentus (CC1388), UniProt:Q9A8G6, is associated with CspD, a cold shock protein (CC1387), UniProt:Q9A8G7. However, the genomic context of UniProt:Q2GA55 is most conserved with a putative xylose isomerase, suggesting a possible role in extracellular sugar processing. Saro_0821, UniProt:Q2GA57, is annotated as an AMP-dependent synthetase and ligase. Structure 3m7a structure corresponds to the C-terminal (27-165) fragment of the YP_496102 (Saro_0823) protein and it is structurally unique, as the best hits from Dali have a Z-score of 3.8 (1nt0, 2j1t, 3kq4) and it is thus a likely candidate for a new fold. Interestingly, many of the top Dali hits are involved in sugar metabolism. There are no obvious active site-like cavities on the protein surface of 3m7a (http://www.topsan.org/Proteins/JCSG/).	9.83368e-50
NZ_CP021366.1\|WP_026436501.1\|1929383_1929566_-\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	3.70402e-25
NZ_CP021366.1\|WP_086927177.1\|1929585_1930659_-\|tetraacyldisaccharide-4'-kinase	gnl\|CDD\|234808	PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; Reviewed.	3.94917e-134
NZ_CP021366.1\|WP_086927181.1\|1933717_1934299_+\|superoxide-dismutase-[Fe]	gnl\|CDD\|182534	PRK10543, PRK10543, superoxide dismutase [Fe].	1.68089e-102
NZ_CP021366.1\|WP_086927183.1\|1935099_1935333_-\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	1.63142e-08
NZ_CP021366.1\|WP_086927176.1\|1928580_1929387_-\|3-deoxy-manno-octulosonate-cytidylyltransferase	gnl\|CDD\|235473	PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional.	2.39925e-129
NZ_CP021366.1\|WP_086927184.1\|1935620_1937858_+\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|377178	pfam03971, IDH, Monomeric isocitrate dehydrogenase. NADP(+)-dependent isocitrate dehydrogenase (ICD) is an important enzyme of the intermediary metabolism, as it controls the carbon flux within the citric acid cycle and supplies the cell with 2-oxoglutarate EC:1.1.1.42 and NADPH for biosynthetic purposes.	0
NZ_CP021366.1\|WP_086927186.1\|1939458_1939635_-\|SDR-family-oxidoreductase	gnl\|CDD\|235506	PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	7.35624e-09
NZ_CP021366.1\|WP_086912313.1\|1923026_1924157_+\|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380565	cd06342, PBP1_ABC_LIVBP-like, type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup includes the type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup also includes a leucine-specific binding protein (or LivK), which is very similar in sequence and structure to leucine-isoleucine-valine binding protein (LIVBP). ABC-type active transport systems are transmembrane proteins that function in the transport of diverse sets of substrates across extra- and intracellular membranes, including carbohydrates, amino acids, inorganic ions, dipeptides and oligopeptides, metabolic products, lipids and sterols, and heme, to name a few.	5.84273e-130
NZ_CP021366.1\|WP_086927175.1\|1927765_1928422_-\|adenylate-kinase	gnl\|CDD\|234711	PRK00279, adk, adenylate kinase; Reviewed.	1.22554e-144
NZ_CP021366.1\|WP_086927178.1\|1930664_1931102_-\|biopolymer-transporter-ExbD	gnl\|CDD\|376792	pfam02472, ExbD, Biopolymer transport protein ExbD/TolR. This group of proteins are membrane bound transport proteins essential for ferric ion uptake in bacteria. The Pfam family consists of ExbD, and TolR which are involved in TonB-dependent transport of various receptor bound substrates including colicins.	1.267e-30
NZ_CP021366.1\|WP_086927188.1\|1941186_1942176_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.59388e-117

>NZ_CP021366.1|WP_086927178.1|1930664_1931102_-|biopolymer-transporter-ExbD
MNFRPRAKDEPEINLIPFIDVLLVILIFMMLTTTYSKFTELQLTLPVADAEQQRDHPKEVIVAVAADGRYAVNKTAVDGKSVDAVARALGQVASAGQGSVVIISADATAPHQAVVTVMEAARRVGLSQITFATQSSASARAGNGR
>NZ_CP021366.1|WP_086927177.1|1929585_1930659_-|tetraacyldisaccharide-4'-kinase
MAAAGPQPPSPLPSTTAPASGSQQATGLARIWRSRGPAAWALWPLSLVYGALVALRRWLYRLQVLRSEHPGPPVIVVGNVIAGGAGKTPVVIALVRHLQAQGWQPGVISRGYGRSTHDCRAVRPDSPAQEVGDEPALIARATHAPVFVAPRRITAARALLAAHPGTNILVCDDGLQHLALARDLEICVFNSDGMGNGFLLPAGPLREPWPRPVDWVLHAGTRPAGHNPSFALQRRLAPHALRADGRQVPLASLRGGPVHAVAAVARPAEFFAMLRAQGLQLSSTEALPDHYDFNSWKRPSDKHITLICTEKDAVKLWPLHPDALAVPLMLELDPAFFAALDARLAPWRAAPLSSPSA
>NZ_CP021366.1|WP_026436501.1|1929383_1929566_-|Trm112-family-protein
MDPKLLELLVCPVTKGPLTYDRERQELVSRSARLAYPVRDGIPVLLENEARTLTDEELEA
>NZ_CP021366.1|WP_086927176.1|1928580_1929387_-|3-deoxy-manno-octulosonate-cytidylyltransferase
MIPTAATGFTVLIPARMASSRLPDKPLADIAGLPMVVHVARRAAQSAAARVVVAADDPRILHACQAHGVQALLTRTDHASGSDRLAEACMQLGLDGDAVVVNVQGDEPLMDPALIDAVAALLPARPEASMGTAAHAIHTRTDYENPNVVKVVLDARGLAHYFSRAPIPHARDHAGQAWWQGAAAQAAPSVAALHGFAPLRHIGIYSYRAGFLRQFPGLAQAPTEAVEALEQLRALWHGHRIAVHIADQAPGPGVDTPADLDRVRTLLA
>NZ_CP021366.1|WP_086927175.1|1927765_1928422_-|adenylate-kinase
MRLILLGAPGAGKGTQATFICQKYGIPQISTGDMLRAAVKAGTPLGLQAKAVMDSGALVSDDIIIGLVKERITQPDCANGFLFDGFPRTIPQADAMKDAGVKLDYVLEIDVPFDAIIERMSGRRSHPASGRTYHVKFNPPKVAGKDDVTGEDLIQREDDKEETVKKRLQVYSDQTRPLVNYYSNWAKAEPNAAPKYRAISGTGSVEEITARALQALSS
>NZ_CP021366.1|WP_086927174.1|1926750_1927698_+|asparaginase
MSSQKIVVLGTGGTIAGKAATQEDNIGYTAAQVGLEQLLHAVPGLQAAACGGLVAEQIAQLDSKDMEFSVWRLLAERCARALADPLVRGLVITHGTDTLEETAWFLQSVLDAHKPVVLTCAMRPATALTPDGPQNLLDAVAVAMTAGARGVVVVAAGAVHGAQRFQKVHPYRVDAFSSGDAGPLGWVEEGVVRLVQNWPKAQSGKAQCAIEKIVNCTHWPRVEVVMSYAGATGALVDSLVRDGVQGIVVAATGNGTIHQALESALLRAQAAGVKVVRSTRCPEGQVLPKPGDALPDSRGLSAVKARIALMLQLLP
>NZ_CP021366.1|WP_086912315.1|1925976_1926651_-|transcriptional-repressor-LexA
MLDNPKLTARQQQILDLIQVAISRTGAPPTRAEIATELGFKSANAAEEHLQALARKGVIELVSGTSRGIRLRSDTVRSINAARGTQFSLPMPGLSQLVLPLIGRVAAGSPILAQEHVDQTYSVENSLFQHKPDYLLKVRGMSMRDAGIMDGDLLAVQSTREARNGQIVVARLGDDVTVKRLRRTAGAIELLPENPDYPVIVVQPGEAFEIEGLAVGLIRNTMLM
>NZ_CP021366.1|WP_086912314.1|1924280_1925288_-|D-2-hydroxyacid-dehydrogenase-family-protein
MNIVILDDYQDAVRKLHCASRLDPYSAKVYTNTVKGQGQLAVRLKDADIIVLVRERTQITRQLVEKLPRLKLIAQTGKIGSHIDVTACTERGIAVAEGVGSPVAPAELTWALVMAAMRRLPQYIANLKHGAWQQSGLKAASMPPNFCLGSVLRGKTLGIWGYGRIGQLVAGYGRAFGMNVRVWGRDASRAQALTDGYQAATNREEFFSQCDVLSLHLRLNDETRGIISLEDLSCMKPTALLVNTSRAELIEPDALIAALNRGRPGLAAVDVFESEPILQGHALLRLENCICTPHIGYVEQDSYELYFGAAFDNVVNYIKGTPTNIVNPGALQVRR
>NZ_CP021366.1|WP_086912313.1|1923026_1924157_+|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein
MQLKLKLTVVAAIAAVAGMASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGITIGGKKIKFELQAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAATNPNLTKPGYKTTFRIIANDNALGAGLAFYAADTLKLKTVAIVDDRTAYGQGVANVFKKVAAEKGMKVVDEQFTTDKATDFMAILTAIKSKNPDAIFFGGMDPQGGPMLRQMEQLGMGNVKYFGGDGICTSEIAKLAAGAKTLSNVVCAEGGASLDKMPGGKAWKAKYDAKYPGQFQVYSPYTYDATHLIVDAMKRANSVDPKVYTPELLKSQFKGVTSTIAFEPNGEMKNPAITLYVYKDGKKTPLN
>NZ_CP021366.1|WP_086927173.1|1922406_1922895_+|hypothetical-protein
MSLPPKPLPRFVPTLTEVVQGPDVLPVSVPLAQHGPSSRGGASTIAQTAPSLHASASIPAAPVPSMDKTVRGTSGTKPVQTSPTPRRPLPDGMEEYMVHRVMQRVDVLLDQRLREAIALVIQEQTRSVLPRLREEIESVVRHAVYEAVADELASGNPTECGG
>NZ_CP021366.1|WP_086927179.1|1931250_1931895_-|MotA/TolQ/ExbB-proton-channel-family-protein
MLSIIQAAGWPIWPLIACSVLALALIFERFVALKTARVAPPRLLDEAITVSTKALPTPDVVNQLAQNSALGEVLASGLRAFNNNPLCTEADLRATMEGAGRTVAHRLEKYLNALATIASAAPLLGLLGTVIGMIEIFGSQVGTGGASQAMGGGNPAQLAHGISVALYNTAFGLIVAIPALIFWRYFRSRVDAYLLTLELASEQFVRHILRLRKR
>NZ_CP021366.1|WP_086927180.1|1932245_1933571_+|exodeoxyribonuclease-VII-large-subunit
MPEPTSVGATPRIWEVGALCRAIADALEARFNPVAVRGEITGFSRASSGHCYFSVKDANGQLRCAMFRRSASLLDFSPRDGELVELRGRIGVYEARGDLQFIVESMQRAGQGALFEQFLRLKAQLEGEGLFDAARKRPLPLQPRGIGLVTSPGAAALHDVVTALRRRVPHIPVLLVPAQVQGVAAPQALVSALSKLYLLAQAGKAPEADLAQNPAIDVILLVRGGGSMEDLWAFNDEQLARTIVQSPVPLICGVGHETDFTIADFCADLRAPTPTAAAELVAQPREVWLGALGLLAGRLADGVQRQLDARHQRLDQAAARLGRPSGIVARQQLQLARLAQRMRHGSLLKMQQLVQTQKALEDEMPLKLQRQLALHAEGLDRAALRLELLDPRLVLQRGYALLTDTAGQAVTSVRQAQPGDALRATLADGAVDVTVVQPRLL
>NZ_CP021366.1|WP_086927181.1|1933717_1934299_+|superoxide-dismutase-[Fe]
MEHTLPPLPYAIDALAPHYSQETLEYHHGKHHNAYVVNLNNLQKGTEFEAMTLEEIVKKSSGGIYNNAAQIWNHTFFWSCMKPQGGGEPTGALAAAINAKFGSYAAFKEAFVKSTVGNFGSGWTWLVKKADGSVDIVNTGAAGTPLTTADKALLTVDVWEHAYYIDYRNQRPKFVETFLGNLVNWSFAEANFA
>NZ_CP021366.1|WP_086927182.1|1934441_1934873_-|DUF192-domain-containing-protein
MVATLALWSTAAPAQDGPQLALQRVELTAGMHRIDAQVAQTPQERQTGLMFRREMPAQEGMLFIFDQPGVQCFWMKNTLLPLTAAFVGDDGTIVNLADMKPQTTDSHCSARPVRYVLEMNQGWFGKKGIKAGFKLGGAPFSKR
>NZ_CP021366.1|WP_086927183.1|1935099_1935333_-|hypothetical-protein
MKKLLAVLMAGLFAAGAFAQAPAAAPAAAPAPAVAPQTAPAPAMTPAPATKAAKAPAKAKHKKVAAKKTKKHVKKAV
>NZ_CP021366.1|WP_086927184.1|1935620_1937858_+|NADP-dependent-isocitrate-dehydrogenase
MSTQQPTIIYTLTDEAPRLATASFLPIVRAFAAPAGINVTESDISVAARVLGEFTEFLRDDQKVPNTLAALGKKTLEPDANIIKLPNISASVGQLIACIKELQGKGYAVPDYPEDPKSDEDKAIRARYAKCIGSAVNPVLREGNSDRRAPRAVKEYARKNPHSMAEWSQASRSHVSHMHAGDFYHGEKSMTLDRARDVKMELLTKSGKTIVLKAKVSLLDREIIDSMFMSKKALLAFYEKEIEDAHKTGVMFSLHVKATMMKVSHPIVFGHCVKIFYKDAFAKHGKLFDELGVNVNNGMANLYEKVATLPTAQREEVMRDLHACHATRPELAMVDSAKGITNFHSPNDIIVDASMPAMIRNGGKMWGADGRLKDVKAVMPESTFARIYQEIINFCKWHGAFDPKTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANITDLATGEVLLSQNVEAGDIWRMCQVKDAAIRDWVKLAVTRARNSGMPVVFWLDAYRPHEAQLITKVKMYLHEHDINGLDIQIMSQVRAMRYTLERVVRGLDTISATGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENHLRWDSLGEFLALAVSLEDLGLKTGNAQAKVLAKTLDAATGKLLDNNKNPSPKTGQLDNRGSQFYLALYWAQELAAQTDDADLAKRFAPLAQQLAANEQKIVDELNAVQGKPADIGGYYLPDPAKLDAIMRPSQTLNTVLAAAGA
>NZ_CP021366.1|WP_086927185.1|1938130_1939390_+|NADP-dependent-isocitrate-dehydrogenase
MTNYQHIKVPAEGQKITVNADMSLNVPDQPIIPFIEGDGTGADITPVMLKVVDAAVAKAYGGKKKIHWMEVFAGEKSTKVYGPDVWLPEETLHAVKDYVVSIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPIQYFDGVPSPVKEPHKTNMVIFRENSEDIYAGIEFEAESEKAKKLIKILQDEFGVKKIRFPNTSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTIVHKGNIMKFTEGGFRDWAYGLAAKEFGAELIDGGPWMRFKNPKTGKDIVIKDSIADAFLQQILLRPAEYSVIATLNLNGDYVSDALAAQVGGIGIAPGANMSDTIAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHMGWVEAADLIISSMKKSIASKNVTYDFARLMEGAKQVSCSGFGQVMIDHM
>NZ_CP021366.1|WP_086927186.1|1939458_1939635_-|SDR-family-oxidoreductase
MHPTGRMGQPKEITETACALLADMASFMSGLHSVVDGGLLGVEPGAGQTVTVVRLRHP
>NZ_CP021366.1|WP_086927187.1|1939749_1941177_-|amidohydrolase
MHPIDELRPFFEQQAPRTIALSDQIWSLAELRYAEEASVKLHTDGLAEAGFRIQQPVADIPTAFMAEYGEGGPVIGLLGEYDALSGLNQQSGALQCMPSSDSPGMNGHGCGHHLLGTAAHLAALAVQQHLRTHKLPGRIRFYGCPAEEGGSGKTFMARAGAFTDLDAALTWHPSSHTGIFDQSTLANIQASFVFKGRAAHAANAPHLGRSALDAVELMNVGCNYLREHMPPSARVHYAVTDSGGMSPNVVQARAEVLYLIRAARNIDAAELYERVQNVARGAALMTGCEVDIRFDKACSNLLQNTTLNQVMYTQMQHLGRLPVGEKEREQARQHHATLGASDIEEAGRSLSSALRGQVTELFDGIKDYDPAREELLYGSTDVADVSWVTPTAQAWVACYAFGTPFHSWQMVSQGKTSLAHVGMLQAAKILAATAIELLSKPDMLAAARQELQARREGKPYTCPIPAEIPLPFRRS
>NZ_CP021366.1|WP_086927188.1|1941186_1942176_-|ABC-transporter-substrate-binding-protein
MTRLSPRALTRRLSLLALGLLPLAALAQSDFPSKPVKLVVPFAAGGSTDLVARVIADGLRTTLGQAVVVDNRAGAGGLLGTEVVSQAAPDGYTIGMATASTMTVNPALYPRAEAINAKLQPLVNLVSMPSVYMVHPGMGVKDFAGFVTALKAKPNHYSAAVPGVGSLGQLMVESFNDTVGVKMANVPYRGSGPALNDALAGVVQIMPDQIPSAMPHIKSGKLLPVAVASSRRITELPDVPTFKELGYPELNDLGISWFGLVIPAKTPPAIAEKLRAAAIQAVHAPETLARLQKMGVSLTDGKSEDFPALIATQVKRNRAIVQKAGIKPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1487658 : 1512587

Escherichia_phage(25.0%)

transposase,terminase,tail,tRNA,integrase,head

attL 1503188:1503202|attR 1512767:1512781

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086926987.1\|1487658_1489506_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	1.1e-162	51.0
WP_086926988.1\|1489689_1490088_+	hypothetical protein	NA	NA	NA	NA
WP_086926989.1\|1490241_1490685_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_086926990.1\|1490724_1491579_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_086928669.1\|1491601_1492009_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_086926991.1\|1492120_1492957_+	dioxygenase	NA	NA	NA	NA
WP_086911918.1\|1493008_1493680_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_086926992.1\|1493773_1494607_-	zinc-dependent peptidase	NA	NA	NA	NA
WP_086926993.1\|1494643_1495435_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_086911921.1\|1495451_1495958_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_086926994.1\|1495982_1496567_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_086926995.1\|1496705_1497269_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_086926996.1\|1497486_1498863_+\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	9.3e-39	33.4
WP_086914009.1\|1498908_1499583_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_086911924.1\|1499665_1500643_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_086926997.1\|1500753_1501716_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_086911926.1\|1501796_1503065_+	aspartate kinase	NA	NA	NA	NA
1503188:1503202	attL	NA	NA	NA	NA
WP_086926998.1\|1503321_1503639_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	1.1e-14	45.6
WP_086926999.1\|1503635_1503914_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J711	uncultured_Caudovirales_phage	3.0e-05	34.7
WP_086927000.1\|1504124_1505624_-\|terminase	terminase	K7PLY2	Enterobacterial_phage	1.1e-173	62.1
WP_026437709.1\|1505857_1506673_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	1.7e-32	38.5
WP_086927645.1\|1506665_1508189_-\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_157896712.1\|1508463_1509285_+	hypothetical protein	NA	NA	NA	NA
WP_086927002.1\|1509290_1509593_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_086927003.1\|1509699_1510602_+	hypothetical protein	NA	NA	NA	NA
WP_094122614.1\|1510577_1511809_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.6e-133	83.2
WP_086927004.1\|1511708_1512587_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	1.6e-44	40.8
1512767:1512781	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021367

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021368

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP021366

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection