CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021427	Lactobacillus gasseri strain 4M13, complete genome	2 crisprs	cas3,cas2,csa3,DEDDh,cas9,cas1,csn2,WYL,DinG	0	6	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021427_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021427_1

1744290-1744919

TypeII

Consensus_repeat	Method
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	PILER-CR
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	CRISPRCasFinder
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	CRT

9 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP021427_1

>merge|NZ_CP021427|1|1744290-1744919|PILER-CR,CRISPRCasFinder,CRT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCGCTTATTTCATTAAGTAGGTGATGCAGATGGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCGAAATTGGTGTCCCTCCCAAGTCAATGCACGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCGAGAGCTTGGTTTAAGTCCTCGCGCTAGAAGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCTTTAAGTAATTTTCCAATGACACCAGCATTGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCCAAAGAATTAAACAGATAGTAGGTGATTAGGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCTATCGCATTATTCATCGTATCCATACCCGTGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCTATCGTCGGTACGAGTTGTAATGCTGAATAGTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATCTTTGCATAATTAATGAAATCAGCGACAACAGTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATCAGTTAATCAAAGAAGGCGGACAAAAAGGCGGTTTTAGATGGTTGTTAGATCAATAAAGTTATTAGT

>NZ_CP021427|1|1|1744290-1744853|PILER-CR
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GCTTATTTCATTAAGTAGGTGATGCAGATG
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GAAATTGGTGTCCCTCCCAAGTCAATGCAC
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GAGAGCTTGGTTTAAGTCCTCGCGCTAGAA
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TTTAAGTAATTTTCCAATGACACCAGCATT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	CAAAGAATTAAACAGATAGTAGGTGATTAG
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TATCGCATTATTCATCGTATCCATACCCGT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TATCGTCGGTACGAGTTGTAATGCTGAATA
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TTTGCATAATTAATGAAATCAGCGACAACA
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC

>NZ_CP021427|1|1|1744290-1744919|CRISPRCasFinder
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GCTTATTTCATTAAGTAGGTGATGCAGATG
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GAAATTGGTGTCCCTCCCAAGTCAATGCAC
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GAGAGCTTGGTTTAAGTCCTCGCGCTAGAA
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TTTAAGTAATTTTCCAATGACACCAGCATT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	CAAAGAATTAAACAGATAGTAGGTGATTAG
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TATCGCATTATTCATCGTATCCATACCCGT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TATCGTCGGTACGAGTTGTAATGCTGAATA
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TTTGCATAATTAATGAAATCAGCGACAACA
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	AGTTAATCAAAGAAGGCGGACAAAAAGGCG
GTTTTAGATGGTTGTTAGATCAATAAAGTTATTAGT

>NZ_CP021427|1|1|1744290-1744919|CRT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GCTTATTTCATTAAGTAGGTGATGCAGATG
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GAAATTGGTGTCCCTCCCAAGTCAATGCAC
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	GAGAGCTTGGTTTAAGTCCTCGCGCTAGAA
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TTTAAGTAATTTTCCAATGACACCAGCATT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	CAAAGAATTAAACAGATAGTAGGTGATTAG
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TATCGCATTATTCATCGTATCCATACCCGT
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TATCGTCGGTACGAGTTGTAATGCTGAATA
GTTTTAGATGGTTGTTAGATCAATAAGGCTTAGATC	TTTGCATAATTAATGAAATCAGCGACAACA
GTTTTAGATGGTTGTTAGATCAATAAGGTTTAGATC	AGTTAATCAAAGAAGGCGGACAAAAAGGCG
GTTTTAGATGGTTGTTAGATCAATAAAGTTATTAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021427.1\|WP_087261458.1\|1743286_1743628_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP021427.1\|WP_020807048.1\|1749369_1749810_+\|8-oxo-dGTP-diphosphatase	unknown	unknown	gnl\|CDD\|239519
NZ_CP021427.1\|WP_113533095.1\|1732084_1732252_-\|DUF3938-domain-containing-protein	unknown	unknown	gnl\|CDD\|372462
NZ_CP021427.1\|WP_003647166.1\|1734129_1735167_+\|dTDP-glucose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224013
NZ_CP021427.1\|WP_020807046.1\|1750688_1751093_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_020807053.1\|1742400_1743309_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP021427.1\|WP_020807044.1\|1751769_1752573_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369870
NZ_CP021427.1\|WP_065169685.1\|1749839_1750499_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|370635
NZ_CP021427.1\|WP_024273054.1\|1746060_1747110_-\|IS30-like-element-ISLga1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP021427.1\|WP_020807056.1\|1735173_1736058_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP021427.1\|WP_003647168.1\|1736090_1736699_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	unknown	unknown	gnl\|CDD\|376414
NZ_CP021427.1\|WP_020807043.1\|1752641_1753994_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP021427.1\|WP_020807049.1\|1747284_1748202_+\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320699
NZ_CP021427.1\|WP_020807045.1\|1751169_1751553_+\|DUF1828-domain-containing-protein	unknown	unknown	gnl\|CDD\|378071
NZ_CP021427.1\|WP_020807050.1\|1745568_1745994_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP021427.1\|WP_087261412.1\|1743588_1744257_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP021427.1\|WP_020807055.1\|1736715_1737702_+\|dTDP-4-dehydrorhamnose-reductase	unknown	unknown	gnl\|CDD\|367904
NZ_CP021427.1\|WP_020807054.1\|1738034_1742195_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP021427.1\|WP_003648682.1\|1748406_1749246_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275056
NZ_CP021427.1\|WP_020807057.1\|1732872_1734048_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|133381

Protein	Function_ID	Function_description	E-value
NZ_CP021427.1\|WP_087261458.1\|1743286_1743628_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	3.55686e-26
NZ_CP021427.1\|WP_020807048.1\|1749369_1749810_+\|8-oxo-dGTP-diphosphatase	gnl\|CDD\|239519	cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily. MTH1, the mammalian counterpart of MutT, hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP and 2-hydroxy-ATP, to monophosphates, thereby preventing the incorporation of such oxygen radicals during replication. This is an important step in the repair mechanism in genomic and mitochondrial DNA. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for activity, and contain the Nudix motif, a highly conserved 23-residue block (GX5EX7REUXEEXGU, where U = I, L or V), that functions as a metal binding and catalytic site. MTH1 is predominantly localized in the cytoplasm and mitochondria. Structurally, this enzyme adopts a similar fold to MutT despite low sequence similarity outside the conserved nudix motif. The most distinctive structural difference between MutT and MTH1 is the presence of a beta-hairpin, which is absent in MutT. This results in a much deeper and narrower substrate binding pocket. Mechanistically, MTH1 contains dual specificity for nucleotides that contain 2-OH-adenine bases and those that contain 8-oxo-guanine bases.	5.89495e-49
NZ_CP021427.1\|WP_113533095.1\|1732084_1732252_-\|DUF3938-domain-containing-protein	gnl\|CDD\|372462	pfam13074, DUF3938, Protein of unknown function (DUF3938). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 130 amino acids in length.	0.000123607
NZ_CP021427.1\|WP_003647166.1\|1734129_1735167_+\|dTDP-glucose-4,6-dehydratase	gnl\|CDD\|224013	COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane].	0
NZ_CP021427.1\|WP_020807053.1\|1742400_1743309_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	3.3563e-104
NZ_CP021427.1\|WP_020807044.1\|1751769_1752573_+\|hypothetical-protein	gnl\|CDD\|369870	pfam08428, Rib, Rib/alpha-like repeat. The region featured in this family is found repeated in a number of bacterial surface proteins, such as Rib and alpha. These are expressed by group B streptococci, and Rib is thought to confer protective immunity.	1.413e-19
NZ_CP021427.1\|WP_065169685.1\|1749839_1750499_-\|hypothetical-protein	gnl\|CDD\|370635	pfam09726, Macoilin, Macoilin family. The Macoilin proteins has an N-terminal portion that is composed of 5 trasnmembrane helices, followed by a C-terminal coiled-coil region. Macoilin is a highly conserved protein present in eukaryotes. Macoilin appears to be found in the ER and be involved in the function of neurons.	1.60943e-05
NZ_CP021427.1\|WP_024273054.1\|1746060_1747110_-\|IS30-like-element-ISLga1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	9.19552e-76
NZ_CP021427.1\|WP_020807056.1\|1735173_1736058_+\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	4.50555e-175
NZ_CP021427.1\|WP_003647168.1\|1736090_1736699_+\|dTDP-4-dehydrorhamnose-3,5-epimerase	gnl\|CDD\|376414	pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase. This family catalyze the isomerisation of dTDP-4-dehydro-6-deoxy -D-glucose with dTDP-4-dehydro-6-deoxy-L-mannose. The EC number of this enzyme is 5.1.3.13.	1.94051e-98
NZ_CP021427.1\|WP_020807043.1\|1752641_1753994_-\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	2.41504e-33
NZ_CP021427.1\|WP_020807049.1\|1747284_1748202_+\|M48-family-metalloprotease	gnl\|CDD\|320699	cd07340, M48B_Htpx_like, Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase. This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.	4.18177e-97
NZ_CP021427.1\|WP_020807045.1\|1751169_1751553_+\|DUF1828-domain-containing-protein	gnl\|CDD\|378071	pfam08861, DUF1828, Domain of unknown function DUF1828. This presumed domain is functionally uncharacterized.	4.64988e-14
NZ_CP021427.1\|WP_020807050.1\|1745568_1745994_+\|hypothetical-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	1.77752e-20
NZ_CP021427.1\|WP_087261412.1\|1743588_1744257_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.53034e-66
NZ_CP021427.1\|WP_020807055.1\|1736715_1737702_+\|dTDP-4-dehydrorhamnose-reductase	gnl\|CDD\|367904	pfam04321, RmlD_sub_bind, RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.	8.6755e-101
NZ_CP021427.1\|WP_020807054.1\|1738034_1742195_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	1.57146e-129
NZ_CP021427.1\|WP_003648682.1\|1748406_1749246_-\|hypothetical-protein	gnl\|CDD\|275056	TIGR04211, hypothetical_protein, SH3 domain protein. Members of this protein family have a signal peptide, a strongly conserved SH3 domain, a variable region, and then a C-terminal hydrophobic transmembrane alpha helix region.	3.93002e-06
NZ_CP021427.1\|WP_020807057.1\|1732872_1734048_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	2.55816e-39

>NZ_CP021427.1|WP_087261412.1|1743588_1744257_+|type-II-A-CRISPR-associated-protein-Csn2
MLLSYLSHKKMVMKNSGIKVIATSSPIVYRDVVQSFQGKKDMLLSSDDDYNQLNIIKDFDFIADPVLNQNIFDKYMPVIIKEYIEVLNEADRNEILKTYHKLEGIIQDSLLLEDLPLELEFNENLKKFLKLENLHLDTKFLEEPYAIIESILKIHQNYNLHSIPVACNVAHYLNLAQVGMLNDLLKEMKLKLILIEFTSADFLFFPKDVDYFYIDQDLVDWY
>NZ_CP021427.1|WP_087261458.1|1743286_1743628_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPVDTASERREYRQFRKRLINEGFLMIQYSIYERVCVSRKTATFLENRIKSFLPTSGVVQSLMVTEKQYNDMHFLVGNPVDDVRNSSDRTVILCFYLIYLIKRWL
>NZ_CP021427.1|WP_020807053.1|1742400_1743309_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRSVIITQHAKLTYSMNMMIVQTKDGINQIPISDINLLLVSTSQAVITSALISKLAENQSKIIFVDAKYQPVSETIDYYPNSRSLAKLKSQFNWDEKRKELLWTKIVARKIQNQIKALQNYNLVWDDVQNELDQMELNDSTNREAAAARKYFINMFGKDFIRRNSGVINAALDYGYAILLSAFNREIAVNGYLSYLGIHHHSQENQFNLGSDLMEPFRPFVDYWVKAHENIDEFTPDIKFGLVELLSLEIKFNGRKTLLSNAITVYVRDCLRFLSGEIDKVKIEMELTDEVPNDAINDNV
>NZ_CP021427.1|WP_020807054.1|1738034_1742195_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MTKIKNEYIVGLDIGTNSCGWVAMDFQNTILRMHGKTAIGSHLFDAGNSAADRRAFRTTRRRIKRRKWRLKLLEEIFDPYMTEVDPYFFARLKESGLSPLDKRKNASSIVFPTALEDKKFYCNYPTIYHLRYDLMSEDKKFDLREIYLAIHHIVKYRGNFLYNTPVKDFEASKIDVKDSLEKLNELYERLDSEFTVELDSSNALEIEKIIRDKNVFKINKVKSIHQLLSLKTENKERTKLIKDVSKQIINAILGYKTKFETILLKNISKDEADDWEFKLTDVDADNKFENLIGDLNENEQEILLVIRNLANAITLSNIVEEGKTLSESMIDKYNKHSDDLKLLKQVISDHPDRDKAKKLALAYDLYVNNRHGKLLQAKDVLGSKKTLSKEDFYKEVKKNLDDSKASQEILDAIALDSFMPKQRTNENGVIPYQLHQLELDRIIKNQGKYYPFLKEANPVSSHLKQAPYKLDELIRFRVPYYVGPLISPNESTKNKQTKKNQNFAWMIRKEQGQITPWNFDQKVDRMASANKFIKRMTTKDTYLLGEDVLPANSLLYQKFTVLNELNNIKINGKRISVPLKQELYNNLFKKNSTVTTNKLKSYLKENYNLINVEIKGLADEKKFNSGLTTYNKLRNLKIFDQQIDDLNYDKDFERIIEWSTIFEDKAIYKDKLKTIKWLSDRQIDKLSKIRMQGWGQLSKKLLSQLTDNNGQTIIEQLWDSQNNFMQIVNQADFKDAIAVANQNLLVNTSVEDILNEAYTSPANKKAIRQVVKVVDDIVKAASGKVPKQIAIEFTRDADDKAKISQTRANKLRKVYKELSNELASEAIRNELERVAKDQKLLKDKYYLYFMQLGRDAYTGEPIDIDELEQYDIDHILPQSFIKDDSLENRVLVKKAVNNGKSDNVPVKLYGNHMAADLGITIRHMWEKWKDQGLITKTKYNNLIIDPDKINKYESSGFIHRQLVETSQIIKLASTILQSKYPDTEIIVVKARYNHYLRKHLNLYKSREVNDYHHAIDAYLSAICGNLLYQVYPYLRPFFVYGQYKKFSSDPKKEKIIYDKTRKYNFISQIFENKGNDIISLETKKKVFDKKDIIEKLKHAYDYKYMLVSRETETRDQEMFKMTVYPRLSRDTKKSRNLIPKKKDMPTEIYGGYTNNSDAYMVIARINKKKETEYRVFGVPMRELVNLRKAEKKGHYNAYLKQVLEPEIMYNKNGKKNKTISSFEIVKSKVPYKQVILDGDKKFMLGSSTYVYNAKQLTLSQDAMQAITDNCENDTDEEKALIEAYDEILTNIDKYLPLFDINKFRDKLHAGREKFINLSLDVKKDTILQVLNGLHDNAVMPKIKSLGLSTELGKLQIPTGVKLSENAKLIYQSPTGLFEKRVKISDL
>NZ_CP021427.1|WP_020807055.1|1736715_1737702_+|dTDP-4-dehydrorhamnose-reductase
MKVFVTGVNGQLGHDVMNELAKRGYEGVGSDLAPEYAGVADGSSVTKAPYVSLDITDAKAVNKVISEVNPDVIVHCAAWTAVDMAEDDDKVAAVRKVNVDGTQNIANVAKKLDAPMVYLSTDYVFDGQGTTPWEPDFKGYKPLNVYGETKLGGEEAVANTLDKYFIVRIAWVFGVNGSNFIKTMLKVGSNHDEVKVVSDQIGTPTYTFDLARLLVDMIETDKYGYYHATNSELPATESGYDENGTKTGYISWYDFTKEIYRQAGYKTKVTPVTTEEYGLSKAVRPFNSRLDKSKLEKNGFKPLPTWTDAISRYLDILKDDGFFDELKK
>NZ_CP021427.1|WP_003647168.1|1736090_1736699_+|dTDP-4-dehydrorhamnose-3,5-epimerase
MGQIKVEKNVGGIEGLAVITPTVHGDDRGYFMETFNQRDMMDAGFSINFVQDNQSSSTKGVLRGLHFQKKYPQIKLVRAVRGSVFDVAVDLRSESKTYGKWYGVELTAENKKQFLIPQGFAHGFLVLSDVAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPHLKGDYPGSPDASGYTLDDGTKLNMAERDQEWKGLKDTFKF
>NZ_CP021427.1|WP_020807056.1|1735173_1736058_+|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGIILAGGSGTRLYPLTLVTSKQLLPVYDKPMIYYPLSTLMLAGIKDILVISTPADTPRFKELLGDGSQFGVNLSYKVQPTPDGLAQAFTLGEDFINGEPCAMVLGDNIFYGNGFTDLLKNAAEDAQKGKATVFGYYVNDPERFGVVDFDKNGNAISIEEKPEHPKSNYAVTGLYFYPAGVSEKAAQVKPSARGEVEITSLNDMYLQDGDLGVQLLGRGYAWLDTGTMQSLVDASNYVKMIEERQGVSVSAPEEIAYVHGWIDKDQLLEAAKHYGKSPYGKHLKSVAEGKVRY
>NZ_CP021427.1|WP_003647166.1|1734129_1735167_+|dTDP-glucose-4,6-dehydratase
MKVIVTGGAGFIGSNFIFYMLKKHPDYEIICLDSLTYAGNLSTLKDVMDNPNFKFVKLDIRDREGVYKLFEEEKPDVVVNFAAESHVDRSIENPEIFLETNIIGTSVLMDACRKYGIKRFHQVSTDEVYGDLPLDRPDLFFHEDTPLHTSSPYSSSKASADLLVGAYGRTFHLPVTISRCSNNYGPYQFPEKLIPLMIQRALNNEKLPVYGDGKNVRDWLYVEDHCKAIDLILEKGTPGEVYNIGGHNEMHNIDIVKLICDYLDKPYSLIEHVTDRKGHDRRYAIDPEKIHNELGWLPETMFKDGIKKTIQWYLDNKEWWENIISGDYQNYYDEMYGKKQVLDKD
>NZ_CP021427.1|WP_020807057.1|1732872_1734048_+|methyltransferase-domain-containing-protein
MPKYYTSGEFAKKAHVSIRTIRYYDQKNLLKPSTHTASGARRYTDTDFAKLQQILLLKYLGFSLSDIREMTLGSGDRQLLLDSLQIQKRLVEERLKEMQNVATAIDSTSSTLKAGQEVDWSKMLNLIHLTSMNQSLSTQYQNASNISARIRLHRDYSLNKEGWFHWLFKQLDLKPGMKILELGAGNGALWSQNLDKLPKGLTIVLSDISEGILADAKNEIGDNSEFQYAIFDAQKIPFADNTFDLVIANHMLFYCDDIPKTLKEVRRVMKKGASFACATYSKRHMHEITDLVQEFNPEIVLSSTNLYDRFGLDNGAEILSKDFTDVSCHKYQDAIELSESTPVISYILSCHGNQNAILLDHYNEFKNYVDEKVSGGFHITKDVGYFICKKT
>NZ_CP021427.1|WP_113533095.1|1732084_1732252_-|DUF3938-domain-containing-protein
MCQSKLLLKIITFFIFTPEEDSQSIVLFTVISTIGDILIYSSCDYDYTVLISTNR
>NZ_CP021427.1|WP_020807050.1|1745568_1745994_+|hypothetical-protein
MSIYRNDDVLITDLMDRIDKLENQVTDLKKVFYKQSGESHSTFLYGCEVRGSDYLHLEDKVIPRLKENDPVLLIREADNKYDKNAISVATPAGLKLGYIPREHNLIFSRLIDSGNLLFGRVKNFHWDGKNFELVIKVYLAN
>NZ_CP021427.1|WP_024273054.1|1746060_1747110_-|IS30-like-element-ISLga1-family-transposase
MDSLHSTMNQHVKGKHLSFEERVIIQLRLKDGCSLRAIARELNCSPSTISYEIKRGTVKLYHGKVKRYKATQGHDVYQAHRKNCGRKSDFLKKTQFIHYVHKHFFKDGWSLDVCSNRATAAGEFSSSDVVCTKTLYNYVDKGLLGIYNYDLPEKLKRNTKLHRVRKNKKKLGRSIEERPKEISERNEFGHWECDLVLGHKTKDDEVLLTLSERMSREFLIIRIPDKTSISVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEEASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQNIIDIETWCNSLPRKILAYHTPDEIFERELDRIYQAA
>NZ_CP021427.1|WP_020807049.1|1747284_1748202_+|M48-family-metalloprotease
MLYKQIEQNKRNTWIILGLYTALLLILSIFLGMIFTKYVGIGFFIIGLIYIAHVYFDATQHLMKVTNAVEITKESDPEIYELVEELCLAGGLPVPKIYITPDSDPNAFATGRDPEHASLALTQGLLSMMNKKEVQGVIGHELSHIRNYDTRITVLASALTSLITITGIGIVLFGWGVLTSESKGWLGLIIKFFAMFLIIVGGIISIIGIPLAKLLFLLVSRQREYLADIGSVDLTREPSGLISALSKLEKMEESESTPEINSQDLALEHLYFNLPHPGNWIDRLFSDHPPLDKRIERLKNSDKIE
>NZ_CP021427.1|WP_003648682.1|1748406_1749246_-|hypothetical-protein
MTLQINTRVDSITWPLNQNLTNQEIISQLELTVTENGQLISNDNLSINKKAVNRSEAGVYPVIITAIGSNNEYATKKIQAWVTDKNNVNSATRPPVQPTPAPQYKTPSQTPSPKKKSKKKVVYIVLGVLVLLIAIIFGISACQAHNDTVQNEQAQSNALNNTNSKLDNLSEQNKQLMQQNKELQNAINNYKQDQNKEELQNQLDQIKNENQQLKNNAANNQALQNQIDQLGSTIDQIKQNPNQADSLLNQMKNNQNEFMQNLNATFQKLVSDFQQLIGK
>NZ_CP021427.1|WP_020807048.1|1749369_1749810_+|8-oxo-dGTP-diphosphatase
MKRSEPVTLTNMCMIKKKDKILVLDRNDPVWPGLTFPGGHVESHESFHDSVVREIKEETGLLIKNPHLVGVKQFFDKNDERYLVFFYVATEFTGTVKASDEGKLTWMTKEELTSKKLAYNFDHDLPVFFDKNLSEHLLDEKIDQTY
>NZ_CP021427.1|WP_065169685.1|1749839_1750499_-|hypothetical-protein
MEEFNLKKLIVGALSCGLLLLAGCRNNLVEPKHKSSADDYAIIQSSSHKKSHKKVEQPKKKSEDKKKKDKDKDKSKDENKKMDVQIDTLNKNENSSSSEAQSSSSALPSLNSSKRENSTETNRSLKSNFGTSLYTLPRQNYSYYTPKSNYYYSNNWSTNNNTGSSHQNSAVSNSKSEPSTSTSSSSSNDASTSTEEKQSPTTQNNDSNSSESSEDVQND
>NZ_CP021427.1|WP_020807046.1|1750688_1751093_+|hypothetical-protein
MYDLEDVMMKSFRDDNGISSAFSIEPVDDNEYRVSTNVVDGLNDMIHFNLIVYPNGTYALNDRVFTARMIDDNIGSFSSIAADVARLASEFGVLLDDRGELTRDYINSRDLRSEVNNFTQLLNRVVEFAQLNRY
>NZ_CP021427.1|WP_020807045.1|1751169_1751553_+|DUF1828-domain-containing-protein
MEESELKLIKHASFDWLKQNIQFIQAGEDIEVATPLIGAYGDLVYCWIEKEKNGAYRITDDGGTLFKLDPAQENLDLLEEAADIVIGAGFEFDEDNSEIYQIVDLENMAQTLSDLTQLQVALTYLAS
>NZ_CP021427.1|WP_020807044.1|1751769_1752573_+|hypothetical-protein
MMRQIKKRNIMTGLGTAALLASLSLNGTAFAASTDSVNAGAEQAKTYQTQLEQHKNLQAYTNPLSVKTLTTTKGVLPDATSGISNWSTVPAGTVANWDKTPEINKVGTSYGTVYVTFPDGSRSRLAVYVTVKDTAVSQDSKASKKDLNNGSATSATDQQDNASKQTTSVKKDVAKENTSKNSSEKTNKDVVVKDLGSTTVTEKNVSVVNNTKDNKKNSKKSSNPVSVATQLPETEGKAVNPLVVIGGLLVAAIGAVAIFGKKIKNRL
>NZ_CP021427.1|WP_020807043.1|1752641_1753994_-|APC-family-permease
MTNNNSVPKKLSFISIYFLGINAVIGSGTFLLPSVIYRYMNLTAILVLLCTAVTVSMIALCYADLSSRFTQSGAAWLYSYNAFGRFAGYELGIFTWFLGCTTLSAEVVALLTVLKSFLPIFKNNAVYIGSIIFLILLFSVINFFGRSWVKIVNNISAAAKIITLIVFIIIGAFFIKKSNFTPVIPHAALTGVTPFFKHFGDAFTPIFYLFTGFSFIPIAAKQMNNPEKNIPRVLVAVMTSVTILDCLMLLVAIGLSGQKLGSYSNPLASALKTGVGQWGFAFMIIGMLISIFGVAFSASFNTPSLIASLANEHGMLPKWIGKKNKHDAPWVGIIFTAILSAALATQSYLFLVSCTVLASFVQYVPSILAVIKFKHSNEYPTHGFSLPGKYTIPIIALIISCYMVTNFTPKTLLLGVVVAVLAAACYFFIDKDEKLEKEHENFLAKLRHIK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021427_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021427_2

2091681-2091783

Orphan

Consensus_repeat	Method
CTTTCGATTTTCGAAATTCCGCTCGTAGCAAGGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021427_2

>merge|NZ_CP021427|2|2091681-2091783|CRISPRCasFinder
CTTTCGATTTTCGAAATTCCGCTCGTAGCAAGGGTTTGCGGGGGGGCGTCAACGAAGTCATGCGGACTTTCGATTTTCGAAATTCCGCTCGTAGCAAGGGTTT

>NZ_CP021427|2|2|2091681-2091783|CRISPRCasFinder
CTTTCGATTTTCGAAATTCCGCTCGTAGCAAGGGTTT	GCGGGGGGGCGTCAACGAAGTCATGCGGA
CTTTCGATTTTCGAAATTCCGCTCGTAGCAAGGGTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021427.1\|WP_064534206.1\|2089448_2089727_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_087261464.1\|2101628_2102021_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_020807706.1\|2095198_2095993_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP021427.1\|WP_147614552.1\|2085085_2085466_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|212030
NZ_CP021427.1\|WP_065169802.1\|2085458_2085911_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_016373490.1\|2090601_2090883_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP021427.1\|WP_065169799.1\|2086886_2088947_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473
NZ_CP021427.1\|WP_010620892.1\|2090369_2090555_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_011241765.1\|2086091_2086217_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_020807709.1\|2099722_2100565_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224855
NZ_CP021427.1\|WP_087261251.1\|2102432_2103482_-\|IS30-like-element-ISLga1-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP021427.1\|WP_035426694.1\|2096547_2098119_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP021427.1\|WP_003625296.1\|2103847_2104480_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376405
NZ_CP021427.1\|WP_020807708.1\|2098125_2099712_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP021427.1\|WP_002819869.1\|2089216_2089426_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_064534204.1\|2089716_2090373_-\|ATPase	unknown	unknown	gnl\|CDD\|226648
NZ_CP021427.1\|WP_065169800.1\|2086363_2086543_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_020807702.1\|2093631_2093847_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021427.1\|WP_005728422.1\|2092839_2093625_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP021427.1\|WP_065169815.1\|2100597_2101614_-\|ThiF-family-adenylyltransferase	unknown	unknown	gnl\|CDD\|366360

Protein	Function_ID	Function_description	E-value
NZ_CP021427.1\|WP_147614552.1\|2085085_2085466_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	0.000151022
NZ_CP021427.1\|WP_020807706.1\|2095198_2095993_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	6.44896e-26
NZ_CP021427.1\|WP_035426694.1\|2096547_2098119_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.73984e-50
NZ_CP021427.1\|WP_016373490.1\|2090601_2090883_-\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	9.19015e-13
NZ_CP021427.1\|WP_065169799.1\|2086886_2088947_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	1.90468e-102
NZ_CP021427.1\|WP_020807709.1\|2099722_2100565_-\|hypothetical-protein	gnl\|CDD\|224855	COG1944, COG1944, Uncharacterized conserved protein [Function unknown].	0.000101048
NZ_CP021427.1\|WP_087261251.1\|2102432_2103482_-\|IS30-like-element-ISLga1-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.68672e-75
NZ_CP021427.1\|WP_065169815.1\|2100597_2101614_-\|ThiF-family-adenylyltransferase	gnl\|CDD\|366360	pfam00899, ThiF, ThiF family. This domain is found in ubiquitin activating E1 family and members of the bacterial ThiF/MoeB/HesA family. It is repeated in Ubiquitin-activating enzyme E1.	6.06001e-27
NZ_CP021427.1\|WP_003625296.1\|2103847_2104480_-\|hypothetical-protein	gnl\|CDD\|376405	pfam00881, Nitroreductase, Nitroreductase family. The nitroreductase family comprises a group of FMN- or FAD-dependent and NAD(P)H-dependent enzymes able to metabolize nitrosubstituted compounds.	0.00234308
NZ_CP021427.1\|WP_020807708.1\|2098125_2099712_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.41012e-54
NZ_CP021427.1\|WP_064534204.1\|2089716_2090373_-\|ATPase	gnl\|CDD\|226648	COG4185, COG4185, Uncharacterized protein conserved in bacteria [Function unknown].	5.66864e-35
NZ_CP021427.1\|WP_005728422.1\|2092839_2093625_+\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	1.88809e-36

>NZ_CP021427.1|WP_016373490.1|2090601_2090883_-|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MAVKEKKRVQVKIDKDLADDTEAVLSQLGLNPTTAINMFYKRIVANGALPFNVSLSEEERANLRFLKATKETPVTEFKDAKEVADWLNDPDED
>NZ_CP021427.1|WP_010620892.1|2090369_2090555_-|hypothetical-protein
MKDTITINDFFEIAKETDLKDLLDKSLHEPDPEKRKVYDALYTYFLDKRQDEVIKRKDFVR
>NZ_CP021427.1|WP_064534204.1|2089716_2090373_-|ATPase
MIDKPQYIIVAGINGAGKSTLYDTFPILFDKTKRINADELLRQMGGDWHKDSDNLKAMKEEIKQLHYALDRQQSIHVETTLAGRGKAHKNGFEVTLLYVASRDENLAIQRVNERVQKGGHGVPVATIKKRYQESKHNLPLVAFKSDKVMIYDNSEKFTSVYAREKGQVFKNDLRHFPWINQNITYPEKVQKQLQNFADQNPEVKPKNDPENKNDRPSY
>NZ_CP021427.1|WP_064534206.1|2089448_2089727_+|hypothetical-protein
MSNQYEKLVKQQARLKQKIEREDFKLRQSKYYENRQARKARSRRLIQKGALLEKYFQADNLSVEQTEELLKIFANYVNAHKPDKLKNDQPNN
>NZ_CP021427.1|WP_002819869.1|2089216_2089426_+|hypothetical-protein
MSQSNLEKQEAKLKALNQKIKDEKNKIEQRLGKQIISQANLDYANLSNDQIKLLAKQFSEFLKVKSVDH
>NZ_CP021427.1|WP_065169799.1|2086886_2088947_-|MobA/MobL-family-protein
MAIFHISFSNISAGKGRSAIASAAYRSGEKLFDDKECRRYFYARSVIPESFILTPKNAPEWAIDREKLWNEVEKNDRKSNSRYAKEFNVALPVELSESEQKELLTKYVQENFVDQGMVADVAIHRDHPDNPHAHVMLTNRPFNPDGSWGLKAKTQYIKDENGKQLLTKSGFPKQRKIWLVDWDKKEKINEWRHNWATSVNQFLAQKNIPDRISEKSFVDQGIQETPTQHEGINSQRKNRKAFNQQVRAQRNAQAKYHNLDEKIRNHEHFDALTDELSFSEKHTISHLSQQLKTYVDLEHLDDKQRMLFNWKNSLLIKHAIGEDVTKQLLTIDQQTTSLAQANQLLNKVVERATKKLYPELNFEQTTAAERRELIKETNSEQTTFKGSELAERLADIRNDLLTQQLLTFTKRPYTSWQLVNQQAQTIEKQLTTVLAKHGHQLDDLKHTDRGMLAAYEPNELEFISKAVKNLRVMREVKAVVQTQYNSILTTAFPDSDLDKLETIDKEQIYTAVVYYDPELKPLSADDLRQLQQQPPVVFTSQQHQAGLNYLLGKMELKDIQDHRLQRVLKHDGTRQLFIGECGQDPKLDHQQIEMVQARLKQQTTRFDQYKQDQIKDYQAINYYPTSPKNYLTNILDEALMTILYAKNTDYLRKQQLRGLKETEWAMTKKQRQHQTRNRHEDGGMHL
>NZ_CP021427.1|WP_065169800.1|2086363_2086543_+|hypothetical-protein
MGTWNNLQEGFTVNERRLPDTLVDVAVWHVFNRATQLYRQASQIKKSPCVTLVGYRATM
>NZ_CP021427.1|WP_011241765.1|2086091_2086217_-|hypothetical-protein
MCVPNLLQFVPNDYIANNYLKTNFYLKDVLCYRKLVSFHSC
>NZ_CP021427.1|WP_065169802.1|2085458_2085911_+|hypothetical-protein
MIEKEKVLSDAPKVLNSDNNPWEVTVEGDSIIGTWKWMDARFFTEGGISDEDKEFTFTVTLKDNGKWKEVDSTSSKTSSIRMHNGKLSFSKDISFSKGKTYQKSISFGIGKDKKSGKVGIVESKLDTSIIKKSIRDYLKQCGWKKAGLFG
>NZ_CP021427.1|WP_147614552.1|2085085_2085466_+|LysM-peptidoglycan-binding-domain-containing-protein
MTPGDTWRTIAYKYAMSVEELLKVNCAKAVDVLSIGQYGFNLVKIPSSWLHMEFGLSFLHDTSPLVNKIGRTIDQFLLLAISRIIDIVYYGYSMIRFTTGDMTGLGIIRLVMFSNDYQKKEMISYD
>NZ_CP021427.1|WP_005728422.1|2092839_2093625_+|AAA-family-ATPase
MNGKTLLNFNFKGGVGKTTLTVMETYLLGQEGKKVLLIDFDPQGNATEIMKETYKADLKPELSLYEGLLGGNLSKSIVSVTNQIDMIPTDWTLSLWIGAVEKVSRVKRNILLPQMLSKLKQNYDYIFIDVPPTINVFTNNAIMASDFISIVLQTQKQSYTSSLKTATHLGELREQYNGSFQLVGVILYLMKPRAKVDTEISAQAKDFFGEGVFSNSIRTQERVKTFANEGIRNKDHWDKRAIQMYQMVLNEQLLRIQQLEE
>NZ_CP021427.1|WP_020807702.1|2093631_2093847_+|hypothetical-protein
MAEDFLNKVSKKASEQLKNLKSPYQFETERTKTVQLRMSTYKEVKRIAFENDEKIVDVLEKIIREGLAKRR
>NZ_CP021427.1|WP_020807706.1|2095198_2095993_-|alpha/beta-hydrolase
MFNARTKSIVINGYSMDYISFGKGNKWLILIPGLSINRIRGHALQMSFMYRQFARKYKVLMFDRRDHLTPSYSIGQMADELYSALRKLGIYKIDVVGVSEGGMIAQKLAINQPDIVHKLVLAVTISEPNNTSNTTIKQWISLAKNNQLKELVWDSFQRSYSTHYIHKHHHLLKLLATITKVKEVDRFIILAQAILNFNVAAQLTKIKCPVFVIGAQQDQVLSVEGTKTIAKILHAPLYIYPHYGHAVYIEAKDFNQRIYNFLMS
>NZ_CP021427.1|WP_035426694.1|2096547_2098119_-|ABC-transporter-ATP-binding-protein
MSFKDLYAVNRIRMISLLVLEFLTSGLIIGVSYINTYQITAIKDRKWQQFIFLITLSLILFIISYAGLNVCQYWIEKQIQQYNHQIRFKIVDHYFYDNKPHNAAQVQNRLTNDLNLIKDSKLAVYTDIPYYLAQIIFASIGLLLFHWSLLIVVLILGTLSFYLPKLLRPAMQAAALKLSQANKQYLDTAEKWLDGLSELKKFSVGSQLSKIMDHASDTLESANIARRGTMQGLAVLNKATSALLQFVLLAVTAILVTNHIVVFGVIVTVESFSSYINVSVKMLATELGQIHSVDRLSREVNADTAVIEHTGDLQSPASLTTKNVSVKFSNGKIIKFPNLNIKTGEKILLTGDSGSGKTTLFKVLLGKIKLHTGMINFKNKYGDDINIDKAKIGYIPQDPILFPDSIENNITMFNSKLKNKVLDYVKNVSFESDIRKMSLGLKTELNLQKLNISGGQRQKIVLARACIHDDDFILIDEGTSAIDKKATLEILKKLLDGPYTVIFIAHNFNEEMYSLFDREIHLT
>NZ_CP021427.1|WP_020807708.1|2098125_2099712_-|ABC-transporter-ATP-binding-protein
MSFQKLIKTNLLLFIVIIVLELLFAAGSAISSYIIQFAYNQLVKNILLGFLLIIASSVFLSFISYILSSLATYLFSKQTQKYIHSIRHKLISEYYHDKAPKVAEMENELNSNLQVLTKNYADQSLSIIQSGFLLVTSISSLLLMNWMLTLLAIILSVITLYIPRFTRQKASNATQKVASRNSKYLLVIEEWFNGLEELRKYTAFNQLDLVMQKVSQNLETSFVERKKVISVADFLNGCANSFSQIAITLLAAILFFNHQVTFGVIIAAGNFSSMILNCLLTITTSLTRIQSVQGLNKQIIESQKLVPFHKEINTDEICSISTHNLSISFKNGETIYFPDIHIKKGEKVLLSGDSGTGKSTLFKLILNKLQPTNGQVIFEDKYGKEISPDYAQIGYIPQDGKLFPTSIINNIIMFNNKLKKLSKNAVENNDLSKDIASMPNGLETEIDLDTNNFSGGQKQKIILARNEIHNFSIILADEATSAIDSKSSYRILKNLVSSNKTVIVIAHNLTPAMEKLFSRKISLGSNKR
>NZ_CP021427.1|WP_020807709.1|2099722_2100565_-|hypothetical-protein
MKIYKWKLSKLQVLKLSKVKVQGNLVAVTSDGNKYIPFGGIDSLYETAYKKAISELNERAAWFTMYSLHPSIVPNTTGFAAHTDKEKAIQSSIYEVIERKAFHYFIKLIMNNKIDEIYSNFHIQNKKDFLLFSKPYLTQAGELWITFAFDLGRKIIPVGMGKQNNLAESIDDAIDECIMVNHSIEKYLISHSNKQSTQSMSQEELLSFINLGKSTLLQDNLEKLSIENNYYENVKTKNIESLLTLNVTRYIPKFLSPTNRYVYLSVPLEKADSIKNNYRI
>NZ_CP021427.1|WP_065169815.1|2100597_2101614_-|ThiF-family-adenylyltransferase
MEYMFKYDVYGKVENKEIKILELIPIKRRYVIKLKDDEVSSAKQLIDLLNHGTTLQELEKLFAKKETMNNIFVFLKKQYLLANYFGDNHPDDPFARQIEMLDSFNRSSVSTSKLQSDLSQKSVLIIGAGGVGTALSNLLNSCGIGHIFIVDADIIENTNLSRQFLYNRDDVGKPKVEVLSQKLNKRGLGKVTGINAMLTLSNYKDILKDVGNVDLITGMPFPFSSSLNKLYKDILTLGYTMYAIGEHDAGPLFTKSNEIDKVANSIIAKYPATNFLNQRRDNPAWHDRHPSFLPEIQITSSLAAAEIVKYFTQITTMNTENAMYSLHSDNYTVSLVKF
>NZ_CP021427.1|WP_087261464.1|2101628_2102021_-|hypothetical-protein
MLNSRLNYDTGNLFIYIDRDNVQNNIGIIRQRKLIATRFGLAEVINPNVVISFGGVNIQKHALHIRLGLQKIKKLDLKIPLEDIKEVYTSDNSPIEYSTICQKISYPAVVSFKLPNVYMRLKRPIKFYIQ
>NZ_CP021427.1|WP_087261251.1|2102432_2103482_-|IS30-like-element-ISLga1-family-transposase
MDSLHSTMNQHVKGKHLSFEERVIIQLRLKDGCSLRAIARELNCSPSTISYEVKRGTVKLYHGKVKRYKATQGHDVYQAHRKNCGRKSDFLKKNQFIHYVHKHFFKDGWSLDVCSNRATAAGEFSSSDVVCTKTLYNYVDKGLLGIYNYDLPEKLKRNTKLHRVRKNKKKLGRSIEERPKEISERNEFGHWECDLVLGHKTKDDEVLLTLSERMSREFLIIRIPDKTSISVMQAFKELQRQYSEHWNDIFKTITTDNGSEFADLSNLEEASNTLVYYAHPYTSCDKGTVERHNGLIRRFIPKGEAIANYSLQNIIDIETWCNSLPRKILAYHTPDEIFERELDRIYQAA
>NZ_CP021427.1|WP_003625296.1|2103847_2104480_-|hypothetical-protein
MPSSNFYEALSLKTRVIHRNELNKIKESEIHDEEINSFSENFIFKNRYSYRGNLSSLSYTELKEFIEDLSRRKDYHPIPYAGNISPVISFCLNDSNLYYCNFINGSLKRYQSDSLRKYVKKQTDRADIRGSGGTIILLALDFSVLKTKYLQQSEILSWVDLGCILEGMSILASVKQYNCCIHFFMKDPRNILFDEKSYTPVCLFRIGHKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP052067	Lactobacillus paracasei strain 347-16 plasmid unnamed2, complete sequence	3249-3278	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP019031	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence	29775-29804	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP014885	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-4, complete sequence	19723-19752	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP017381	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence	3049-3078	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP048005	Lactobacillus paracasei strain CACC 566 plasmid p2CACC566, complete sequence	44017-44046	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP017699	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence	3974-4003	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP017699	Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence	48881-48910	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	42038-42067	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_021516	Lactobacillus plantarum 16 plasmid Lp16C, complete sequence	18386-18415	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	46430-46459	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_KM063576	Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence	13356-13385	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP028979	Lactobacillus plantarum strain LQ80 plasmid pLQ802, complete sequence	25804-25833	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035557	Lactobacillus plantarum strain SRCM103297 plasmid unnamed1	8725-8754	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035557	Lactobacillus plantarum strain SRCM103297 plasmid unnamed1	51029-51058	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	13357-13386	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_011839	Lactobacillus gasseri plasmid pLgLA39, complete sequence	25960-25989	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP028232	Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence	41583-41612	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP011537	Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence	20371-20400	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP014891	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence	26392-26421	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP028242	Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence	10241-10270	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	46091-46120	0	1.0
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP032752	Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed1, complete sequence	42130-42159	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	17963-17992	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	67611-67640	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035574	Lactobacillus plantarum strain SRCM103303 plasmid unnamed3	66716-66745	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035176	Lactobacillus plantarum strain SRCM103426 plasmid unnamed2	50013-50042	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP017376	Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence	19581-19610	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	16199-16228	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP023493	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence	27116-27145	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	18654-18683	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	37321-37350	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP015967	Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence	1385-1414	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP026509	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed4, complete sequence	1985-2014	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP025416	Lactobacillus plantarum strain X7021 plasmid unnamed4, complete sequence	24275-24304	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP028336	Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence	40397-40426	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_015603	Lactobacillus kefiranofaciens ZW3 plasmid pWW2, complete sequence	10175-10204	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP021933	Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence	54886-54915	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035132	Lactobacillus plantarum strain SRCM103311 plasmid unnamed1	8964-8993	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035148	Lactobacillus plantarum strain SRCM103361 plasmid unnamed1	88468-88497	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP024061	Lactobacillus plantarum strain KACC 92189 plasmid unnamed3	36199-36228	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	17810-17839	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP029538	Lactobacillus paracasei strain LC355 plasmid unnamed2, complete sequence	35453-35482	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP020097	Lactobacillus plantarum strain K25 plasmid unnamed4, complete sequence	10074-10103	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP035569	Lactobacillus plantarum strain SRCM103300 plasmid unnamed3	23303-23332	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	27231-27260	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_AP014682	Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence	13168-13197	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP032650	Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence	20686-20715	1	0.967
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	14838-14867	1	0.967
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP045730	Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence	3596-3624	1	0.966
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	16760-16788	1	0.966
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_AP017932	Lactobacillus sakei strain LK-145 plasmid pLs145-a, complete sequence	7841-7870	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP022710	Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence	46095-46124	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP016802	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence	47857-47886	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP019751	Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence	24467-24496	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP046038	Lactobacillus sakei strain CBA3614 plasmid unnamed1, complete sequence	29177-29206	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP027195	Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence	42865-42894	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	29962-29991	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP040377	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed3, complete sequence	944-973	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_LT907984	Lactobacillus sakei subsp. sakei 23K plasmid pJ23A1, complete sequence	16438-16467	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_LT907987	Lactobacillus sakei strain T332 plasmid p332A2, complete sequence	16156-16185	2	0.933
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP025208	Lactobacillus sakei strain WiKim0074 plasmid pLSW74_2, complete sequence	10173-10202	6	0.8
NZ_CP021427_1	1.1\|1744326\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744326-1744355	30	MK504443	Lactobacillus phage 521B, complete genome	120165-120194	7	0.767
NZ_CP021427_1	1.9\|1744854\|30\|NZ_CP021427\|CRISPRCasFinder,CRT	1744854-1744883	30	AP022646	Bacillus wiedmannii PL1 plasmid pBwiPL1-3 DNA, complete sequence	2917-2946	7	0.767
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP045730	Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence	3542-3570	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	16706-16734	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_KR052811	Lactobacillus crispatus strain L6 plasmid pLc17, complete sequence	11794-11822	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP046312	Lactobacillus crispatus strain FDAARGOS_743 plasmid unnamed1, complete sequence	3936-3964	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP026504	Lactobacillus crispatus strain AB70 plasmid pLcAB70, complete sequence	5455-5483	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP044414	Lactobacillus sp. JM1 plasmid unnamed2, complete sequence	25960-25988	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	37234-37262	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NZ_CP012279	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence	3450-3478	7	0.759
NZ_CP021427_2	2.1\|2091718\|29\|NZ_CP021427\|CRISPRCasFinder	2091718-2091746	29	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	462-490	7	0.759
NZ_CP021427_1	1.4\|1744524\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744524-1744553	30	NC_049431	Vibrio phage 1.097.O._10N.286.49.B3, partial genome	16388-16417	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP013929	Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence	102579-102608	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	CP013931	Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence	102585-102614	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_017498	Lactococcus lactis plasmid pSK11A, complete sequence	8628-8657	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP016709	Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109C, complete sequence	9521-9550	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	102956-102985	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NC_008504	Lactococcus lactis subsp. cremoris SK11 plasmid 2, complete sequence	4914-4943	8	0.733
NZ_CP021427_1	1.5\|1744590\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744590-1744619	30	NZ_CP016739	Lactococcus lactis subsp. cremoris strain JM3 plasmid pJM3C, complete sequence	14924-14953	8	0.733
NZ_CP021427_1	1.8\|1744788\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744788-1744817	30	NC_048827	Vibrio phage vB_VchM_Kuja, complete genome	142116-142145	8	0.733
NZ_CP021427_1	1.9\|1744854\|30\|NZ_CP021427\|CRISPRCasFinder,CRT	1744854-1744883	30	NC_002580	Propionibacterium freudenreichii plasmid p545, complete sequence	137-166	8	0.733
NZ_CP021427_1	1.1\|1744326\|30\|NZ_CP021427\|PILER-CR,CRISPRCasFinder,CRT	1744326-1744355	30	AY583235	Mycoplasma phage phiMFV1, complete genome	2923-2952	9	0.7

1. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP052067 (Lactobacillus paracasei strain 347-16 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

2. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019031 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

3. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014885 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-4, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

4. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017381 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

5. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048005 (Lactobacillus paracasei strain CACC 566 plasmid p2CACC566, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

6. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017699 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

7. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017699 (Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535 plasmid pLDW-5, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

8. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

9. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_021516 (Lactobacillus plantarum 16 plasmid Lp16C, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

10. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

11. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KM063576 (Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

12. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028979 (Lactobacillus plantarum strain LQ80 plasmid pLQ802, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

13. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035557 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

14. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035557 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

15. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

16. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_011839 (Lactobacillus gasseri plasmid pLgLA39, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

17. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028232 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

18. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011537 (Lactobacillus fermentum 3872 plasmid pLF3872, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

19. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014891 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-1, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

20. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028242 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

21. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtaggtgattag	Protospacer
******************************

22. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032752 (Lactobacillus plantarum subsp. argentoratensis strain DSM 16365 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

23. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

24. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

25. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035574 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

26. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035176 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

27. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017376 (Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

28. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

29. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023493 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

30. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

31. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

32. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015967 (Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtgggtgattag	Protospacer
********************.*********

33. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026509 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed4, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

34. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025416 (Lactobacillus plantarum strain X7021 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtgggtgattag	Protospacer
********************.*********

35. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028336 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

36. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_015603 (Lactobacillus kefiranofaciens ZW3 plasmid pWW2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

37. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021933 (Lactobacillus plantarum strain TMW 1.1478 plasmid pL11478-1, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

38. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035132 (Lactobacillus plantarum strain SRCM103311 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

39. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035148 (Lactobacillus plantarum strain SRCM103361 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

40. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024061 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacggatagtaggtgattag	Protospacer
*************.****************

41. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

42. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029538 (Lactobacillus paracasei strain LC355 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

43. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020097 (Lactobacillus plantarum strain K25 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

44. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035569 (Lactobacillus plantarum strain SRCM103300 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

45. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

46. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP014682 (Lactobacillus hokkaidonensis JCM 18461 strain LOOC260 plasmid pLOOC260-2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

47. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032650 (Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaagaattaaacagatagtgggtgattag	Protospacer
********************.*********

48. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

caaagaattaaacagatagtaggtgattag	CRISPR spacer
caaaggattaaacagatagtaggtgattag	Protospacer
*****.************************

49. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP045730 (Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.966

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
gcggggggtcgtcaacgaagtcatgcgga	Protospacer
******** ********************

50. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.966

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
gcggggggtcgtcaacgaagtcatgcgga	Protospacer
******** ********************

51. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP017932 (Lactobacillus sakei strain LK-145 plasmid pLs145-a, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

52. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022710 (Lactobacillus sakei strain WiKim0063 plasmid pLBS01, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

53. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016802 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-5, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

54. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019751 (Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-1, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

55. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046038 (Lactobacillus sakei strain CBA3614 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

56. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027195 (Lactobacillus sp. CBA3606 plasmid pCBA3606-1, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

57. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

58. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040377 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

59. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT907984 (Lactobacillus sakei subsp. sakei 23K plasmid pJ23A1, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

60. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT907987 (Lactobacillus sakei strain T332 plasmid p332A2, complete sequence) position: , mismatch: 2, identity: 0.933

caaagaattaaacagatagtaggtgattag	CRISPR spacer
aaaaggattaaacagatagtaggtgattag	Protospacer
 ****.************************

61. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025208 (Lactobacillus sakei strain WiKim0074 plasmid pLSW74_2, complete sequence) position: , mismatch: 6, identity: 0.8

caaagaattaaacagatagtaggtgattag	CRISPR spacer
tcacaaattaaacgaatagtaggtgattag	Protospacer
. * .********..***************

62. spacer 1.1|1744326|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to MK504443 (Lactobacillus phage 521B, complete genome) position: , mismatch: 7, identity: 0.767

gcttatttcattaagtaggtgatgcagatg	CRISPR spacer
tgttaaactattcagtaggtgatgcagatg	Protospacer
  ***  ..*** *****************

63. spacer 1.9|1744854|30|NZ_CP021427|CRISPRCasFinder,CRT matches to AP022646 (Bacillus wiedmannii PL1 plasmid pBwiPL1-3 DNA, complete sequence) position: , mismatch: 7, identity: 0.767

--agttaatcaaagaaggcggacaaaaaggcg	CRISPR spacer
gacatcaa--gaagaaggcggacaaagaggcg	Protospacer
   .*.**  .***************.*****

64. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP045730 (Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggattcaacgaagtcatgcgga	Protospacer
  * ..***  ******************

65. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggattcaacgaagtcatgcgga	Protospacer
  * ..***  ******************

66. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_KR052811 (Lactobacillus crispatus strain L6 plasmid pLc17, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggattcaacgaagtcatgcgga	Protospacer
  * ..***  ******************

67. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP046312 (Lactobacillus crispatus strain FDAARGOS_743 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggattcaacgaagtcatgcgga	Protospacer
  * ..***  ******************

68. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP026504 (Lactobacillus crispatus strain AB70 plasmid pLcAB70, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggattcaacgaagtcatgcgga	Protospacer
  * ..***  ******************

69. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP044414 (Lactobacillus sp. JM1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggtttcaacgaagtcatgcgga	Protospacer
  * ..***. ******************

70. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggtttcaacgaagtcatgcgga	Protospacer
  * ..***. ******************

71. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NZ_CP012279 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggattcaacgaagtcatgcgga	Protospacer
  * ..***  ******************

72. spacer 2.1|2091718|29|NZ_CP021427|CRISPRCasFinder matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 7, identity: 0.759

gcgggggggcgtcaacgaagtcatgcgga	CRISPR spacer
tagcaagggtttcaacgaagtcatgcgga	Protospacer
  * ..***. ******************

73. spacer 1.4|1744524|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_049431 (Vibrio phage 1.097.O._10N.286.49.B3, partial genome) position: , mismatch: 8, identity: 0.733

tttaagtaattttccaatgacaccagcatt	CRISPR spacer
tttaagtaattttccaattacatatccgcc	Protospacer
****************** ***.   *...

74. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013929 (Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
ttgattgttaaacagatagtaagtgatttg	Protospacer
. .*  .**************.****** *

75. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to CP013931 (Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
ttgattgttaaacagatagtaagtgatttg	Protospacer
. .*  .**************.****** *

76. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_017498 (Lactococcus lactis plasmid pSK11A, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
taaagaattaaagagatagtagcattatat	Protospacer
.*********** *********     **

77. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016709 (Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109C, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
taaagaattaaagagatagtagcattatat	Protospacer
.*********** *********     **

78. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
ttgattgttaaacagatagtaagtgatttg	Protospacer
. .*  .**************.****** *

79. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_008504 (Lactococcus lactis subsp. cremoris SK11 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
taaagaattaaagagatagtagcattatat	Protospacer
.*********** *********     **

80. spacer 1.5|1744590|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016739 (Lactococcus lactis subsp. cremoris strain JM3 plasmid pJM3C, complete sequence) position: , mismatch: 8, identity: 0.733

caaagaattaaacagatagtaggtgattag	CRISPR spacer
taaagaattaaagagatagtagcattatat	Protospacer
.*********** *********     **

81. spacer 1.8|1744788|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to NC_048827 (Vibrio phage vB_VchM_Kuja, complete genome) position: , mismatch: 8, identity: 0.733

tttgcataattaatgaaatcagcgacaaca	CRISPR spacer
gaaaaagaattaatgaaatcagcatcaaca	Protospacer
   . * ****************. *****

82. spacer 1.9|1744854|30|NZ_CP021427|CRISPRCasFinder,CRT matches to NC_002580 (Propionibacterium freudenreichii plasmid p545, complete sequence) position: , mismatch: 8, identity: 0.733

agttaatcaaagaaggcggacaaaaaggcg	CRISPR spacer
aaggcggcaaagaaggcggccacaaaggcg	Protospacer
*.   . ************ ** *******

83. spacer 1.1|1744326|30|NZ_CP021427|PILER-CR,CRISPRCasFinder,CRT matches to AY583235 (Mycoplasma phage phiMFV1, complete genome) position: , mismatch: 9, identity: 0.7

gcttatttcattaagtaggtgatgcagatg	CRISPR spacer
ttttatttcattaattaggtgattttgcat	Protospacer
 .************ ******** . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1732 : 83709

Lactobacillus_phage(71.7%)

integrase,head,capsid,transposase,protease,terminase,plate,portal

attL 36300:36359|attR 83809:83875

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024273054.1\|1732_2782_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_065169494.1\|4429_7000_-	ABC transporter permease	NA	NA	NA	NA
WP_035425608.1\|7009_7720_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.5e-36	36.5
WP_035425606.1\|8002_8635_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_020807292.1\|8696_9821_+	glycosyltransferase	NA	NA	NA	NA
WP_020807294.1\|12657_13203_+	cysteine hydrolase	G3MA16	Bacillus_virus	2.0e-32	40.8
WP_003648947.1\|13316_13853_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_020807295.1\|13880_17069_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_020807296.1\|17061_18150_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	8.6e-56	34.7
WP_020807297.1\|18146_19424_-	dihydroorotase	NA	NA	NA	NA
WP_020807298.1\|19423_20380_-	aspartate carbamoyltransferase catalytic subunit	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.5e-22	29.9
WP_003648952.1\|20526_21069_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_003648953.1\|21238_22162_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_020807299.1\|22413_23121_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_003647205.1\|23122_23761_+	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	1.4e-26	31.4
WP_065169493.1\|24010_25606_+	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_020807301.1\|25647_26469_-	sugar-phosphatase	NA	NA	NA	NA
WP_020807302.1\|26473_27502_-	hypothetical protein	NA	NA	NA	NA
WP_003648959.1\|27631_27958_+	heavy metal-binding domain-containing protein	M4STD1	Rhodobacter_phage	2.4e-06	36.5
WP_020807303.1\|27987_29379_-	NOL1/NOP2/sun family putative RNA methylase	NA	NA	NA	NA
WP_020807304.1\|29378_30356_-	hypothetical protein	NA	NA	NA	NA
WP_024272995.1\|30414_31464_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.4
WP_087261171.1\|31529_32294_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_020807306.1\|32375_32948_+	signal peptidase I	NA	NA	NA	NA
WP_003648964.1\|32975_33161_+	hypothetical protein	NA	NA	NA	NA
WP_020807307.1\|33232_34069_-	hypothetical protein	NA	NA	NA	NA
WP_020807308.1\|34078_34897_-	hypothetical protein	NA	NA	NA	NA
WP_003648967.1\|34899_35607_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-16	28.6
WP_003648968.1\|35608_35977_-	GntR family transcriptional regulator	NA	NA	NA	NA
36300:36359	attL	NA	NA	NA	NA
WP_065169492.1\|36503_36689_-	hypothetical protein	O48431	Lactobacillus_phage	2.3e-22	88.5
WP_003656391.1\|37233_38181_-	lysin	Q38317	Lactobacillus_phage	6.6e-161	88.7
WP_003656393.1\|38184_38529_-	hypothetical protein	Q38316	Lactobacillus_phage	1.7e-50	93.0
WP_003656394.1\|38525_38735_-	hypothetical protein	Q9T1D9	Lactobacillus_phage	2.5e-20	98.6
WP_024273047.1\|38738_39128_-	hypothetical protein	Q9T1E0	Lactobacillus_phage	3.7e-41	88.7
WP_020807530.1\|39093_39303_-	hypothetical protein	Q9T1E1	Lactobacillus_phage	1.3e-32	98.6
WP_065169660.1\|39315_39780_-	hypothetical protein	Q9T1E2	Lactobacillus_phage	1.0e-74	94.8
WP_087261173.1\|39834_42666_-\|plate	BppU family phage baseplate upper protein	Q9T1E3	Lactobacillus_phage	0.0e+00	91.5
WP_020807532.1\|42595_42805_-	hypothetical protein	NA	NA	NA	NA
WP_065169533.1\|42820_45619_-	endopeptidase	Q9T1E4	Lactobacillus_phage	0.0e+00	97.6
WP_020807534.1\|45615_46359_-	phage protein	Q9T1E6	Lactobacillus_phage	2.1e-125	85.0
WP_087261174.1\|46345_51802_-	tape measure protein	Q9T1E7	Lactobacillus_phage	0.0e+00	93.0
WP_065169532.1\|52012_52564_-	hypothetical protein	Q9T1F0	Lactobacillus_phage	5.7e-80	85.8
WP_065169531.1\|53527_53899_-	DUF806 family protein	Q9T1F2	Lactobacillus_phage	3.4e-60	91.1
WP_020807539.1\|53882_54362_-	hypothetical protein	Q9T1F3	Lactobacillus_phage	9.3e-71	84.9
WP_035425575.1\|54354_54711_-\|head	phage head closure protein	Q9T1F4	Lactobacillus_phage	3.6e-59	94.9
WP_087261177.1\|54667_55048_-	DNA packaging protein	Q9T1F5	Lactobacillus_phage	3.8e-51	84.1
WP_065169529.1\|55064_56255_-\|capsid	phage major capsid protein	Q9T1F6	Lactobacillus_phage	8.5e-198	87.8
WP_087261179.1\|56260_56974_-\|protease	Clp protease ClpP	Q9T1F7	Lactobacillus_phage	5.6e-112	87.0
WP_087261182.1\|56933_58130_-\|portal	phage portal protein	Q9T1F8	Lactobacillus_phage	2.9e-198	92.0
WP_065169526.1\|58129_58336_-	DUF1056 family protein	NA	NA	NA	NA
WP_087261185.1\|58316_60191_-\|terminase	terminase large subunit	Q9T1F9	Lactobacillus_phage	0.0e+00	93.3
WP_020807546.1\|60187_60637_-\|terminase	phage terminase small subunit P27 family	Q9T1G0	Lactobacillus_phage	1.3e-77	96.0
WP_065169523.1\|60802_61315_-	HNH endonuclease	Q9T1G1	Lactobacillus_phage	1.2e-87	85.9
WP_147614539.1\|61646_62102_-	hypothetical protein	Q9T1G2	Lactobacillus_phage	4.2e-73	89.2
WP_003656430.1\|62192_62687_-	hypothetical protein	Q9T1G3	Lactobacillus_phage	7.6e-92	98.8
WP_065169535.1\|62683_63046_-	VRR-NUC domain-containing protein	L0P7E5	Lactobacillus_phage	2.9e-40	64.1
WP_081275656.1\|63038_63419_-	hypothetical protein	Q9T1G5	Lactobacillus_phage	2.1e-49	84.9
WP_065169521.1\|63553_63871_-	hypothetical protein	Q9T1G6	Lactobacillus_phage	5.6e-48	99.0
WP_081275650.1\|63870_64161_-	hypothetical protein	Q9T1G7	Lactobacillus_phage	6.1e-25	86.3
WP_147614540.1\|64171_64342_-	sporulation protein Cse60	NA	NA	NA	NA
WP_065169520.1\|64331_64574_-	hypothetical protein	NA	NA	NA	NA
WP_065169519.1\|64557_64809_-	hypothetical protein	NA	NA	NA	NA
WP_065169518.1\|64801_65074_-	hypothetical protein	NA	NA	NA	NA
WP_065169517.1\|65060_65327_-	hypothetical protein	NA	NA	NA	NA
WP_087261187.1\|65323_65569_-	hypothetical protein	NA	NA	NA	NA
WP_157664534.1\|66223_67504_-	virulence protein E	A0A0A1EL11	Lactobacillus_phage	4.8e-98	47.2
WP_087261197.1\|67493_68300_-	DNA primase	U3PBE3	Lactobacillus_phage	2.8e-88	64.6
WP_087261200.1\|68312_68912_-	hypothetical protein	U3PDN3	Lactobacillus_phage	2.2e-37	42.6
WP_087261204.1\|68915_69650_-	AAA family ATPase	U3PIS9	Lactobacillus_phage	4.9e-47	45.3
WP_087261207.1\|71035_71290_-	hypothetical protein	NA	NA	NA	NA
WP_087261210.1\|71283_71625_-	hypothetical protein	NA	NA	NA	NA
WP_065169503.1\|72064_72280_-	hypothetical protein	Q9T1I6	Lactobacillus_phage	1.8e-34	94.4
WP_021315033.1\|72291_72489_-	hypothetical protein	Q9T1I7	Lactobacillus_phage	6.1e-29	96.9
WP_155761827.1\|72579_72744_-	hypothetical protein	NA	NA	NA	NA
WP_065169502.1\|72877_73324_+	hypothetical protein	NA	NA	NA	NA
WP_157664536.1\|73450_73612_-	hypothetical protein	NA	NA	NA	NA
WP_065169501.1\|73761_74058_-	hypothetical protein	NA	NA	NA	NA
WP_087261212.1\|74114_74324_-	helix-turn-helix transcriptional regulator	D2IZX1	Enterococcus_phage	2.8e-08	46.4
WP_087261215.1\|74604_74832_+	hypothetical protein	NA	NA	NA	NA
WP_087261220.1\|74937_75159_+	hypothetical protein	NA	NA	NA	NA
WP_087261223.1\|75173_75446_-	hypothetical protein	NA	NA	NA	NA
WP_087261226.1\|75506_75692_+	hypothetical protein	NA	NA	NA	NA
WP_087261229.1\|75684_75906_-	hypothetical protein	NA	NA	NA	NA
WP_035422750.1\|75967_76234_+	hypothetical protein	NA	NA	NA	NA
WP_035422755.1\|76346_76568_-	hypothetical protein	Q9T1J1	Lactobacillus_phage	1.4e-29	90.3
WP_003656455.1\|76594_77326_-	toxin Bro	A0A141DZC7	Streptococcus_phage	4.2e-54	49.1
WP_051994791.1\|77383_77572_-	helix-turn-helix transcriptional regulator	Q9G0C3	Lactococcus_phage	1.2e-05	45.9
WP_157664538.1\|77537_77711_-	hypothetical protein	NA	NA	NA	NA
WP_003656456.1\|78050_78422_+	helix-turn-helix transcriptional regulator	A0A097QQ00	Enterococcus_phage	1.2e-09	38.5
WP_087261232.1\|78437_78839_+	ImmA/IrrE family metallo-endopeptidase	O48433	Lactobacillus_phage	2.0e-42	68.3
WP_087261235.1\|78873_79554_+	helix-turn-helix domain-containing protein	U3PIS7	Lactobacillus_phage	8.6e-46	45.0
WP_087261238.1\|79571_79940_+	hypothetical protein	A0A2I6PF07	Staphylococcus_phage	1.1e-10	31.9
WP_087261241.1\|79914_80121_-	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_087261244.1\|80152_80383_-	hypothetical protein	NA	NA	NA	NA
WP_003653473.1\|80913_81894_+	Abi family protein	M1PS09	Streptococcus_phage	5.4e-65	43.4
WP_065169753.1\|82455_83709_+\|integrase	site-specific integrase	Q37880	Lactobacillus_phage	7.1e-78	39.5
83809:83875	attR	NA	NA	NA	NA

DBSCAN-SWA_2

257331 : 304807

unidentified_phage(27.27%)

protease,transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024273054.1\|257331_258381_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_003649102.1\|260667_261105_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_065169717.1\|261277_262750_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_020807525.1\|262749_263310_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_024273048.1\|263351_264017_-	nitroreductase	NA	NA	NA	NA
WP_020807580.1\|264290_265421_+	acyltransferase family protein	NA	NA	NA	NA
WP_020807581.1\|265467_266055_-	cell division protein	NA	NA	NA	NA
WP_020807582.1\|266047_266467_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_020807583.1\|266602_268414_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	2.3e-93	38.2
WP_003649162.1\|268755_269451_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_020806787.1\|269496_270267_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_065169716.1\|270354_272889_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	2.5e-66	25.8
WP_080972639.1\|273578_273992_+	hypothetical protein	NA	NA	NA	NA
WP_020806790.1\|274114_276499_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_020806791.1\|276628_277903_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_020806792.1\|277912_278578_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.8e-22	32.0
WP_020806793.1\|278582_279194_-	(p)ppGpp synthetase	NA	NA	NA	NA
WP_020806794.1\|279261_280326_-	hypothetical protein	NA	NA	NA	NA
WP_020806795.1\|280454_280865_-	OsmC family protein	NA	NA	NA	NA
WP_020806796.1\|280878_282426_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_051904648.1\|282418_283381_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-25	37.1
WP_087261251.1\|283501_284551_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.4
WP_020806798.1\|284707_285541_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_003649175.1\|285660_286569_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	5.1e-78	51.2
WP_020806799.1\|286627_287551_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_003649177.1\|287566_288391_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003649178.1\|288577_289024_+	flavodoxin	NA	NA	NA	NA
WP_020806801.1\|289562_290705_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	8.5e-30	28.5
WP_020806802.1\|291187_292513_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_020806803.1\|292512_293748_-	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	1.8e-33	27.6
WP_020806804.1\|293758_294475_-	lysozyme M1 (1,4-beta-N-acetylmuramidase)	NA	NA	NA	NA
WP_020806805.1\|294588_295899_+	amino acid permease	NA	NA	NA	NA
WP_003649185.1\|295982_296552_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.0e-07	26.1
WP_039157093.1\|296649_298029_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_051904647.1\|298079_298784_-	hypothetical protein	NA	NA	NA	NA
WP_024273054.1\|299012_300062_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_003649188.1\|300097_300754_-	nitroreductase	NA	NA	NA	NA
WP_020806808.1\|300920_303326_-	phosphoketolase family protein	NA	NA	NA	NA
WP_020806809.1\|303437_304217_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_020806810.1\|304480_304807_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA

DBSCAN-SWA_3

309352 : 367343

unidentified_phage(35.71%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024272995.1\|309352_310402_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.4
WP_020806815.1\|310537_312076_-	YfcC family protein	NA	NA	NA	NA
WP_048684893.1\|312230_312914_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_020806817.1\|312931_313687_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-17	31.7
WP_003647608.1\|313697_314498_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-10	28.0
WP_003647609.1\|314508_315399_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_020806818.1\|315398_316391_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_020806819.1\|316407_317277_-	phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003649202.1\|317394_317925_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_087261269.1\|318583_319633_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7
WP_020806822.1\|319934_321431_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_020806823.1\|321532_322381_-	patatin family protein	NA	NA	NA	NA
WP_024273036.1\|322453_325255_-	cation-transporting P-type ATPase	M1HJQ2	Paramecium_bursaria_Chlorella_virus	6.7e-76	27.9
WP_020806825.1\|325390_325705_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003649208.1\|325888_326119_-	hypothetical protein	NA	NA	NA	NA
WP_024273054.1\|326260_327310_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_003649213.1\|327592_327790_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_049159833.1\|327799_328027_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_087261269.1\|328346_329396_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7
WP_003649215.1\|329529_330123_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003649216.1\|330133_332293_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.5e-47	27.2
WP_003649217.1\|332305_333103_-	response regulator transcription factor	NA	NA	NA	NA
WP_065169554.1\|333099_334407_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_003649220.1\|334409_334562_-	hypothetical protein	NA	NA	NA	NA
WP_020806830.1\|334704_336072_-	MFS transporter	NA	NA	NA	NA
WP_035425644.1\|336230_336869_+	uridine kinase	A0A1V0SAA3	Catovirus	1.1e-37	38.0
WP_003649223.1\|336908_337703_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_065169555.1\|337845_339774_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_020806832.1\|339968_340694_+	trehalose operon repressor	NA	NA	NA	NA
WP_020806833.1\|340707_342366_+	alpha,alpha-phosphotrehalase	NA	NA	NA	NA
WP_020806834.1\|342472_343309_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_020806835.1\|343355_344006_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003647625.1\|344019_344658_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_020806836.1\|344654_345479_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003647627.1\|345480_346230_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.9e-35	39.3
WP_020806837.1\|346680_347502_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_020806838.1\|347553_349323_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.4e-47	27.7
WP_020806839.1\|349315_351049_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.0e-38	27.6
WP_003649234.1\|351049_351490_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_020806840.1\|351578_352430_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003649236.1\|352527_353760_-	MFS transporter	NA	NA	NA	NA
WP_020806841.1\|353912_355406_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.0e-71	34.5
WP_020806842.1\|355553_357590_-	beta-galactosidase	NA	NA	NA	NA
WP_020806843.1\|357944_359231_+	phosphatidylserine decarboxylase family protein	NA	NA	NA	NA
WP_020806844.1\|359265_360699_+	amino acid permease	NA	NA	NA	NA
WP_020806845.1\|360724_362011_+	phosphatidylserine decarboxylase family protein	NA	NA	NA	NA
WP_003649245.1\|362068_362269_-	hypothetical protein	NA	NA	NA	NA
WP_020806846.1\|362268_363354_-	M42 family peptidase	NA	NA	NA	NA
WP_020806847.1\|363659_364247_+	hypothetical protein	NA	NA	NA	NA
WP_003649248.1\|364332_364764_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_020806848.1\|364756_364966_+	hypothetical protein	NA	NA	NA	NA
WP_020806849.1\|364967_366179_+	MFS transporter	NA	NA	NA	NA
WP_087261269.1\|366293_367343_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7

DBSCAN-SWA_4

598911 : 650529

unidentified_phage(30.77%)

protease,transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020807222.1\|598911_601380_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	3.1e-125	33.6
WP_020807223.1\|601832_603374_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	4.3e-85	38.7
WP_003649473.1\|603388_604396_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_020807224.1\|604455_605331_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_024273054.1\|605522_606572_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_020807225.1\|606753_609453_-	YfhO family protein	NA	NA	NA	NA
WP_020807226.1\|609535_611662_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	A0A0P0CCN8	Ostreococcus_mediterraneus_virus	7.0e-110	42.0
WP_020807227.1\|611745_613041_-\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	2.9e-10	24.6
WP_003649478.1\|613062_613419_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_003647843.1\|613418_613796_-	septum formation initiator family protein	NA	NA	NA	NA
WP_003649479.1\|613884_614127_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_065169769.1\|614140_617638_-	transcription-repair coupling factor	S6B678	Bacillus_phage	3.1e-06	32.1
WP_020807229.1\|617639_618197_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_003649482.1\|618377_619349_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_003647846.1\|619491_620172_+	CBS domain-containing protein	NA	NA	NA	NA
WP_087261301.1\|620234_621365_-	alanine racemase	NA	NA	NA	NA
WP_020807231.1\|621364_621724_-	holo-ACP synthase	NA	NA	NA	NA
WP_020807232.1\|621796_623254_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	2.4e-69	39.4
WP_020807233.1\|623269_624637_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_003647850.1\|624802_625054_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_020807234.1\|625171_626773_-	APC family permease	NA	NA	NA	NA
WP_020807235.1\|626871_627636_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	6.6e-10	28.2
WP_020807236.1\|627628_628528_-	ribose/xylose/arabinose/galactoside ABC transporter permease	NA	NA	NA	NA
WP_020807237.1\|628524_629517_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_020807238.1\|629775_632007_-	alpha-galactosidase	NA	NA	NA	NA
WP_020807239.1\|632077_633313_-	serine hydroxymethyltransferase	A0A240F2Y9	Aeromonas_phage	8.8e-97	52.4
WP_020807240.1\|633461_634877_+	C69 family dipeptidase	NA	NA	NA	NA
WP_087261269.1\|635118_636168_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7
WP_024273009.1\|636260_636743_+	hypothetical protein	NA	NA	NA	NA
WP_020806545.1\|637307_638024_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_020806546.1\|638062_638329_-	hypothetical protein	NA	NA	NA	NA
WP_020806547.1\|638392_639574_-	permease	NA	NA	NA	NA
WP_020806548.1\|641675_643034_+	formyl-CoA transferase	NA	NA	NA	NA
WP_003649502.1\|643240_643753_+	hypothetical protein	NA	NA	NA	NA
WP_020806549.1\|643838_644348_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	5.3e-24	40.6
WP_003649506.1\|645727_646018_-	hypothetical protein	NA	NA	NA	NA
WP_155761860.1\|646075_646243_-	hypothetical protein	NA	NA	NA	NA
WP_024273054.1\|646249_647299_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_077410116.1\|647979_648069_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_087261269.1\|649479_650529_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7

DBSCAN-SWA_5

879257 : 926737

Streptococcus_phage(30.77%)

transposase,integrase

attL 903353:903412|attR 925654:926847

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024273054.1\|879257_880307_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_020807263.1\|880811_881639_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	3.9e-101	64.2
WP_003648116.1\|881774_882041_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_020807262.1\|882075_882240_-	CsbD family protein	NA	NA	NA	NA
WP_020807261.1\|882529_883456_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_020807260.1\|883490_885413_-	TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein	A0A1S5SF82	Streptococcus_phage	9.5e-66	28.8
WP_087261323.1\|885647_887240_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-06	21.2
WP_003649711.1\|887564_887750_+	hypothetical protein	NA	NA	NA	NA
WP_003649712.1\|887861_888701_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	8.7e-48	37.3
WP_020807258.1\|888736_889444_-	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
WP_020807257.1\|889583_890273_+	DUF975 family protein	NA	NA	NA	NA
WP_003649715.1\|890325_890973_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_020807256.1\|891111_891969_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_020807255.1\|892006_893170_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_081275658.1\|893413_894451_-	aldo/keto reductase	NA	NA	NA	NA
WP_003656874.1\|894500_895019_-	DUF3278 domain-containing protein	NA	NA	NA	NA
WP_003648125.1\|895021_895216_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065169565.1\|896599_897439_-	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_052536208.1\|898696_899899_-	MFS transporter	NA	NA	NA	NA
WP_007125836.1\|899904_900642_-	HesA/MoeB/ThiF family protein	A0A1V0SAV8	Catovirus	1.3e-15	35.4
WP_007125837.1\|900707_900980_-	MoaD/ThiS family protein	NA	NA	NA	NA
WP_065169564.1\|901446_902304_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_065169563.1\|902421_903255_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
903353:903412	attL	NA	NA	NA	NA
WP_024273054.1\|903386_904436_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_087261325.1\|904568_905426_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_065169561.1\|905495_906401_-	hypothetical protein	A0A1D8EX18	Mycobacterium_phage	9.7e-53	40.1
WP_060462323.1\|906400_907441_-	DNA methylase	A0A1D8EX39	Mycobacterium_phage	6.8e-127	60.6
WP_065169560.1\|907492_908722_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_056940688.1\|908767_908947_-	hypothetical protein	NA	NA	NA	NA
WP_056940687.1\|908948_909332_-	hypothetical protein	NA	NA	NA	NA
WP_003624854.1\|909331_910153_-	hypothetical protein	NA	NA	NA	NA
WP_003624855.1\|910239_911034_-	cell division protein FtsK	NA	NA	NA	NA
WP_060462321.1\|911023_911575_-	hypothetical protein	NA	NA	NA	NA
WP_056940629.1\|911592_912033_-	hypothetical protein	NA	NA	NA	NA
WP_060462320.1\|912215_912932_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_065169559.1\|913003_913810_+	hypothetical protein	NA	NA	NA	NA
WP_003656878.1\|914223_914925_+	methyltransferase	G3MA03	Bacillus_virus	2.3e-17	41.9
WP_020807252.1\|915032_917051_+	hypothetical protein	NA	NA	NA	NA
WP_020807251.1\|917179_918322_+	DUF2974 domain-containing protein	NA	NA	NA	NA
WP_003649724.1\|918399_919284_-	ROK family protein	NA	NA	NA	NA
WP_003649725.1\|919380_920754_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.3e-125	52.1
WP_003649726.1\|920756_921212_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_003648132.1\|921223_923242_-	diguanylate cyclase	NA	NA	NA	NA
WP_020807249.1\|923347_924265_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_003649728.1\|924359_924596_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_003648134.1\|924620_925139_-	single-stranded DNA-binding protein	A0A290GHL8	Caldibacillus_phage	2.7e-39	50.6
WP_003648136.1\|925172_925469_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_024273054.1\|925687_926737_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
925654:926847	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1695530 : 1747110

unidentified_phage(41.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003648638.1\|1695530_1696796_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	59.4
WP_003648639.1\|1696795_1697380_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_020807138.1\|1697592_1698069_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_020807137.1\|1698068_1698584_+	hypothetical protein	NA	NA	NA	NA
WP_020807136.1\|1698826_1699357_+	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_020807135.1\|1699454_1700723_+	hypothetical protein	NA	NA	NA	NA
WP_020807134.1\|1700790_1701456_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_020807133.1\|1701573_1702428_+	hypothetical protein	NA	NA	NA	NA
WP_020807132.1\|1702634_1703108_+	hypothetical protein	NA	NA	NA	NA
WP_020807131.1\|1703353_1704358_+	transcriptional regulator	NA	NA	NA	NA
WP_020807130.1\|1704364_1705225_+	capsular polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_065169544.1\|1705235_1705997_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_020807128.1\|1706002_1706773_+	capsular polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_024273054.1\|1706810_1707860_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_020807921.1\|1707998_1708664_+	sugar transferase	NA	NA	NA	NA
WP_020807920.1\|1708663_1709611_+	glycosyltransferase	NA	NA	NA	NA
WP_020807919.1\|1709643_1710723_+	glycosyltransferase	NA	NA	NA	NA
WP_020807918.1\|1710712_1711543_+	glycosyltransferase	NA	NA	NA	NA
WP_020807917.1\|1711562_1712726_+	EpsG family protein	NA	NA	NA	NA
WP_020807916.1\|1712749_1713487_+	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_020807915.1\|1713515_1714637_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	7.1e-162	72.9
WP_020807914.1\|1714642_1716070_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_087261398.1\|1716292_1717309_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	3.1e-47	35.5
WP_065169820.1\|1718230_1718434_+	hypothetical protein	NA	NA	NA	NA
WP_024273054.1\|1718452_1719502_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_020807932.1\|1719702_1720215_+	DUF4065 domain-containing protein	M4SRU1	Rhodobacter_phage	8.9e-11	30.6
WP_020807933.1\|1720214_1720580_+	hypothetical protein	NA	NA	NA	NA
WP_087261401.1\|1720721_1720994_+	hypothetical protein	NA	NA	NA	NA
WP_065169749.1\|1721610_1721868_-	hypothetical protein	NA	NA	NA	NA
WP_020807937.1\|1721852_1722047_-	Mobile element protein	NA	NA	NA	NA
WP_087261405.1\|1722637_1723555_-	hypothetical protein	NA	NA	NA	NA
WP_024273054.1\|1723561_1724611_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_087261407.1\|1724693_1725176_-	hypothetical protein	NA	NA	NA	NA
WP_087261410.1\|1726507_1727851_+	hypothetical protein	NA	NA	NA	NA
WP_065169748.1\|1729419_1729905_+	hypothetical protein	NA	NA	NA	NA
WP_065169747.1\|1729901_1730477_+	hypothetical protein	NA	NA	NA	NA
WP_065169746.1\|1730478_1731435_+	hypothetical protein	NA	NA	NA	NA
WP_113533095.1\|1732084_1732252_-	DUF3938 domain-containing protein	NA	NA	NA	NA
WP_020807057.1\|1732872_1734048_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_003647166.1\|1734129_1735167_+	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	3.4e-86	47.1
WP_020807056.1\|1735173_1736058_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.2e-94	58.6
WP_003647168.1\|1736090_1736699_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.7e-45	50.8
WP_020807055.1\|1736715_1737702_+	dTDP-4-dehydrorhamnose reductase	A0A140G5S3	Enterobacteria_phage	3.1e-28	36.3
WP_020807054.1\|1738034_1742195_+	type II CRISPR RNA-guided endonuclease Cas9	NA	NA	NA	NA
WP_020807053.1\|1742400_1743309_+	type II CRISPR-associated endonuclease Cas1	NA	NA	NA	NA
WP_087261458.1\|1743286_1743628_+	CRISPR-associated endonuclease Cas2	NA	NA	NA	NA
WP_087261412.1\|1743588_1744257_+	type II-A CRISPR-associated protein Csn2	NA	NA	NA	NA
WP_020807050.1\|1745568_1745994_+	hypothetical protein	NA	NA	NA	NA
WP_024273054.1\|1746060_1747110_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7

DBSCAN-SWA_7

1790791 : 1851586

unidentified_phage(15.79%)

protease,transposase,tRNA,integrase

attL 1790109:1790126|attR 1792431:1792448

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1790109:1790126	attL	NA	NA	NA	NA
WP_020807019.1\|1790791_1791727_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	1.8e-81	49.7
WP_065169692.1\|1793052_1794339_+	hypothetical protein	NA	NA	NA	NA
1792431:1792448	attR	NA	NA	NA	NA
WP_020807016.1\|1794766_1795678_+	restriction endonuclease	NA	NA	NA	NA
WP_133258104.1\|1795688_1796225_+	hypothetical protein	NA	NA	NA	NA
WP_024273065.1\|1796230_1796959_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	3.0e-36	50.4
WP_020807013.1\|1797398_1798340_+	restriction endonuclease	NA	NA	NA	NA
WP_020807012.1\|1798586_1799801_-	ATP-binding protein	NA	NA	NA	NA
WP_020807011.1\|1800003_1800894_-	YitT family protein	M1Q1P6	Streptococcus_phage	5.2e-59	38.9
WP_065169694.1\|1800949_1802146_+\|tRNA	CCA tRNA nucleotidyltransferase	G3MAR3	Bacillus_virus	1.3e-33	30.7
WP_003651163.1\|1802194_1802860_-	hemolysin III family protein	NA	NA	NA	NA
WP_020807009.1\|1803001_1803859_+	DegV family protein	A0A0N9SI50	Staphylococcus_phage	2.2e-14	37.1
WP_020807008.1\|1803858_1804086_+	YozE family protein	NA	NA	NA	NA
WP_087261416.1\|1804093_1805542_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	5.1e-11	28.4
WP_020807006.1\|1805543_1806383_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_020807005.1\|1806379_1807132_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	4.9e-26	40.4
WP_020807004.1\|1807183_1808029_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_003648735.1\|1808094_1810176_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.2e-99	36.5
WP_020807003.1\|1810273_1811590_+\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA
WP_065169696.1\|1811592_1812516_+	tyrosine recombinase XerC	A0A097EYL9	Mycobacterium_phage	1.8e-17	29.6
WP_020807002.1\|1812519_1813044_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_020807001.1\|1813054_1814449_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IEP8	Erwinia_phage	1.9e-31	27.1
WP_020807000.1\|1814476_1815364_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_020806999.1\|1815423_1816026_+	hypothetical protein	NA	NA	NA	NA
WP_020806998.1\|1816184_1816748_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_003648742.1\|1817015_1817477_+	hypothetical protein	NA	NA	NA	NA
WP_065169697.1\|1817673_1818705_+	putative sulfate exporter family transporter	NA	NA	NA	NA
WP_020806996.1\|1818867_1819215_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_081275669.1\|1819340_1819718_+	hypothetical protein	NA	NA	NA	NA
WP_020806994.1\|1821108_1821747_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.8e-19	33.5
WP_020806993.1\|1822633_1824313_+	acetolactate synthase AlsS	NA	NA	NA	NA
WP_020806992.1\|1824296_1825049_+	acetolactate decarboxylase	NA	NA	NA	NA
WP_020806991.1\|1825104_1825518_-	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_020806990.1\|1825519_1825957_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_024272995.1\|1826190_1827240_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.4
WP_147614543.1\|1827724_1829230_+	adhesin	NA	NA	NA	NA
WP_020806987.1\|1829319_1829919_+	HAD family phosphatase	NA	NA	NA	NA
WP_020806986.1\|1829949_1830573_+	NUDIX hydrolase	NA	NA	NA	NA
WP_020806985.1\|1830862_1831609_+	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_020806984.1\|1832071_1833448_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_020806983.1\|1833660_1834506_+	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
WP_020806982.1\|1834516_1834897_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_020806981.1\|1835014_1835308_+	hypothetical protein	NA	NA	NA	NA
WP_020806980.1\|1835363_1836536_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	6.9e-43	31.8
WP_020806979.1\|1836632_1837427_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-09	26.7
WP_020806978.1\|1837606_1839202_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.7e-15	28.4
WP_065169735.1\|1839198_1840782_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.2e-17	20.8
WP_020806976.1\|1840945_1841797_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-20	31.2
WP_020806975.1\|1841796_1842651_+	multidrug ABC transporter permease	NA	NA	NA	NA
WP_020806974.1\|1842654_1843107_+	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_020806973.1\|1843108_1843504_+	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_020806972.1\|1843550_1844270_+	Fic family protein	NA	NA	NA	NA
WP_020806971.1\|1844375_1844789_+	cupin domain-containing protein	NA	NA	NA	NA
WP_020806970.1\|1845418_1846786_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_020806969.1\|1846962_1847940_+	choloylglycine hydrolase family protein	NA	NA	NA	NA
WP_024273054.1\|1848072_1849122_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_087261421.1\|1850536_1851586_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.1e-47	35.4

DBSCAN-SWA_8

1877656 : 2009485

147

Lactobacillus_phage(52.86%)

integrase,tail,head,capsid,holin,transposase,protease,terminase,portal

attL 1978573:1978589|attR 2001905:2001921

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024273054.1\|1877656_1878706_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_003647298.1\|1879413_1880112_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_020807357.1\|1880179_1880767_-	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	1.0e-26	44.4
WP_020807356.1\|1880829_1882623_-	DNA helicase RecQ	A0A0G2Y8K9	Acanthamoeba_polyphaga_mimivirus	6.1e-83	38.7
WP_003647301.1\|1882696_1883632_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_087261425.1\|1884940_1887421_-	DNA topoisomerase IV subunit A	A0A172JHV7	Bacillus_phage	2.8e-94	30.7
WP_020807354.1\|1887437_1889396_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.4e-117	40.7
WP_020807353.1\|1889495_1890155_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_020807352.1\|1890257_1890872_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_020807351.1\|1891000_1891651_+	endonuclease III-like protein	NA	NA	NA	NA
WP_065169824.1\|1891697_1892573_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.3e-41	34.0
WP_113533196.1\|1892541_1893057_-	aldo/keto reductase	NA	NA	NA	NA
WP_020807348.1\|1893044_1893914_-	ABC transporter ATP-binding protein	M1H3A1	Paramecium_bursaria_Chlorella_virus	2.8e-09	28.5
WP_020807347.1\|1893920_1895168_-	ABC transporter permease	NA	NA	NA	NA
WP_020807346.1\|1895164_1896280_-	ABC transporter permease	NA	NA	NA	NA
WP_087261269.1\|1896882_1897932_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7
WP_020807344.1\|1898411_1898648_-	hypothetical protein	NA	NA	NA	NA
WP_020807343.1\|1898765_1899479_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_087261269.1\|1899585_1900635_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	1.4e-47	35.7
WP_065169681.1\|1901062_1901998_-	lysin	Q6SE63	Lactobacillus_prophage	2.2e-116	64.7
WP_065169680.1\|1902010_1902409_-\|holin	phage holin	Q6SEB6	Lactobacillus_prophage	6.3e-57	88.6
WP_003656255.1\|1902405_1902642_-	hypothetical protein	NA	NA	NA	NA
WP_065169679.1\|1902655_1903057_-	hypothetical protein	Q6SEB9	Lactobacillus_prophage	4.0e-43	66.2
WP_100215364.1\|1903118_1903262_-	XkdX family protein	NA	NA	NA	NA
WP_035422715.1\|1903261_1903915_-	hypothetical protein	NA	NA	NA	NA
WP_065169678.1\|1903934_1904366_-	hypothetical protein	NA	NA	NA	NA
WP_065169677.1\|1904392_1906963_-	hypothetical protein	Q6SEC0	Lactobacillus_prophage	4.5e-63	42.8
WP_051994789.1\|1906962_1907292_-	hypothetical protein	NA	NA	NA	NA
WP_003656249.1\|1907323_1908679_-	hypothetical protein	O03938	Lactobacillus_phage	4.6e-22	26.6
WP_003656247.1\|1908693_1909515_-\|tail	phage tail family protein	D2KRB8	Lactobacillus_phage	6.1e-62	46.7
WP_065169676.1\|1909507_1914526_-	tape measure protein	Q9T1E7	Lactobacillus_phage	1.5e-107	42.2
WP_003656243.1\|1914529_1915147_-	hypothetical protein	A0A1S5SAD5	Streptococcus_phage	2.2e-11	31.5
WP_003656242.1\|1915151_1915580_-	hypothetical protein	NA	NA	NA	NA
WP_065169682.1\|1915591_1915942_-	hypothetical protein	NA	NA	NA	NA
WP_003656240.1\|1916203_1916605_-	hypothetical protein	NA	NA	NA	NA
WP_035422713.1\|1916597_1916969_-\|capsid	phage capsid protein	O03933	Lactobacillus_phage	4.3e-15	39.4
WP_003656238.1\|1916978_1917329_-	hypothetical protein	O03932	Lactobacillus_phage	1.1e-20	41.5
WP_003656237.1\|1917322_1917712_-	hypothetical protein	NA	NA	NA	NA
WP_003656235.1\|1917734_1918787_-	hypothetical protein	O03966	Lactobacillus_phage	2.7e-99	52.3
WP_003656234.1\|1918793_1919420_-	scaffold protein	X2CYF9	Lactobacillus_phage	1.3e-16	34.3
WP_035422709.1\|1919516_1919774_-	hypothetical protein	NA	NA	NA	NA
WP_080581165.1\|1919777_1920092_-	hypothetical protein	U3PFU0	Lactobacillus_phage	6.8e-22	56.4
WP_035422707.1\|1920208_1920865_-	hypothetical protein	NA	NA	NA	NA
WP_065169675.1\|1921833_1923468_-\|portal	phage portal protein	Q38341	Lactococcus_phage	2.9e-132	48.6
WP_065169674.1\|1923480_1924785_-\|terminase	PBSX family phage terminase large subunit	A4L7R3	Lactococcus_phage	4.8e-170	65.0
WP_065169673.1\|1924753_1925284_-\|terminase	terminase small subunit	Q20DD9	Lactobacillus_phage	1.9e-48	67.3
WP_003656228.1\|1925345_1925789_-	hypothetical protein	NA	NA	NA	NA
WP_065169672.1\|1925763_1926234_-	DUF4065 domain-containing protein	Q9AZG0	Lactococcus_phage	8.1e-27	40.5
WP_065169671.1\|1927585_1928089_-	hypothetical protein	Q20DE6	Lactobacillus_phage	2.7e-89	94.0
WP_011678824.1\|1928118_1928289_-	hypothetical protein	Q20DE7	Lactobacillus_phage	5.5e-26	100.0
WP_003648032.1\|1928587_1928848_-	hypothetical protein	A9D9P5	Lactobacillus_prophage	2.3e-23	60.5
WP_065169670.1\|1928955_1929207_-	helix-turn-helix transcriptional regulator	X2CY61	Lactobacillus_phage	4.7e-34	96.1
WP_065169669.1\|1929212_1930100_-	hypothetical protein	Q6SEE7	Lactobacillus_prophage	1.8e-144	86.7
WP_065169668.1\|1930112_1930904_-	hypothetical protein	Q6SEE8	Lactobacillus_prophage	1.6e-112	78.4
WP_003656219.1\|1930905_1931781_-	DUF1351 domain-containing protein	Q6SE94	Lactobacillus_prophage	5.9e-63	46.3
WP_155761842.1\|1931799_1931958_-	hypothetical protein	NA	NA	NA	NA
WP_035422704.1\|1932121_1932370_-	hypothetical protein	Q9T1I6	Lactobacillus_phage	5.4e-06	36.9
WP_035422702.1\|1932366_1932603_-	hypothetical protein	NA	NA	NA	NA
WP_003656218.1\|1932616_1933399_-	hypothetical protein	Q20DF7	Lactobacillus_phage	2.3e-79	63.6
WP_035422701.1\|1933410_1933623_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003656217.1\|1933776_1934400_+	helix-turn-helix domain-containing protein	Q9G0C2	Lactococcus_phage	6.7e-37	43.8
WP_003656215.1\|1935021_1935753_+	SHOCT domain-containing protein	O48432	Lactobacillus_phage	1.2e-29	38.2
WP_003656214.1\|1935766_1936771_+	hypothetical protein	NA	NA	NA	NA
WP_035422700.1\|1936773_1936980_-	hypothetical protein	NA	NA	NA	NA
WP_003656213.1\|1937183_1938398_+\|integrase	site-specific integrase	A9D9I9	Lactobacillus_prophage	6.1e-50	33.4
WP_024273054.1\|1938980_1940030_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_020807359.1\|1940315_1941386_+	tyrosine recombinase XerS	A0A0E3XA96	Gordonia_phage	4.0e-05	29.6
WP_020807360.1\|1941454_1942339_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_020807361.1\|1942408_1943500_-	hypothetical protein	NA	NA	NA	NA
WP_020807362.1\|1943584_1944472_-	DegV family protein	NA	NA	NA	NA
WP_003648850.1\|1944576_1944987_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_020807363.1\|1945175_1946867_+	fibronectin/fibrinogen-binding protein	Q84500	Paramecium_bursaria_Chlorella_virus	1.0e-10	41.2
WP_020807364.1\|1946952_1950117_-	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
WP_020807365.1\|1950120_1951176_-	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
WP_087261427.1\|1951179_1952094_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.0e-09	29.1
WP_003648855.1\|1952108_1952573_-	signal peptidase II	NA	NA	NA	NA
WP_020807367.1\|1952573_1954247_-	formate--tetrahydrofolate ligase	NA	NA	NA	NA
WP_020807368.1\|1954249_1954594_-	hypothetical protein	NA	NA	NA	NA
WP_020807369.1\|1954726_1955650_+	DegV family protein	NA	NA	NA	NA
WP_065169576.1\|1955708_1956941_-	3',5'-cyclic-nucleotide phosphodiesterase	NA	NA	NA	NA
WP_020807371.1\|1956943_1958068_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
WP_003648861.1\|1958532_1958970_-	DivIVA domain-containing protein	NA	NA	NA	NA
WP_065169667.1\|1959276_1960251_-	glycoside hydrolase family 25	Q6SE63	Lactobacillus_prophage	1.0e-47	38.0
WP_065169665.1\|1960727_1960949_-	hypothetical protein	NA	NA	NA	NA
WP_147614544.1\|1960951_1961359_-	hypothetical protein	NA	NA	NA	NA
WP_065169663.1\|1961324_1961534_-	XkdX family protein	Q9T1E1	Lactobacillus_phage	1.3e-08	49.1
WP_065169662.1\|1961533_1962049_-	hypothetical protein	Q9T1E2	Lactobacillus_phage	1.2e-36	53.6
WP_065169578.1\|1965104_1965314_-	hypothetical protein	NA	NA	NA	NA
WP_065169579.1\|1965330_1968150_-	hypothetical protein	B8R659	Lactobacillus_phage	5.4e-219	43.4
WP_147614545.1\|1968149_1968926_-	hypothetical protein	B8R658	Lactobacillus_phage	2.4e-28	36.7
WP_065169581.1\|1968891_1975887_-\|tail	phage tail tape measure protein	F8J1C3	Lactobacillus_phage	3.6e-38	36.9
WP_065169582.1\|1976114_1976540_-	hypothetical protein	NA	NA	NA	NA
WP_065169583.1\|1976725_1977361_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	3.0e-56	55.7
WP_065169584.1\|1977360_1977747_-	hypothetical protein	E9LUQ7	Lactobacillus_phage	1.5e-26	43.3
WP_065169585.1\|1977748_1978186_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	2.1e-21	36.6
WP_081275662.1\|1978182_1978512_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	6.3e-18	44.2
WP_065169587.1\|1978544_1978916_-\|head,tail	phage gp6-like head-tail connector protein	F8J1B6	Lactobacillus_phage	4.9e-19	44.9
1978573:1978589	attL	NA	NA	NA	NA
WP_065169588.1\|1979178_1980354_-\|capsid	phage major capsid protein	F8J1B4	Lactobacillus_phage	1.2e-103	53.6
WP_065169649.1\|1980354_1981113_-\|protease	Clp protease ClpP	F8J1B3	Lactobacillus_phage	5.8e-67	59.7
WP_065169589.1\|1981048_1982386_-\|portal	phage portal protein	F8J1B2	Lactobacillus_phage	4.3e-105	51.7
WP_065169590.1\|1982401_1982680_-	hypothetical protein	NA	NA	NA	NA
WP_065169591.1\|1982690_1983434_-	site-specific DNA-methyltransferase	A0A2P0ZL38	Lactobacillus_phage	1.4e-78	64.0
WP_087261431.1\|1983443_1984751_-\|terminase	terminase large subunit	F8J1B1	Lactobacillus_phage	8.8e-180	68.3
WP_113779214.1\|1985028_1985349_-	hypothetical protein	A0A1B1P7R3	Bacillus_phage	4.6e-34	59.4
WP_065169594.1\|1985519_1985978_-\|terminase	phage terminase small subunit P27 family	F8J1A9	Lactobacillus_phage	7.4e-25	45.0
WP_157664545.1\|1986183_1986519_-	HNH endonuclease	F8J1B0	Lactobacillus_phage	2.1e-21	49.1
WP_065169595.1\|1987770_1987962_-	hypothetical protein	NA	NA	NA	NA
WP_065169596.1\|1987930_1988113_-	hypothetical protein	NA	NA	NA	NA
WP_065169597.1\|1988102_1988303_-	hypothetical protein	NA	NA	NA	NA
WP_065169598.1\|1988600_1988825_-	hypothetical protein	NA	NA	NA	NA
WP_065169599.1\|1988940_1989333_-	hypothetical protein	NA	NA	NA	NA
WP_065169600.1\|1989363_1989636_-	hypothetical protein	NA	NA	NA	NA
WP_065169601.1\|1989882_1990269_-	hypothetical protein	NA	NA	NA	NA
WP_065169602.1\|1990285_1990687_-	hypothetical protein	NA	NA	NA	NA
WP_065169603.1\|1990697_1991075_-	hypothetical protein	NA	NA	NA	NA
WP_065169604.1\|1991303_1991522_-	hypothetical protein	NA	NA	NA	NA
WP_155761837.1\|1992118_1992274_-	hypothetical protein	NA	NA	NA	NA
WP_065169605.1\|1992302_1992521_-	hypothetical protein	NA	NA	NA	NA
WP_065169606.1\|1992637_1993069_-	hypothetical protein	F8J1G8	Lactobacillus_phage	1.7e-31	50.4
WP_155761838.1\|1993080_1993257_-	hypothetical protein	NA	NA	NA	NA
WP_065169608.1\|1995455_1995893_-	RusA family crossover junction endodeoxyribonuclease	Q8SDG7	Lactococcus_phage	3.7e-34	51.9
WP_065169609.1\|1995889_1996252_-	hypothetical protein	NA	NA	NA	NA
WP_065169610.1\|1996267_1996846_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065169611.1\|1996918_1997146_-	hypothetical protein	NA	NA	NA	NA
WP_087261434.1\|1997222_1997456_-	hypothetical protein	NA	NA	NA	NA
WP_065169613.1\|1997502_1997745_-	hypothetical protein	NA	NA	NA	NA
WP_113779207.1\|1997821_1997992_-	sporulation protein Cse60	NA	NA	NA	NA
WP_065169614.1\|1997981_1998230_-	hypothetical protein	NA	NA	NA	NA
WP_147614546.1\|1998245_1998551_-	hypothetical protein	NA	NA	NA	NA
WP_065169616.1\|1998567_1998816_-	hypothetical protein	NA	NA	NA	NA
WP_065169617.1\|1998805_1999189_-	hypothetical protein	NA	NA	NA	NA
WP_157664546.1\|1999185_1999353_-	hypothetical protein	NA	NA	NA	NA
WP_065169618.1\|1999505_1999715_-	hypothetical protein	NA	NA	NA	NA
WP_065169619.1\|1999714_2000104_-	hypothetical protein	NA	NA	NA	NA
WP_113779203.1\|2000320_2000482_-\|integrase	integrase	NA	NA	NA	NA
WP_065169621.1\|2000522_2000969_-	single-stranded DNA-binding protein	A0A1J0MFL8	Staphylococcus_phage	3.0e-31	53.3
WP_065169622.1\|2000968_2001250_-	hypothetical protein	NA	NA	NA	NA
WP_147614547.1\|2001668_2001908_-	hypothetical protein	NA	NA	NA	NA
WP_065169624.1\|2001985_2002171_-	hypothetical protein	Q20DF6	Lactobacillus_phage	3.2e-11	56.9
2001905:2001921	attR	NA	NA	NA	NA
WP_065169625.1\|2002187_2002973_-	hypothetical protein	Q20DF7	Lactobacillus_phage	2.3e-98	76.9
WP_065169626.1\|2003874_2004072_-	hypothetical protein	NA	NA	NA	NA
WP_065169627.1\|2004064_2004310_-	hypothetical protein	NA	NA	NA	NA
WP_065169628.1\|2004482_2006693_-	AAA family ATPase	A0A2K9VD36	Lactobacillus_phage	2.0e-67	28.4
WP_065169629.1\|2006695_2007013_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_065169630.1\|2007013_2007820_-	AAA domain-containing protein	B8R682	Lactobacillus_phage	1.1e-50	43.8
WP_065169631.1\|2007835_2008750_-	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	7.0e-43	39.0
WP_065169632.1\|2008768_2009485_-	hypothetical protein	A0A1S5SAA3	Streptococcus_phage	1.4e-17	38.3

DBSCAN-SWA_9

2017345 : 2084477

unidentified_phage(33.33%)

tRNA,holin,transposase,protease,integrase

attL 2016214:2016228|attR 2022875:2022889

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2016214:2016228	attL	NA	NA	NA	NA
WP_065169648.1\|2017345_2018470_+\|integrase	site-specific integrase	Q6SEG4	Lactobacillus_prophage	1.6e-100	50.9
WP_020807372.1\|2018680_2019250_-	DUF1273 domain-containing protein	NA	NA	NA	NA
WP_003648863.1\|2019318_2019948_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	4.4e-20	39.3
WP_020807373.1\|2019937_2022316_+	penicillin-binding protein	NA	NA	NA	NA
WP_020807374.1\|2022402_2023032_-	endonuclease III	NA	NA	NA	NA
2022875:2022889	attR	NA	NA	NA	NA
WP_020807375.1\|2023040_2023685_-	DnaD domain protein	NA	NA	NA	NA
WP_003648867.1\|2023752_2025051_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.3e-47	26.5
WP_020807376.1\|2025119_2025614_-	hypothetical protein	NA	NA	NA	NA
WP_020807377.1\|2025606_2028420_-	DEAD/DEAH box helicase	A0A1X9I5C8	Streptococcus_phage	8.8e-60	33.6
WP_020807378.1\|2028444_2032059_-	helicase-exonuclease AddAB subunit AddA	S5MMD7	Bacillus_phage	2.7e-21	24.0
WP_020807379.1\|2032059_2035536_-	ATP-dependent nuclease subunit B	NA	NA	NA	NA
WP_020807380.1\|2035622_2036540_+	mevalonate kinase	NA	NA	NA	NA
WP_020807381.1\|2036539_2037505_+	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_020807382.1\|2037539_2038613_+	phosphomevalonate kinase	NA	NA	NA	NA
WP_020807383.1\|2038637_2039663_+	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_020807384.1\|2039749_2041333_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.2e-15	21.5
WP_087261251.1\|2041734_2042784_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.4
WP_020807880.1\|2043080_2043899_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_020807881.1\|2044052_2044928_+\|protease	membrane protease family stomatin/prohibitin-like protein	NA	NA	NA	NA
WP_020807882.1\|2044994_2045807_+	DUF975 family protein	NA	NA	NA	NA
WP_020807883.1\|2045865_2046441_-	hypothetical protein	NA	NA	NA	NA
WP_020807884.1\|2046524_2047070_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_020807885.1\|2047041_2047770_+	hypothetical protein	NA	NA	NA	NA
WP_024272995.1\|2047874_2048924_-\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.4
WP_020807886.1\|2049041_2049686_+	hypothetical protein	NA	NA	NA	NA
WP_020807887.1\|2049740_2049941_-	hypothetical protein	NA	NA	NA	NA
WP_020807888.1\|2050012_2051164_-	hypothetical protein	NA	NA	NA	NA
WP_020807889.1\|2051288_2051933_-	nitroreductase family protein	NA	NA	NA	NA
WP_020807890.1\|2052092_2052956_-	homoserine kinase	NA	NA	NA	NA
WP_020807891.1\|2052965_2054192_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_020807892.1\|2054292_2055780_+	threonine synthase	NA	NA	NA	NA
WP_020807893.1\|2055811_2056870_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_020807894.1\|2056958_2058314_+	aspartate kinase	NA	NA	NA	NA
WP_024273054.1\|2058426_2059476_+\|transposase	IS30-like element ISLga1 family transposase	H7BWC8	unidentified_phage	2.4e-47	35.7
WP_065169808.1\|2075689_2077942_+	ABC transporter permease	NA	NA	NA	NA
WP_147614549.1\|2078619_2082312_-	Cna B-type domain-containing protein	NA	NA	NA	NA
WP_065169805.1\|2082566_2083589_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_065169804.1\|2083758_2084106_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016378676.1\|2084372_2084477_+\|holin	putative holin-like toxin	NA	NA	NA	NA

DBSCAN-SWA_10

2111044 : 2118874

Lactococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020807716.1\|2111044_2113213_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A0D3MSW9	Lactococcus_phage	4.2e-171	47.3
WP_020807717.1\|2113205_2113628_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	1.5e-11	34.2
WP_020807718.1\|2113611_2114619_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A160DHK0	Gordonia_phage	1.2e-96	54.0
WP_020807721.1\|2115906_2116494_-	recombinase family protein	M4QQC6	Vibrio_phage	5.9e-19	42.4
WP_065169814.1\|2117229_2118045_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-09	29.0
WP_047036257.1\|2118031_2118874_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.8e-16	30.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021427

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection