CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP021364	Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence	0 crisprs	NA	1
NZ_CP021365	Acidovorax carolinensis strain P3 plasmid pACP3.3, complete sequence	0 crisprs	cas4	0
NZ_CP021363	Acidovorax carolinensis strain P3 plasmid pACP3.1, complete sequence	0 crisprs	c2c9_V-U4,DEDDh	2
NZ_CP021362	Acidovorax carolinensis strain P3 chromosome, complete genome	1 crisprs	Cas9_archaeal,DEDDh,DinG,csa3	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

62753 : 95116

Burkholderia_phage(33.33%)

integrase,transposase

attL 81624:81683|attR 108967:112171

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086929078.1\|62753_63728_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	5.3e-81	49.7
WP_157896845.1\|64034_64403_+	hypothetical protein	NA	NA	NA	NA
WP_067513015.1\|64330_65197_+	hypothetical protein	NA	NA	NA	NA
WP_067513013.1\|65461_65977_-	hypothetical protein	NA	NA	NA	NA
WP_067513011.1\|66227_66863_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_082763136.1\|66976_67714_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_067513009.1\|67863_68796_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_086929079.1\|69031_70006_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	1.7e-79	50.8
WP_086911694.1\|70073_71453_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_082763120.1\|71644_72802_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_066786398.1\|72805_75883_+	MMPL family transporter	NA	NA	NA	NA
WP_066786401.1\|75875_77387_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_066786404.1\|77390_77969_+	acyloxyacyl hydrolase	NA	NA	NA	NA
WP_067512782.1\|78265_78847_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	4.8e-37	40.9
WP_066785122.1\|78955_79351_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_156445148.1\|79571_80135_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_157896846.1\|80399_81059_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_066785115.1\|81278_81620_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
81624:81683	attL	NA	NA	NA	NA
WP_003049965.1\|81766_84682_-\|transposase	Tn3-like element IS1071 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-52	24.0
WP_086929080.1\|84947_86756_+\|integrase	tyrosine-type recombinase/integrase	A0A142F2H8	Mycobacterium_phage	1.8e-05	28.0
WP_086929081.1\|87691_88360_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	2.0e-15	30.6
WP_086929136.1\|88362_89355_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_157667155.1\|89392_90022_-	hypothetical protein	NA	NA	NA	NA
WP_157667158.1\|91159_91213_+	hypothetical protein	NA	NA	NA	NA
WP_086929083.1\|91978_93325_+	replication initiation protein	NA	NA	NA	NA
WP_086929084.1\|94030_95116_-\|transposase	IS630 family transposase	NA	NA	NA	NA
108967:112171	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021363

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

36144 : 65383

Burkholderia_phage(33.33%)

integrase,transposase

attL 38285:38298|attR 63218:63231

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024814084.1\|36144_36768_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SFD7	Streptococcus_phage	1.3e-11	31.0
WP_086914285.1\|36882_37857_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	2.6e-80	49.4
WP_157896632.1\|38195_38414_-	hypothetical protein	NA	NA	NA	NA
38285:38298	attL	NA	NA	NA	NA
WP_086914283.1\|38569_39703_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_086914282.1\|39704_42809_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-79	24.3
WP_086914281.1\|42801_43104_+	DUF3240 family protein	NA	NA	NA	NA
WP_086914280.1\|43100_44348_+	TolC family protein	NA	NA	NA	NA
WP_086914279.1\|44428_44698_+	flagellar biosynthesis protein FliQ	NA	NA	NA	NA
WP_008903077.1\|45469_46258_+	UPF0149 family protein	NA	NA	NA	NA
WP_082759088.1\|46291_47887_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	4.5e-77	36.9
WP_008903079.1\|47988_48339_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_008903080.1\|48314_48758_-\|transposase	transposase	NA	NA	NA	NA
WP_086914278.1\|49585_50401_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	3.7e-19	33.7
WP_056057356.1\|50471_50783_+	HU family DNA-binding protein	Q6QIE5	Burkholderia_phage	4.4e-13	44.9
WP_086914277.1\|50931_51393_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_086914276.1\|51435_51672_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_086914275.1\|52322_52691_-	hypothetical protein	NA	NA	NA	NA
WP_063462293.1\|53740_54826_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_157896774.1\|54941_55676_+	hypothetical protein	NA	NA	NA	NA
WP_094122716.1\|56420_57590_+	hypothetical protein	NA	NA	NA	NA
WP_086914271.1\|58045_59002_-	hypothetical protein	NA	NA	NA	NA
WP_157896629.1\|59640_60594_-	hypothetical protein	NA	NA	NA	NA
WP_086914269.1\|60580_61477_-	AAA family ATPase	NA	NA	NA	NA
WP_086928898.1\|61476_62904_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_157896776.1\|64251_64749_-	hypothetical protein	NA	NA	NA	NA
63218:63231	attR	NA	NA	NA	NA
WP_086914301.1\|64726_65383_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA

DBSCAN-SWA_2

79017 : 85829

Salmonella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086928914.1\|79017_79248_-	hypothetical protein	W8VUQ4	Pseudomonas_phage	8.3e-09	45.9
WP_157896787.1\|79244_79646_-	hypothetical protein	NA	NA	NA	NA
WP_086928916.1\|80069_81317_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A1B0VCD8	Salmonella_phage	4.1e-110	51.8
WP_086929057.1\|81341_81761_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.0e-37	55.9
WP_157896788.1\|82021_82186_-	hypothetical protein	NA	NA	NA	NA
WP_086928917.1\|82182_82407_-	hypothetical protein	NA	NA	NA	NA
WP_157896789.1\|82403_82667_-	hypothetical protein	NA	NA	NA	NA
WP_086928919.1\|82675_83083_-	hypothetical protein	NA	NA	NA	NA
WP_086928920.1\|83268_83925_-	SOS response-associated peptidase	C7BGE4	Burkholderia_phage	2.7e-36	42.0
WP_086928921.1\|84021_84465_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	5.5e-25	47.6
WP_086929058.1\|84518_85829_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	7.1e-97	44.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP021362

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021362_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021362_1

2149548-2149661

Orphan

Consensus_repeat	Method
ACGGTCGCCCCGCTGCGCGCGGCTCCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021362_1

>merge|NZ_CP021362|1|2149548-2149661|CRISPRCasFinder
ACGGTCGCCCCGCTGCGCGCGGCTCCCTGCCCCCCAAGGGGGCCGCATTTTGCCTTGGGCGGCCCGGCGGCAAAATGATCGCCCCAACGGTCGCCCCGCTGCGCGTGGCTCCCT

>NZ_CP021362|1|1|2149548-2149661|CRISPRCasFinder
ACGGTCGCCCCGCTGCGCGCGGCTCCCT	GCCCCCCAAGGGGGCCGCATTTTGCCTTGGGCGGCCCGGCGGCAAAATGATCGCCCCA
ACGGTCGCCCCGCTGCGCGTGGCTCCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021362.1\|WP_086927180.1\|2147213_2148539_-\|exodeoxyribonuclease-VII-large-subunit	unknown	unknown	gnl\|CDD\|272979
NZ_CP021362.1\|WP_086927190.1\|2135936_2136377_+\|TfoX/Sxy-family-protein	unknown	unknown	gnl\|CDD\|377438
NZ_CP021362.1\|WP_086927176.1\|2151394_2152201_+\|3-deoxy-manno-octulosonate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|235473
NZ_CP021362.1\|WP_094122633.1\|2149677_2150118_+\|biopolymer-transporter-ExbD	unknown	unknown	gnl\|CDD\|376792
NZ_CP021362.1\|WP_086927179.1\|2148889_2149534_+\|MotA/TolQ/ExbB-proton-channel-family-protein	unknown	unknown	gnl\|CDD\|223881
NZ_CP021362.1\|WP_086927187.1\|2139615_2141043_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|349922
NZ_CP021362.1\|WP_086912313.1\|2156624_2157755_-\|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380565
NZ_CP021362.1\|WP_086927175.1\|2152359_2153016_+\|adenylate-kinase	unknown	unknown	gnl\|CDD\|234711
NZ_CP021362.1\|WP_086912314.1\|2155493_2156501_+\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP021362.1\|WP_086927184.1\|2142934_2145172_-\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|377178
NZ_CP021362.1\|WP_086927186.1\|2141157_2141334_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235506
NZ_CP021362.1\|WP_086928699.1\|2137441_2138386_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274127
NZ_CP021362.1\|WP_094122705.1\|2150203_2151196_+\|tetraacyldisaccharide-4'-kinase	unknown	unknown	gnl\|CDD\|234808
NZ_CP021362.1\|WP_086927182.1\|2145918_2146350_+\|DUF192-domain-containing-protein	unknown	unknown	gnl\|CDD\|376876
NZ_CP021362.1\|WP_094122634.1\|2157886_2158378_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021362.1\|WP_026436501.1\|2151215_2151398_+\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NZ_CP021362.1\|WP_086927185.1\|2141402_2142662_-\|NADP-dependent-isocitrate-dehydrogenase	unknown	unknown	gnl\|CDD\|180792
NZ_CP021362.1\|WP_086927174.1\|2153083_2154031_-\|asparaginase	unknown	unknown	gnl\|CDD\|214873
NZ_CP021362.1\|WP_086912315.1\|2154130_2154805_+\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688
NZ_CP021362.1\|WP_086927188.1\|2138616_2139606_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270295

Protein	Function_ID	Function_description	E-value
NZ_CP021362.1\|WP_086927180.1\|2147213_2148539_-\|exodeoxyribonuclease-VII-large-subunit	gnl\|CDD\|272979	TIGR00237, exodeoxyribonuclease_VII_large_subunit, exodeoxyribonuclease VII, large subunit. This family consist of exodeoxyribonuclease VII, large subunit XseA which catalyses exonucleolytic cleavage in either the 5'->3' or 3'->5' direction to yield 5'-phosphomononucleotides. Exonuclease VII consists of one large subunit and four small subunits. [DNA metabolism, Degradation of DNA].	1.00306e-162
NZ_CP021362.1\|WP_086927190.1\|2135936_2136377_+\|TfoX/Sxy-family-protein	gnl\|CDD\|377438	pfam04993, TfoX_N, TfoX N-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the N-terminal presumed domain of TfoX. The domain is found as an isolated domain in some proteins suggesting this is an autonomous domain.	1.61938e-11
NZ_CP021362.1\|WP_086927176.1\|2151394_2152201_+\|3-deoxy-manno-octulosonate-cytidylyltransferase	gnl\|CDD\|235473	PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional.	2.39925e-129
NZ_CP021362.1\|WP_094122633.1\|2149677_2150118_+\|biopolymer-transporter-ExbD	gnl\|CDD\|376792	pfam02472, ExbD, Biopolymer transport protein ExbD/TolR. This group of proteins are membrane bound transport proteins essential for ferric ion uptake in bacteria. The Pfam family consists of ExbD, and TolR which are involved in TonB-dependent transport of various receptor bound substrates including colicins.	6.8167e-31
NZ_CP021362.1\|WP_086927179.1\|2148889_2149534_+\|MotA/TolQ/ExbB-proton-channel-family-protein	gnl\|CDD\|223881	COG0811, TolQ, Biopolymer transport proteins [Intracellular trafficking and secretion].	7.85982e-42
NZ_CP021362.1\|WP_086927187.1\|2139615_2141043_+\|amidohydrolase	gnl\|CDD\|349922	cd05673, M20_Acy1L2_AbgB, M20 Peptidase Aminoacylase 1-like protein 2 aminobenzoyl-glutamate utilization protein B subfamily. Peptidase M20 family, ACY1L2 aminobenzoyl-glutamate utilization protein B (AbgB) subfamily. This group contains mostly bacterial amidohydrolases, including gene products of abgB that catalyze the cleavage of p-aminobenzoyl-glutamate, a folate catabolite in Escherichia coli, to p-aminobenzoate and glutamate. p-Aminobenzoyl-glutamate is a natural end product of folate catabolism, and its utilization is initiated by the abg region gene product, AbgT, by enabling uptake of its into the cell in a concentration-dependent, saturable manner. It is subsequently cleaved by AbgA and AbgB (sometimes referred to as AbgAB).	0
NZ_CP021362.1\|WP_086912313.1\|2156624_2157755_-\|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380565	cd06342, PBP1_ABC_LIVBP-like, type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup includes the type 1 periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine). This subgroup also includes a leucine-specific binding protein (or LivK), which is very similar in sequence and structure to leucine-isoleucine-valine binding protein (LIVBP). ABC-type active transport systems are transmembrane proteins that function in the transport of diverse sets of substrates across extra- and intracellular membranes, including carbohydrates, amino acids, inorganic ions, dipeptides and oligopeptides, metabolic products, lipids and sterols, and heme, to name a few.	5.84273e-130
NZ_CP021362.1\|WP_086927175.1\|2152359_2153016_+\|adenylate-kinase	gnl\|CDD\|234711	PRK00279, adk, adenylate kinase; Reviewed.	1.22554e-144
NZ_CP021362.1\|WP_086912314.1\|2155493_2156501_+\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	7.11873e-160
NZ_CP021362.1\|WP_086927184.1\|2142934_2145172_-\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|377178	pfam03971, IDH, Monomeric isocitrate dehydrogenase. NADP(+)-dependent isocitrate dehydrogenase (ICD) is an important enzyme of the intermediary metabolism, as it controls the carbon flux within the citric acid cycle and supplies the cell with 2-oxoglutarate EC:1.1.1.42 and NADPH for biosynthetic purposes.	0
NZ_CP021362.1\|WP_086927186.1\|2141157_2141334_+\|SDR-family-oxidoreductase	gnl\|CDD\|235506	PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	7.35624e-09
NZ_CP021362.1\|WP_086928699.1\|2137441_2138386_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|274127	TIGR02424, TF_pcaQ, pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria. [Energy metabolism, Other, Regulatory functions, DNA interactions].	5.86823e-32
NZ_CP021362.1\|WP_094122705.1\|2150203_2151196_+\|tetraacyldisaccharide-4'-kinase	gnl\|CDD\|234808	PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; Reviewed.	1.27986e-133
NZ_CP021362.1\|WP_086927182.1\|2145918_2146350_+\|DUF192-domain-containing-protein	gnl\|CDD\|376876	pfam02643, DUF192, Uncharacterized ACR, COG1430. Two structures have been solved for members of this large (>500 members) family of bacterial proteins present mostly in environmental bacteria and metagenomes (distant homologs are also present in several Plasmodium species). TOPSAN analysis for Structure 3pjy shows that there is much similarity with the other solved structure, Structure 3m7a, solved for UniProt:Q2GA55 (Saro_0823), a homolog of Thermotoga maritima TM1668, UniProt:Q9X1Z6., The homolog in Caulobacter crescentus (CC1388), UniProt:Q9A8G6, is associated with CspD, a cold shock protein (CC1387), UniProt:Q9A8G7. However, the genomic context of UniProt:Q2GA55 is most conserved with a putative xylose isomerase, suggesting a possible role in extracellular sugar processing. Saro_0821, UniProt:Q2GA57, is annotated as an AMP-dependent synthetase and ligase. Structure 3m7a structure corresponds to the C-terminal (27-165) fragment of the YP_496102 (Saro_0823) protein and it is structurally unique, as the best hits from Dali have a Z-score of 3.8 (1nt0, 2j1t, 3kq4) and it is thus a likely candidate for a new fold. Interestingly, many of the top Dali hits are involved in sugar metabolism. There are no obvious active site-like cavities on the protein surface of 3m7a (http://www.topsan.org/Proteins/JCSG/).	9.83368e-50
NZ_CP021362.1\|WP_026436501.1\|2151215_2151398_+\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	3.70402e-25
NZ_CP021362.1\|WP_086927185.1\|2141402_2142662_-\|NADP-dependent-isocitrate-dehydrogenase	gnl\|CDD\|180792	PRK07006, PRK07006, isocitrate dehydrogenase; Reviewed.	0
NZ_CP021362.1\|WP_086927174.1\|2153083_2154031_-\|asparaginase	gnl\|CDD\|214873	smart00870, Asparaginase, Asparaginase, found in various plant, animal and bacterial cells. Asparaginase catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma. The enzyme is effective in the treatment of human malignant lymphomas, which have a diminished capacity to produce asparagine synthetase: in order to survive, such cells absorb asparagine from blood plasma..- if Asn levels have been depleted by injection of asparaginase, the lymphoma cells die.	2.46161e-106
NZ_CP021362.1\|WP_086912315.1\|2154130_2154805_+\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	4.14079e-108
NZ_CP021362.1\|WP_086927188.1\|2138616_2139606_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.59388e-117

>NZ_CP021362.1|WP_086927179.1|2148889_2149534_+|MotA/TolQ/ExbB-proton-channel-family-protein
MLSIIQAAGWPIWPLIACSVLALALIFERFVALKTARVAPPRLLDEAITVSTKALPTPDVVNQLAQNSALGEVLASGLRAFNNNPLCTEADLRATMEGAGRTVAHRLEKYLNALATIASAAPLLGLLGTVIGMIEIFGSQVGTGGASQAMGGGNPAQLAHGISVALYNTAFGLIVAIPALIFWRYFRSRVDAYLLTLELASEQFVRHILRLRKR
>NZ_CP021362.1|WP_086927180.1|2147213_2148539_-|exodeoxyribonuclease-VII-large-subunit
MPEPTSVGATPRIWEVGALCRAIADALEARFNPVAVRGEITGFSRASSGHCYFSVKDANGQLRCAMFRRSASLLDFSPRDGELVELRGRIGVYEARGDLQFIVESMQRAGQGALFEQFLRLKAQLEGEGLFDAARKRPLPLQPRGIGLVTSPGAAALHDVVTALRRRVPHIPVLLVPAQVQGVAAPQALVSALSKLYLLAQAGKAPEADLAQNPAIDVILLVRGGGSMEDLWAFNDEQLARTIVQSPVPLICGVGHETDFTIADFCADLRAPTPTAAAELVAQPREVWLGALGLLAGRLADGVQRQLDARHQRLDQAAARLGRPSGIVARQQLQLARLAQRMRHGSLLKMQQLVQTQKALEDEMPLKLQRQLALHAEGLDRAALRLELLDPRLVLQRGYALLTDTAGQAVTSVRQAQPGDALRATLADGAVDVTVVQPRLL
>NZ_CP021362.1|WP_086927182.1|2145918_2146350_+|DUF192-domain-containing-protein
MVATLALWSTAAPAQDGPQLALQRVELTAGMHRIDAQVAQTPQERQTGLMFRREMPAQEGMLFIFDQPGVQCFWMKNTLLPLTAAFVGDDGTIVNLADMKPQTTDSHCSARPVRYVLEMNQGWFGKKGIKAGFKLGGAPFSKR
>NZ_CP021362.1|WP_086927184.1|2142934_2145172_-|NADP-dependent-isocitrate-dehydrogenase
MSTQQPTIIYTLTDEAPRLATASFLPIVRAFAAPAGINVTESDISVAARVLGEFTEFLRDDQKVPNTLAALGKKTLEPDANIIKLPNISASVGQLIACIKELQGKGYAVPDYPEDPKSDEDKAIRARYAKCIGSAVNPVLREGNSDRRAPRAVKEYARKNPHSMAEWSQASRSHVSHMHAGDFYHGEKSMTLDRARDVKMELLTKSGKTIVLKAKVSLLDREIIDSMFMSKKALLAFYEKEIEDAHKTGVMFSLHVKATMMKVSHPIVFGHCVKIFYKDAFAKHGKLFDELGVNVNNGMANLYEKVATLPTAQREEVMRDLHACHATRPELAMVDSAKGITNFHSPNDIIVDASMPAMIRNGGKMWGADGRLKDVKAVMPESTFARIYQEIINFCKWHGAFDPKTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANITDLATGEVLLSQNVEAGDIWRMCQVKDAAIRDWVKLAVTRARNSGMPVVFWLDAYRPHEAQLITKVKMYLHEHDINGLDIQIMSQVRAMRYTLERVVRGLDTISATGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENHLRWDSLGEFLALAVSLEDLGLKTGNAQAKVLAKTLDAATGKLLDNNKNPSPKTGQLDNRGSQFYLALYWAQELAAQTDDADLAKRFAPLAQQLAANEQKIVDELNAVQGKPADIGGYYLPDPAKLDAIMRPSQTLNTVLAAAGA
>NZ_CP021362.1|WP_086927185.1|2141402_2142662_-|NADP-dependent-isocitrate-dehydrogenase
MTNYQHIKVPAEGQKITVNADMSLNVPDQPIIPFIEGDGTGADITPVMLKVVDAAVAKAYGGKKKIHWMEVFAGEKSTKVYGPDVWLPEETLHAVKDYVVSIKGPLTTPVGGGIRSLNVALRQELDLYVCLRPIQYFDGVPSPVKEPHKTNMVIFRENSEDIYAGIEFEAESEKAKKLIKILQDEFGVKKIRFPNTSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTIVHKGNIMKFTEGGFRDWAYGLAAKEFGAELIDGGPWMRFKNPKTGKDIVIKDSIADAFLQQILLRPAEYSVIATLNLNGDYVSDALAAQVGGIGIAPGANMSDTIAMFEATHGTAPKYAGKDYVNPGSEILSAEMMLRHMGWVEAADLIISSMKKSIASKNVTYDFARLMEGAKQVSCSGFGQVMIDHM
>NZ_CP021362.1|WP_086927186.1|2141157_2141334_+|SDR-family-oxidoreductase
MHPTGRMGQPKEITETACALLADMASFMSGLHSVVDGGLLGVEPGAGQTVTVVRLRHP
>NZ_CP021362.1|WP_086927187.1|2139615_2141043_+|amidohydrolase
MHPIDELRPFFEQQAPRTIALSDQIWSLAELRYAEEASVKLHTDGLAEAGFRIQQPVADIPTAFMAEYGEGGPVIGLLGEYDALSGLNQQSGALQCMPSSDSPGMNGHGCGHHLLGTAAHLAALAVQQHLRTHKLPGRIRFYGCPAEEGGSGKTFMARAGAFTDLDAALTWHPSSHTGIFDQSTLANIQASFVFKGRAAHAANAPHLGRSALDAVELMNVGCNYLREHMPPSARVHYAVTDSGGMSPNVVQARAEVLYLIRAARNIDAAELYERVQNVARGAALMTGCEVDIRFDKACSNLLQNTTLNQVMYTQMQHLGRLPVGEKEREQARQHHATLGASDIEEAGRSLSSALRGQVTELFDGIKDYDPAREELLYGSTDVADVSWVTPTAQAWVACYAFGTPFHSWQMVSQGKTSLAHVGMLQAAKILAATAIELLSKPDMLAAARQELQARREGKPYTCPIPAEIPLPFRRS
>NZ_CP021362.1|WP_086927188.1|2138616_2139606_+|ABC-transporter-substrate-binding-protein
MTRLSPRALTRRLSLLALGLLPLAALAQSDFPSKPVKLVVPFAAGGSTDLVARVIADGLRTTLGQAVVVDNRAGAGGLLGTEVVSQAAPDGYTIGMATASTMTVNPALYPRAEAINAKLQPLVNLVSMPSVYMVHPGMGVKDFAGFVTALKAKPNHYSAAVPGVGSLGQLMVESFNDTVGVKMANVPYRGSGPALNDALAGVVQIMPDQIPSAMPHIKSGKLLPVAVASSRRITELPDVPTFKELGYPELNDLGISWFGLVIPAKTPPAIAEKLRAAAIQAVHAPETLARLQKMGVSLTDGKSEDFPALIATQVKRNRAIVQKAGIKPE
>NZ_CP021362.1|WP_086928699.1|2137441_2138386_-|LysR-family-transcriptional-regulator
MGKVLFARMATHGRLRQLHLLVVLEDCGSIVRAAAQLHMSQSAATQALAEFERVVGMRLFDRHARGIRPTPAGHALTSAARSAMAGLAEAAESLAAIRQGAATALRLGAIPAAAYALVSGLLGSFYATHPNVHLELQEDTGARLLPLLTAGGLDAVFCRAPQSLPEGFVFEPLLDDDVVIVAAANHVLAGRPHLPLGALTGMRWILPVMNIQLREIFETQVLGVLRDAQWFPVSTLSLPVLEGLLQQPHAVSLLPRSILAGLQTSSRVCRLDVDLWAPLAPLGVAYLQASPPMLLQALLAPARQARVLVGVPGT
>NZ_CP021362.1|WP_086927190.1|2135936_2136377_+|TfoX/Sxy-family-protein
MPARPLSDETLHLIDAVRAALAQRNDVEERTLFGSYCFFVNGKLCVGVKGDELLVRLPPARHAEFQEMQATRELSPEGKMQGYFWVEPNGYATRAQWNFWLHEALAYNPLAKATPPRKRGTAATRPAPTVSTSKDKRHSIFDDDAP
>NZ_CP021362.1|WP_094122633.1|2149677_2150118_+|biopolymer-transporter-ExbD
MHEFPPRAKDEPEINLIPFIDVLLVILIFMMLTTTYSKFTELQLTLPVADAEQQRDHPKEVIVAVAADGRYAVNKTAVDGKSVDAVARALGQVASAGQGSVVIISADATAPHQAVVTVMEAARRVGLSQITFATQSSASARAGNGR
>NZ_CP021362.1|WP_094122705.1|2150203_2151196_+|tetraacyldisaccharide-4'-kinase
MARIWRSRGPAAWALWPLSLVYGALVALRRWLYRLQVLRSEHPGPPVIVVGNVIAGGAGKTPVVIALVRHLQAQGWQPGVISRGYGRSTHDCRAVRPDSPAQEVGDEPALIARATHAPVFVAPRRITAARALLAAHPGTNILVCDDGLQHLALARDLEICVFNSDGMGNGFLLPAGPLREPWPRPVDWVLHAGTRPAGHNPSFALQRRLAPHALRADGRQVPLASLRGGPVHAVAAVARPAEFFAMLRAQGLQLSSTEALPDHYDFNSWKRPSDKHITLICTEKDAVKLWPLHPDALAVPLMLELDPAFFAALDARLAPWRAAPLSSPSA
>NZ_CP021362.1|WP_026436501.1|2151215_2151398_+|Trm112-family-protein
MDPKLLELLVCPVTKGPLTYDRERQELVSRSARLAYPVRDGIPVLLENEARTLTDEELEA
>NZ_CP021362.1|WP_086927176.1|2151394_2152201_+|3-deoxy-manno-octulosonate-cytidylyltransferase
MIPTAATGFTVLIPARMASSRLPDKPLADIAGLPMVVHVARRAAQSAAARVVVAADDPRILHACQAHGVQALLTRTDHASGSDRLAEACMQLGLDGDAVVVNVQGDEPLMDPALIDAVAALLPARPEASMGTAAHAIHTRTDYENPNVVKVVLDARGLAHYFSRAPIPHARDHAGQAWWQGAAAQAAPSVAALHGFAPLRHIGIYSYRAGFLRQFPGLAQAPTEAVEALEQLRALWHGHRIAVHIADQAPGPGVDTPADLDRVRTLLA
>NZ_CP021362.1|WP_086927175.1|2152359_2153016_+|adenylate-kinase
MRLILLGAPGAGKGTQATFICQKYGIPQISTGDMLRAAVKAGTPLGLQAKAVMDSGALVSDDIIIGLVKERITQPDCANGFLFDGFPRTIPQADAMKDAGVKLDYVLEIDVPFDAIIERMSGRRSHPASGRTYHVKFNPPKVAGKDDVTGEDLIQREDDKEETVKKRLQVYSDQTRPLVNYYSNWAKAEPNAAPKYRAISGTGSVEEITARALQALSS
>NZ_CP021362.1|WP_086927174.1|2153083_2154031_-|asparaginase
MSSQKIVVLGTGGTIAGKAATQEDNIGYTAAQVGLEQLLHAVPGLQAAACGGLVAEQIAQLDSKDMEFSVWRLLAERCARALADPLVRGLVITHGTDTLEETAWFLQSVLDAHKPVVLTCAMRPATALTPDGPQNLLDAVAVAMTAGARGVVVVAAGAVHGAQRFQKVHPYRVDAFSSGDAGPLGWVEEGVVRLVQNWPKAQSGKAQCAIEKIVNCTHWPRVEVVMSYAGATGALVDSLVRDGVQGIVVAATGNGTIHQALESALLRAQAAGVKVVRSTRCPEGQVLPKPGDALPDSRGLSAVKARIALMLQLLP
>NZ_CP021362.1|WP_086912315.1|2154130_2154805_+|transcriptional-repressor-LexA
MLDNPKLTARQQQILDLIQVAISRTGAPPTRAEIATELGFKSANAAEEHLQALARKGVIELVSGTSRGIRLRSDTVRSINAARGTQFSLPMPGLSQLVLPLIGRVAAGSPILAQEHVDQTYSVENSLFQHKPDYLLKVRGMSMRDAGIMDGDLLAVQSTREARNGQIVVARLGDDVTVKRLRRTAGAIELLPENPDYPVIVVQPGEAFEIEGLAVGLIRNTMLM
>NZ_CP021362.1|WP_086912314.1|2155493_2156501_+|D-2-hydroxyacid-dehydrogenase-family-protein
MNIVILDDYQDAVRKLHCASRLDPYSAKVYTNTVKGQGQLAVRLKDADIIVLVRERTQITRQLVEKLPRLKLIAQTGKIGSHIDVTACTERGIAVAEGVGSPVAPAELTWALVMAAMRRLPQYIANLKHGAWQQSGLKAASMPPNFCLGSVLRGKTLGIWGYGRIGQLVAGYGRAFGMNVRVWGRDASRAQALTDGYQAATNREEFFSQCDVLSLHLRLNDETRGIISLEDLSCMKPTALLVNTSRAELIEPDALIAALNRGRPGLAAVDVFESEPILQGHALLRLENCICTPHIGYVEQDSYELYFGAAFDNVVNYIKGTPTNIVNPGALQVRR
>NZ_CP021362.1|WP_086912313.1|2156624_2157755_-|branched-chain-amino-acid-ABC-transporter-substrate-binding-protein
MQLKLKLTVVAAIAAVAGMASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQGITIGGKKIKFELQAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGIPHVTGAATNPNLTKPGYKTTFRIIANDNALGAGLAFYAADTLKLKTVAIVDDRTAYGQGVANVFKKVAAEKGMKVVDEQFTTDKATDFMAILTAIKSKNPDAIFFGGMDPQGGPMLRQMEQLGMGNVKYFGGDGICTSEIAKLAAGAKTLSNVVCAEGGASLDKMPGGKAWKAKYDAKYPGQFQVYSPYTYDATHLIVDAMKRANSVDPKVYTPELLKSQFKGVTSTIAFEPNGEMKNPAITLYVYKDGKKTPLN
>NZ_CP021362.1|WP_094122634.1|2157886_2158378_-|hypothetical-protein
MDVPPAQAAPRFVPTLTEVVQGPDVLPVSVPLAQHGPSSRGGASTIAQTAPSLHASASIPAAPVPSMDKTVRGTSGTKPVQTSPTPRRPLPDGMEEYMVHRVMQRVDVLLDQRLREAIALVIQEQTRSVLPRLREEIESVVRHAVYEAVADELASGNPTECGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1415543 : 1487190

Klosneuvirus(13.33%)

portal,integrase,capsid,head,tRNA,protease

attL 1435271:1435288|attR 1458802:1458819

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157896749.1\|1415543_1416575_-\|integrase	tyrosine-type recombinase/integrase	A0A0M4R586	Salmonella_phage	6.5e-21	30.7
WP_086912730.1\|1416893_1417901_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	2.3e-47	35.6
WP_086928760.1\|1418059_1420774_-	aminopeptidase N	NA	NA	NA	NA
WP_157896466.1\|1420792_1421897_-	peptide chain release factor 2	NA	NA	NA	NA
WP_086928759.1\|1422073_1422997_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_086927634.1\|1423178_1424240_+	aldo/keto reductase	NA	NA	NA	NA
WP_086927633.1\|1424302_1424806_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_086927632.1\|1424856_1425510_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_086927631.1\|1425578_1426604_-	phosphodiesterase	NA	NA	NA	NA
WP_086927630.1\|1426614_1427265_-\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_024814772.1\|1427327_1427813_-	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_086927629.1\|1427886_1428960_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_086927628.1\|1429086_1430421_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	2.6e-54	81.7
WP_086912721.1\|1430491_1430809_-	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_086928758.1\|1431769_1432156_-	ArsC family reductase	NA	NA	NA	NA
WP_086927625.1\|1433551_1434421_+	sporulation protein	NA	NA	NA	NA
WP_086927624.1\|1434464_1434953_+	CvpA family protein	NA	NA	NA	NA
WP_086927623.1\|1435026_1436532_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.1e-84	41.6
1435271:1435288	attL	NA	NA	NA	NA
WP_086927622.1\|1436629_1438045_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_086927621.1\|1438968_1439727_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_086928757.1\|1439868_1440921_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_086927620.1\|1441257_1443750_+	DEAD/DEAH box helicase family protein	A0A0E3JPC8	Verrucomicrobia_phage	5.5e-05	26.9
WP_086927619.1\|1443752_1444238_+	SHOCT domain-containing protein	NA	NA	NA	NA
WP_086927618.1\|1444244_1445726_+	SAM-dependent DNA methyltransferase	A0A1V0SLK8	Klosneuvirus	3.7e-33	29.1
WP_086927617.1\|1445737_1447456_+	hypothetical protein	NA	NA	NA	NA
WP_086927616.1\|1447468_1449370_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_157898415.1\|1449547_1450264_+	hypothetical protein	NA	NA	NA	NA
WP_086927614.1\|1450732_1451455_+	PEP-CTERM sorting domain-containing protein	NA	NA	NA	NA
WP_086927613.1\|1451638_1451851_+	hypothetical protein	NA	NA	NA	NA
WP_157896748.1\|1452053_1452785_-	hypothetical protein	NA	NA	NA	NA
WP_157896747.1\|1453368_1454040_-	hypothetical protein	A0A0S2SYC0	Pseudomonas_phage	9.2e-16	48.5
WP_157898416.1\|1454458_1454944_-	hypothetical protein	NA	NA	NA	NA
WP_094122608.1\|1454952_1455471_-	hypothetical protein	NA	NA	NA	NA
WP_086927606.1\|1455570_1456815_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	3.7e-95	47.2
WP_086927605.1\|1457225_1458959_+	Kef family K(+) transporter	NA	NA	NA	NA
1458802:1458819	attR	NA	NA	NA	NA
WP_086912704.1\|1463200_1464862_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	8.3e-42	26.7
WP_086927603.1\|1464921_1467360_+	DUF1631 family protein	NA	NA	NA	NA
WP_086927602.1\|1467403_1468726_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_086927601.1\|1468759_1469764_-	P1 family peptidase	NA	NA	NA	NA
WP_094122702.1\|1469808_1472106_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.3e-81	35.2
WP_086927600.1\|1472268_1472670_-	copper-binding protein	NA	NA	NA	NA
WP_086927599.1\|1472666_1473197_-	DUF411 domain-containing protein	NA	NA	NA	NA
WP_086927598.1\|1473240_1473738_-	cupredoxin family protein	NA	NA	NA	NA
WP_086927592.1\|1478487_1479288_+	ABC transporter permease	NA	NA	NA	NA
WP_086927591.1\|1479322_1480327_+	MCE family protein	NA	NA	NA	NA
WP_086927590.1\|1480323_1481016_+	hypothetical protein	NA	NA	NA	NA
WP_086912689.1\|1481104_1481287_-	hypothetical protein	NA	NA	NA	NA
WP_086927588.1\|1483342_1483825_-	TerS protein	A0A0F7L441	uncultured_marine_virus	1.2e-25	45.7
WP_157896746.1\|1483821_1484277_-	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	3.7e-08	47.0
WP_086927587.1\|1484254_1485424_-\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	2.9e-73	43.9
WP_086927586.1\|1485432_1485957_-\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	5.8e-26	43.7
WP_094122611.1\|1485966_1487190_-\|capsid	phage major capsid protein	R9TPU0	Vibrio_phage	1.2e-29	30.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021364

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021363

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP021362

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection