CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP020860	Ligilactobacillus salivarius strain ZLS006 plasmid unnamed2, complete sequence	0 crisprs	c2c10_CAS-V-U3	0	1
NZ_CP020859	Ligilactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	2 crisprs	c2c4_V-U1,cas14j,DEDDh,cas14k	3	7
NZ_CP020858	Ligilactobacillus salivarius strain ZLS006 chromosome, complete genome	0 crisprs	csa3,Cas14u_CAS-V,cas3,DEDDh,DinG,cas14j,c2c10_CAS-V-U3,c2c4_V-U1	0	15

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13517

Staphylococcus_phage(20.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001791010.1\|944_1061_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_087449160.1\|3771_4689_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-41	42.7
WP_087449161.1\|4869_5484_-	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	3.2e-07	48.4
WP_087449162.1\|6092_6662_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-28	41.6
WP_087449163.1\|6675_6978_+	hypothetical protein	NA	NA	NA	NA
WP_087449164.1\|7223_7721_+	hypothetical protein	NA	NA	NA	NA
WP_087449165.1\|8484_9693_+	RepB family plasmid replication initiator protein	A0A218MNI2	uncultured_virus	1.7e-07	23.5
WP_157664651.1\|10279_10423_-	hypothetical protein	NA	NA	NA	NA
WP_087449166.1\|12296_13517_-\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	3.6e-95	45.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP020859

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020859_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020859_1

166342-166419

TypeV

Consensus_repeat	Method
ATGTATTTTTCATAGAAAATAAA	CRISPRCasFinder

1 spacers

DEDDh,cas14k

The CRISPR arrays of NZ_CP020859_1

>merge|NZ_CP020859|1|166342-166419|CRISPRCasFinder
ATGTATTTTTCATAGAAAATAAACTATCATTGATACGACGGCATTTATAACTACCATGTATTTTTTATAGAAAATAAA

>NZ_CP020859|1|1|166342-166419|CRISPRCasFinder
ATGTATTTTTCATAGAAAATAAA	CTATCATTGATACGACGGCATTTATAACTACC
ATGTATTTTTTATAGAAAATAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020859.1\|WP_087449096.1\|162105_163365_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225718
NZ_CP020859.1\|WP_087449094.1\|159922_160252_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_003699335.1\|173652_173988_+\|DUF5388-domain-containing-protein	unknown	unknown	gnl\|CDD\|375154
NZ_CP020859.1\|WP_087449095.1\|160254_161196_+\|3'-5'-exoribonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235735
NZ_CP020859.1\|WP_087449100.1\|166433_167246_+\|putative-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225420
NZ_CP020859.1\|WP_087449097.1\|163492_164545_+\|NINE-protein	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP020859.1\|WP_087449093.1\|157800_158328_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449104.1\|177426_178698_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225519
NZ_CP020859.1\|WP_087449103.1\|174626_177161_-\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341064
NZ_CP020859.1\|WP_157664642.1\|161673_161823_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449106.1\|179545_180820_+\|Cys-Gln-thioester-bond-forming-surface-protein	unknown	unknown	gnl\|CDD\|369823
NZ_CP020859.1\|WP_087449102.1\|169462_170455_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|369151
NZ_CP020859.1\|WP_087449107.1\|180964_181930_+\|virulence-RhuM-family-protein	unknown	unknown	gnl\|CDD\|379118
NZ_CP020859.1\|WP_157664640.1\|158617_158761_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449159.1\|159186_159900_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|119397
NZ_CP020859.1\|WP_087449099.1\|165425_165824_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449098.1\|164839_165370_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449101.1\|168413_169178_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP020859.1\|WP_081535655.1\|170855_172199_-\|IS200/IS605-family-accessory-protein-TnpB-related-protein	cas14k	-	gnl\|CDD\|223747
NZ_CP020859.1\|WP_087449105.1\|178694_179432_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225818

Protein	Function_ID	Function_description	E-value
NZ_CP020859.1\|WP_087449096.1\|162105_163365_+\|Fic-family-protein	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	2.64481e-20
NZ_CP020859.1\|WP_003699335.1\|173652_173988_+\|DUF5388-domain-containing-protein	gnl\|CDD\|375154	pfam17363, DUF5388, Family of unknown function (DUF5388). This is a family of unknown function found in Lactobacillales.	6.34615e-29
NZ_CP020859.1\|WP_087449095.1\|160254_161196_+\|3'-5'-exoribonuclease	gnl\|CDD\|235735	PRK06195, PRK06195, DNA polymerase III subunit epsilon; Validated.	1.69257e-71
NZ_CP020859.1\|WP_087449100.1\|166433_167246_+\|putative-DNA-binding-domain-containing-protein	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	6.80511e-16
NZ_CP020859.1\|WP_087449097.1\|163492_164545_+\|NINE-protein	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	7.43374e-37
NZ_CP020859.1\|WP_087449103.1\|174626_177161_-\|M1-family-metallopeptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	0
NZ_CP020859.1\|WP_087449105.1\|178694_179432_+\|response-regulator-transcription-factor	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	2.13596e-30
NZ_CP020859.1\|WP_087449106.1\|179545_180820_+\|Cys-Gln-thioester-bond-forming-surface-protein	gnl\|CDD\|369823	pfam08341, TED, Thioester domain. This domain is found near the N-terminus of a variety of bacterial surface proteins and pili. This domain contains an unusual covalent ester bond between a conserved cysteine and glutamine residue.	2.83475e-17
NZ_CP020859.1\|WP_087449102.1\|169462_170455_+\|replication-initiator-protein-A	gnl\|CDD\|369151	pfam06970, RepA_N, Replication initiator protein A (RepA) N-terminus. This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.	3.07998e-05
NZ_CP020859.1\|WP_087449107.1\|180964_181930_+\|virulence-RhuM-family-protein	gnl\|CDD\|379118	pfam13310, Virulence_RhuM, Virulence protein RhuM family. There are currently no experimental data for members of this group or their homologs. However, these proteins are implicated in virulence/pathogenicity because RhuM is encoded in the SPI-3 pathogenicity island in Salmonella typhimurium.	1.66542e-144
NZ_CP020859.1\|WP_087449159.1\|159186_159900_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	2.6788e-19
NZ_CP020859.1\|WP_087449104.1\|177426_178698_+\|GHKL-domain-containing-protein	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	5.23743e-16
NZ_CP020859.1\|WP_087449101.1\|168413_169178_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	2.07777e-27
NZ_CP020859.1\|WP_081535655.1\|170855_172199_-\|IS200/IS605-family-accessory-protein-TnpB-related-protein	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.32027e-18

>NZ_CP020859.1|WP_087449099.1|165425_165824_+|hypothetical-protein
MLTVTIIFAIVGTIIPIIGNLIFGLLGFMIIYIICATIDYFRLSKSDKEKLKAENQAMKDFKIQAQKNKFKCPNCGSKNIQALGIHKKGFSTGKAVGGAILTGGVGALAGFAGKKTNKTDFVCNGCGRRFIL
>NZ_CP020859.1|WP_087449098.1|164839_165370_+|hypothetical-protein
MFFKFFKKQENSASLNNKRINKKTGYQMSTDKQIKAAKENVKFSEKYKFVDNEYYSDEMRYSNKVIDFVLPHYNKGNYYYKIGEWDKAENEWLMILKLMGHFPTLKLAIMYRKQKRFSDEVELLKLSQIYARKNTVYPGTKAIIERIPKAEKFREKHINEDKSKGIDKNKIIQKII
>NZ_CP020859.1|WP_087449097.1|163492_164545_+|NINE-protein
MNLEKIKDLIEKNFIKSKNIWLAYLLAIFFGTFGLHRFYLKKNGLKMLLITVLTLGLGVIITCPILIMDFFKIPDWVKDCNNINNTSPTEKNIQTNQSSKHINNTVTSINLNESMSTSSRLNNSLSANIEETNSSNIDKPRNSQVISYYFKPKLQPVMEFKPKTKTHKKSTRTKTNSSETIKISKLRKLRDDYVVVDIETTGLSPSEDKIIQLSAIKYIDNKEIAVFNEYINPHTKLSDFIINLTGITQDIVDYGKELNDIKDNFISFYGDLPLVGHYINGFDIKFLIANNLIIKNISTIDTLPLARKLDLEDAKLPTVKKFLGINNNSHDSLDDCYTTNALYQFAKKNF
>NZ_CP020859.1|WP_087449096.1|162105_163365_+|Fic-family-protein
MKKYTSLKSVFYSDKSSDKVIYTDFLNNRLNNELIVYSGLKMSPFNSKKEIRDVNTLFEIFFLPTVQISILKDKIYKNSSVITYYMSQLPEVASDQLFYNTLVLELQSTNDIEGIRSSRQEIGEAINNVITKSQKSNMRFEGLVNQYINIKKGNFNEIKSVKEFRTIWDELVGEEEKDEIPDGNLFRRHPEYVMDGSKIVHAGDISEEQITQNLTKLVYEMNNHDIPALERCFIAHYYYEYIHPFYDGNGRTGRYIACSYLARKLDIMTAVSFSSAISLHKKRYYKPFMDMSKTFNHGDATNFIIRMLEILEEGQTILLKRIQTGFKLLNDAEKRVSKLKSLNDEEKSVIFILYQKHIFGTYAPELTDNDLKEILHLSTYKIRNITNNLKKLGYIDLIKEKPKVHYLSQELSKDIPTLH
>NZ_CP020859.1|WP_157664642.1|161673_161823_+|hypothetical-protein
MDWKKVLLGKFDYSKTTENGKYNLNINIQGGIFSVAIIIVLIVWLIKVI
>NZ_CP020859.1|WP_087449095.1|160254_161196_+|3'-5'-exoribonuclease
MENFVAIDFETANENAYSPCSVGIAEFENGKLVDSFYSLINPEQEFSPMNIFVHGIHPEDVENAPTYKEIYPKIQSYISNNLIVSHSAFDRNVLTKSSNYYDVDFINVEFIDTLTLSRRLLPGVHHGLSQMIQHYKIENITEFHNALEDAKACGLLAIAMLEVSDYSTIFELVNDAGYKSFGKITPTKYIPFTLSRHGSTPIKFLNADDILSRKNLHKININETRIKDKNIAFTGKLQSMTRNEAEVIVSDLGGNFQRTVTLSTNILVVGLEDPRVVGPDGKSNKIKKAEHINSKTNNIEVIDEKEFIQMISR
>NZ_CP020859.1|WP_087449094.1|159922_160252_+|hypothetical-protein
MNTELEVVNLKSGNNIVFKEIKDKFSNNLEIVYGIGVSLYANHVITEKSNSWEFSSFCTDPVKLFNLSDIIDKRPANPNEITIFNKLFDNKKLDKVDKEYLKNNYGKEI
>NZ_CP020859.1|WP_087449159.1|159186_159900_+|helix-turn-helix-domain-containing-protein
MASNIRRNLDKLGLNTKEFSNKLDFKYTTVLDWVNAKTYPRIDKIEKMANFFGIEKSELVEEFNEDNTYLNRLNNTVMQLNTDNKKKVVEYADNRLKDQIRQENKIHSITETDNTYYVDVLGAVSAGTGEWLTDEQHEEITVNNEPPEYDFALRVNGDSMIPLFSDGQIIYVNRVDDLDMVRNEQIVIAELNGDAFVKKIVFDNNRKDWQLISLNKEYKPINVTKDDDFKVVGSVVL
>NZ_CP020859.1|WP_157664640.1|158617_158761_-|hypothetical-protein
MNTALLYIILAVVIVSKIIDFYLDNKIKELKKEQEQLKKELDELKKK
>NZ_CP020859.1|WP_087449093.1|157800_158328_+|hypothetical-protein
MNSLISTLITALVGFLSAIIGGLYATRTEKQVTARIVFENAYHEIFELIEDKFYDKSLSDDEIAELGKNIYSILQKSNGYYYPSLKKYALWMFNGEYNDNLQELWHSFSWTFDRQYEKVTSLIGIPPRSRYYRMNTKQYSSFFHLIRIYFLSKYGTIELLLILIGLLLTLNYFTN
>NZ_CP020859.1|WP_087449100.1|166433_167246_+|putative-DNA-binding-domain-containing-protein
MTNDELLTLINRHDESEILDYKENMKDKKQIGEYISALGNSALMLHLSAAYLIWGVKDISKEIVGTNIKPYLEKAPKGNMPFITYLEQYLDLKINLYWEEHIIEEKRILLLKIDVTHVNRPIKFLGQGFIRVGTSKKSLAEYPEKERLIWKSFESTFFESQIAKNDVTANDIFELLDLKLFSDLMDISYFDTELVIKSLLDKHLIVDSGNNYNITNLGAYTFAKNMDNFPTLHKRTIRITKYNGNNKIDNAIFDEQRKENASQYTSFVNF
>NZ_CP020859.1|WP_087449101.1|168413_169178_+|replication-initiation-protein
MSKEPVVQQEIVTAFPNTKEVRYDNELNRIPIGFMNESEQNIFFAILSQVKETSERKTKLSFTQIRELASFQKTSNKELIKSLDNMTTKLASLNVRIHNQQQIIKFTLFPTFQIDGDQQTLTVAVNEDFRYIVNDLAKGFVTNFDIEEFTSIKSKYAKTAFRLAREHENKVFDVVLKDFKELFSIPKSYRPTDINRLILTKVSKILQEYFTIFEITPVQDEKGKAHRIIAYRFNIGKRILRNLDEPRQISLLDD
>NZ_CP020859.1|WP_087449102.1|169462_170455_+|replication-initiator-protein-A
MKSLTSRAFLPINTDLFNNPKYQKLSCDAMVLYSLYSQRKEVSTFHSQTGNDTFTDSEGIFIYFSNDEAAKILRMSVRKISTLRSQLIDCGLISVIRHGLKNFKIYVNTPETTPAETDLVLPWANFDFEKPIKSVPANSASTKSQKLPINQSNNNQTKLLLSRESNESVSQNQSNTLVTPKKSEKDVLNELSLDSIVTRLKDTFSLPVVSRLKVLANNSYTKLKWFSDTIFKAKSQVTKKLLSNDKWLYNPASQEATLFESNDLLKRGLESALLQIAEIVYKGKEKVQNEAKFIYVYLRNFMANAVKQYLIDNYELTEDDEIELNVLLSF
>NZ_CP020859.1|WP_081535655.1|170855_172199_-|IS200/IS605-family-accessory-protein-TnpB-related-protein
MVKKQKSKKKVIKTFKEVRAEKTEVQYEYLVEKHIIKSNDARYAILDKYAHLSNNVYNQALYRFRQAFFKGKWLSYEKLDKSFKQSFNQKDCMLYRSMKSVHLAQQILKLVNQNMTSWNKARKAYLKAPQKFTGKPKIPKYKPKGGKNIVIVDNQTAKLRANGIVEIPVIDSLKIKLQHKETNKIQQVRVIPKNNTFVIEIVYKTNKVIDYKEDNGRYLTIDPGLDNAFTLASNVKGFKPVIINGRPLKSVNQYYNKQKARLTRIYDLSKQNRNTKRLNKLDFYRNQKMLKFAHEASKRIVEIALSHELNTIVIGKNKGQKRSSNMGKRINQNFIGIPHQKMIEMIEYKANLAGIVVIQANEAYTSQTSFLDNEIPINQNGDKARKRKGLSPVKRRVKRGLFKSNKGILINADVNGALQILRKVVPNAFADGIDGIGLVPVKLNLNF
>NZ_CP020859.1|WP_003699335.1|173652_173988_+|DUF5388-domain-containing-protein
MAGGLLNHSKKSGQNKLVHSGPVKVENQVERGDVVTDENTVTFPANVRVDNHIRNQITALNNIGIGSTQKEVVGNLLSERIEKLSDSDRQRFNRILNILEQKDYLTSLSKK
>NZ_CP020859.1|WP_087449103.1|174626_177161_-|M1-family-metallopeptidase
MGQVSHLYDLFQPKHYQIYLDINREKKTFTGVTKISGNASQKEITLHQKFLNILDVKVNGNSTDFKFDDSSETVSFNVPNTGDLDLEVSYFAKLTDSMMGIYPSYYEVDGVKKQLIGTQFETTFARQAFPSIDEPVAKATFDLAIKFDEHEGETVLSNMPEVKTENGVHYFDTTVRMSTYLVAFAFGELQSKLTETKSGVKIGVFSTKAHAEKELDFALDIAKRSIEFYEDYYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLNPDNTSLDTKRIVATVIAHELAHQWFGDLVTMKWWDDLWLNESFANMMEYVAIDALQPDWNIWELFQTSEAPQALQRDATDGVQSVHVEVKDPAEIDSLFDPAIVYAKGSRLLVMVRALIGDEALRSGLKAYFESHKYNNAVGSDLWKALGEASNLDIGSIMNSWLEQPGYPVLNVNVKNGHLVVEQNQFFIGEGKNVDRLWQVPLHADFAQAPKLLTQKELDLGNYQELRKSADKPLRFNVGNTSHVVVNYAPELLEDVLVNSQNLTHIDKLQLLQDLRLLADSGLASYSKVIPLLKEFSNSDSAIVNETLYSIVNNLKFFVTPDSTDETNLKKFVNTLSADQVQRLSWLPKDTDSNDDQLVRPLVLSAALYAENPSAESEAHEIFTQNQDKLLSLSSDIRALVLQNEVKNYNSSQLFESLLEDYRKTSDSSYKQDILFALTSTKDADQIQQIVSYFEDADTIKPQDLRTWYFRTLSNNLGEQAAWNWIRNEWQWLEDTVGGDMEFTSYITVTARALHTEQRLAEFKEFFEPKLNTPGLTREIVMDTKVIESRVAMIERERDHVNAAISDILN
>NZ_CP020859.1|WP_087449104.1|177426_178698_+|GHKL-domain-containing-protein
MGIYIFGMLSTLMIEVITLSYSSKVKFDFWHIVAFILLMIVCIPIKISNLIMIIGGVLITYHQDNGRDSWLRYIIFVMYSFITTWILQVVLNFYGNKIYDWFNYNNYLGTLVCQSIIFLMQVGIIYWFKDSLEILSMSDSSKKRKMELVAIAFLAIYLIYGSTFNDNYNSWWVSIYVIGLILFWGYIRALALLETKRELDELKDFELQNIENYANKIEEMYQGLRRFRHDYLNILLSMDQAIKSGNLELIEGTYTKIMEPSKEKINAAYYDLGKLKHVKTSAIKSILYNKFSYATREGVELEIEINDDVTVQYTRLLDAVRILSILLDNAIEAALESKEPRLLVAYIKETDIERVIIENSTKVERVEIAPLFKENYTTKSGNRGQGLATVKRLIGHYSNASLKTSSRDYTFTQELVLNKEEKR
>NZ_CP020859.1|WP_087449105.1|178694_179432_+|response-regulator-transcription-factor
MKIFILEDDSLQILRLKLILESIQPSLVIQTFKESDKLLQHITQPDENNIYLLDIELKNSRYGGFEASQRIREIDNLGTIIFITTHSEFMRKTYEYRVAALDFIDKIQTNDEIKQSLVTDFQLIKERQNLNEETEFIELESNSEIFRIPVSDIYFFETITDLTKRKLSVYTKSQHFVVKGNLKSIETKSDSFMRVHRSFVANVNNIKKFDSKEKKLYFSENTYCLVSRKNVVPLKNILKEGFVDM
>NZ_CP020859.1|WP_087449106.1|179545_180820_+|Cys-Gln-thioester-bond-forming-surface-protein
MKVMRKIVVGLVFLLGFVINFHFGNNNVSADNIDRYIAYVGQSQDSYGMPIYVQNLSTGKVDVAYCINESKKLPYSAVYNRFDATPERLMALDNPLVDREQLPDIIKRIIYNGYPLNATKLQGKLSDGAFRRLTQLAIWHYSDSYNVNENELTQEERMVYNELIQSVNPVPVNLNLNIYVKDDSTYQDLLGTSFGQLPEHPQFSSSSSVSSSSSSKPSSSSFSSSIESSSSSVSSSSSSSSSSSVTKAESTSSSSSVSSSSSVSSSVPQTETSTVSSSSSSLNSSSSVTKAESTSSSSSSSSSVESSNVSSTSSVSSSSSSEQTSKVSSERSSSSSSEISSVPSVATSTSSSSSTNSEKVIPIETSSSSSKKELVSKKVNSSVKVDKKKDLPQTGEKHNEVLWLSILGCIVFAGSLWIFERKYK
>NZ_CP020859.1|WP_087449107.1|180964_181930_+|virulence-RhuM-family-protein
MFFNQKNIVDNDTIWATQKSIAQLFGKSVSTISRHIKNIYESHELNENMTIAKYATVVNRGIRGEVSEELTYYNLDMIISVGYRVNSIQATRFRQWATQTLREYMIKGFVLDDERLKQGSNLLDKDYFDELLERVRSIRASERRIWQKITDIFAEISIDYDKKSEVTKRFYANVQNKFHYAITRQIAAEIIYTTADHTKQNMGLTTWKNAPKGRILKSDTKVAKNYLDEKQIKQLERNVSGYFDYIEDLIERRNTFTMEQFAESIDRFLEFREYKILHGYGGVSMKQAQDKAGKEYDIFNKNQPINSDFDKSIKKMIDNIK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP020859_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020859_2

167767-167930

TypeV

Consensus_repeat	Method
AGACTATTTTTACACTTCGAA	PILER-CR

2 spacers

DEDDh,cas14k

The CRISPR arrays of NZ_CP020859_2

>merge|NZ_CP020859|2|167767-167930|PILER-CR
ACTATTTTTACACTTCGAAAATTTAATTGTGCTCGAGGTGTAAAAATAGTCTGTATAAAAAAGACTATTTTTACACTCCGAATAGATTCTGTCCCTTTTTCTTGTATTTCCTTACATTCTAACTTCTTTTTTTATCTCTATTTAGACTATTCTTACACTTCGAA

>NZ_CP020859|2|1|167767-167930|PILER-CR
ACTATTTTTACACTTCGAAAA	TTTAATTGTGCTCGAGGTGTAAAAATAGTCTGTATAAAAAAG
ACTATTTTTACACTCCGAATA	GATTCTGTCCCTTTTTCTTGTATTTCCTTACATTCTAACTTCTTTTTTTATCTCTATTTAG
ACTATTCTTACACTTCGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020859.1\|WP_087449096.1\|162105_163365_+\|Fic-family-protein	unknown	unknown	gnl\|CDD\|225718
NZ_CP020859.1\|WP_087449094.1\|159922_160252_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_003699335.1\|173652_173988_+\|DUF5388-domain-containing-protein	unknown	unknown	gnl\|CDD\|375154
NZ_CP020859.1\|WP_087449095.1\|160254_161196_+\|3'-5'-exoribonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235735
NZ_CP020859.1\|WP_087449100.1\|166433_167246_+\|putative-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225420
NZ_CP020859.1\|WP_003709292.1\|181975_182899_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP020859.1\|WP_087449097.1\|163492_164545_+\|NINE-protein	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP020859.1\|WP_087449104.1\|177426_178698_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225519
NZ_CP020859.1\|WP_087449103.1\|174626_177161_-\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341064
NZ_CP020859.1\|WP_157664642.1\|161673_161823_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449106.1\|179545_180820_+\|Cys-Gln-thioester-bond-forming-surface-protein	unknown	unknown	gnl\|CDD\|369823
NZ_CP020859.1\|WP_087449102.1\|169462_170455_+\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|369151
NZ_CP020859.1\|WP_087449107.1\|180964_181930_+\|virulence-RhuM-family-protein	unknown	unknown	gnl\|CDD\|379118
NZ_CP020859.1\|WP_157664640.1\|158617_158761_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449159.1\|159186_159900_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|119397
NZ_CP020859.1\|WP_087449099.1\|165425_165824_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449098.1\|164839_165370_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020859.1\|WP_087449101.1\|168413_169178_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP020859.1\|WP_081535655.1\|170855_172199_-\|IS200/IS605-family-accessory-protein-TnpB-related-protein	cas14k	-	gnl\|CDD\|223747
NZ_CP020859.1\|WP_087449105.1\|178694_179432_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225818

Protein	Function_ID	Function_description	E-value
NZ_CP020859.1\|WP_087449096.1\|162105_163365_+\|Fic-family-protein	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	2.64481e-20
NZ_CP020859.1\|WP_003699335.1\|173652_173988_+\|DUF5388-domain-containing-protein	gnl\|CDD\|375154	pfam17363, DUF5388, Family of unknown function (DUF5388). This is a family of unknown function found in Lactobacillales.	6.34615e-29
NZ_CP020859.1\|WP_087449095.1\|160254_161196_+\|3'-5'-exoribonuclease	gnl\|CDD\|235735	PRK06195, PRK06195, DNA polymerase III subunit epsilon; Validated.	1.69257e-71
NZ_CP020859.1\|WP_087449100.1\|166433_167246_+\|putative-DNA-binding-domain-containing-protein	gnl\|CDD\|225420	COG2865, COG2865, Predicted transcriptional regulator containing an HTH domain and an uncharacterized domain shared with the mammalian protein Schlafen [Transcription].	6.80511e-16
NZ_CP020859.1\|WP_003709292.1\|181975_182899_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	5.31368e-74
NZ_CP020859.1\|WP_087449097.1\|163492_164545_+\|NINE-protein	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	7.43374e-37
NZ_CP020859.1\|WP_087449103.1\|174626_177161_-\|M1-family-metallopeptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	0
NZ_CP020859.1\|WP_087449105.1\|178694_179432_+\|response-regulator-transcription-factor	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	2.13596e-30
NZ_CP020859.1\|WP_087449106.1\|179545_180820_+\|Cys-Gln-thioester-bond-forming-surface-protein	gnl\|CDD\|369823	pfam08341, TED, Thioester domain. This domain is found near the N-terminus of a variety of bacterial surface proteins and pili. This domain contains an unusual covalent ester bond between a conserved cysteine and glutamine residue.	2.83475e-17
NZ_CP020859.1\|WP_087449102.1\|169462_170455_+\|replication-initiator-protein-A	gnl\|CDD\|369151	pfam06970, RepA_N, Replication initiator protein A (RepA) N-terminus. This of family of predicted proteins represents the N-terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids. Most proteins in this family are bacterial, but archaeal and eukaryotic members are also included.	3.07998e-05
NZ_CP020859.1\|WP_087449107.1\|180964_181930_+\|virulence-RhuM-family-protein	gnl\|CDD\|379118	pfam13310, Virulence_RhuM, Virulence protein RhuM family. There are currently no experimental data for members of this group or their homologs. However, these proteins are implicated in virulence/pathogenicity because RhuM is encoded in the SPI-3 pathogenicity island in Salmonella typhimurium.	1.66542e-144
NZ_CP020859.1\|WP_087449159.1\|159186_159900_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	2.6788e-19
NZ_CP020859.1\|WP_087449104.1\|177426_178698_+\|GHKL-domain-containing-protein	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	5.23743e-16
NZ_CP020859.1\|WP_087449101.1\|168413_169178_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	2.07777e-27
NZ_CP020859.1\|WP_081535655.1\|170855_172199_-\|IS200/IS605-family-accessory-protein-TnpB-related-protein	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.32027e-18

>NZ_CP020859.1|WP_087449100.1|166433_167246_+|putative-DNA-binding-domain-containing-protein
MTNDELLTLINRHDESEILDYKENMKDKKQIGEYISALGNSALMLHLSAAYLIWGVKDISKEIVGTNIKPYLEKAPKGNMPFITYLEQYLDLKINLYWEEHIIEEKRILLLKIDVTHVNRPIKFLGQGFIRVGTSKKSLAEYPEKERLIWKSFESTFFESQIAKNDVTANDIFELLDLKLFSDLMDISYFDTELVIKSLLDKHLIVDSGNNYNITNLGAYTFAKNMDNFPTLHKRTIRITKYNGNNKIDNAIFDEQRKENASQYTSFVNF
>NZ_CP020859.1|WP_087449099.1|165425_165824_+|hypothetical-protein
MLTVTIIFAIVGTIIPIIGNLIFGLLGFMIIYIICATIDYFRLSKSDKEKLKAENQAMKDFKIQAQKNKFKCPNCGSKNIQALGIHKKGFSTGKAVGGAILTGGVGALAGFAGKKTNKTDFVCNGCGRRFIL
>NZ_CP020859.1|WP_087449098.1|164839_165370_+|hypothetical-protein
MFFKFFKKQENSASLNNKRINKKTGYQMSTDKQIKAAKENVKFSEKYKFVDNEYYSDEMRYSNKVIDFVLPHYNKGNYYYKIGEWDKAENEWLMILKLMGHFPTLKLAIMYRKQKRFSDEVELLKLSQIYARKNTVYPGTKAIIERIPKAEKFREKHINEDKSKGIDKNKIIQKII
>NZ_CP020859.1|WP_087449097.1|163492_164545_+|NINE-protein
MNLEKIKDLIEKNFIKSKNIWLAYLLAIFFGTFGLHRFYLKKNGLKMLLITVLTLGLGVIITCPILIMDFFKIPDWVKDCNNINNTSPTEKNIQTNQSSKHINNTVTSINLNESMSTSSRLNNSLSANIEETNSSNIDKPRNSQVISYYFKPKLQPVMEFKPKTKTHKKSTRTKTNSSETIKISKLRKLRDDYVVVDIETTGLSPSEDKIIQLSAIKYIDNKEIAVFNEYINPHTKLSDFIINLTGITQDIVDYGKELNDIKDNFISFYGDLPLVGHYINGFDIKFLIANNLIIKNISTIDTLPLARKLDLEDAKLPTVKKFLGINNNSHDSLDDCYTTNALYQFAKKNF
>NZ_CP020859.1|WP_087449096.1|162105_163365_+|Fic-family-protein
MKKYTSLKSVFYSDKSSDKVIYTDFLNNRLNNELIVYSGLKMSPFNSKKEIRDVNTLFEIFFLPTVQISILKDKIYKNSSVITYYMSQLPEVASDQLFYNTLVLELQSTNDIEGIRSSRQEIGEAINNVITKSQKSNMRFEGLVNQYINIKKGNFNEIKSVKEFRTIWDELVGEEEKDEIPDGNLFRRHPEYVMDGSKIVHAGDISEEQITQNLTKLVYEMNNHDIPALERCFIAHYYYEYIHPFYDGNGRTGRYIACSYLARKLDIMTAVSFSSAISLHKKRYYKPFMDMSKTFNHGDATNFIIRMLEILEEGQTILLKRIQTGFKLLNDAEKRVSKLKSLNDEEKSVIFILYQKHIFGTYAPELTDNDLKEILHLSTYKIRNITNNLKKLGYIDLIKEKPKVHYLSQELSKDIPTLH
>NZ_CP020859.1|WP_157664642.1|161673_161823_+|hypothetical-protein
MDWKKVLLGKFDYSKTTENGKYNLNINIQGGIFSVAIIIVLIVWLIKVI
>NZ_CP020859.1|WP_087449095.1|160254_161196_+|3'-5'-exoribonuclease
MENFVAIDFETANENAYSPCSVGIAEFENGKLVDSFYSLINPEQEFSPMNIFVHGIHPEDVENAPTYKEIYPKIQSYISNNLIVSHSAFDRNVLTKSSNYYDVDFINVEFIDTLTLSRRLLPGVHHGLSQMIQHYKIENITEFHNALEDAKACGLLAIAMLEVSDYSTIFELVNDAGYKSFGKITPTKYIPFTLSRHGSTPIKFLNADDILSRKNLHKININETRIKDKNIAFTGKLQSMTRNEAEVIVSDLGGNFQRTVTLSTNILVVGLEDPRVVGPDGKSNKIKKAEHINSKTNNIEVIDEKEFIQMISR
>NZ_CP020859.1|WP_087449094.1|159922_160252_+|hypothetical-protein
MNTELEVVNLKSGNNIVFKEIKDKFSNNLEIVYGIGVSLYANHVITEKSNSWEFSSFCTDPVKLFNLSDIIDKRPANPNEITIFNKLFDNKKLDKVDKEYLKNNYGKEI
>NZ_CP020859.1|WP_087449159.1|159186_159900_+|helix-turn-helix-domain-containing-protein
MASNIRRNLDKLGLNTKEFSNKLDFKYTTVLDWVNAKTYPRIDKIEKMANFFGIEKSELVEEFNEDNTYLNRLNNTVMQLNTDNKKKVVEYADNRLKDQIRQENKIHSITETDNTYYVDVLGAVSAGTGEWLTDEQHEEITVNNEPPEYDFALRVNGDSMIPLFSDGQIIYVNRVDDLDMVRNEQIVIAELNGDAFVKKIVFDNNRKDWQLISLNKEYKPINVTKDDDFKVVGSVVL
>NZ_CP020859.1|WP_157664640.1|158617_158761_-|hypothetical-protein
MNTALLYIILAVVIVSKIIDFYLDNKIKELKKEQEQLKKELDELKKK
>NZ_CP020859.1|WP_087449101.1|168413_169178_+|replication-initiation-protein
MSKEPVVQQEIVTAFPNTKEVRYDNELNRIPIGFMNESEQNIFFAILSQVKETSERKTKLSFTQIRELASFQKTSNKELIKSLDNMTTKLASLNVRIHNQQQIIKFTLFPTFQIDGDQQTLTVAVNEDFRYIVNDLAKGFVTNFDIEEFTSIKSKYAKTAFRLAREHENKVFDVVLKDFKELFSIPKSYRPTDINRLILTKVSKILQEYFTIFEITPVQDEKGKAHRIIAYRFNIGKRILRNLDEPRQISLLDD
>NZ_CP020859.1|WP_087449102.1|169462_170455_+|replication-initiator-protein-A
MKSLTSRAFLPINTDLFNNPKYQKLSCDAMVLYSLYSQRKEVSTFHSQTGNDTFTDSEGIFIYFSNDEAAKILRMSVRKISTLRSQLIDCGLISVIRHGLKNFKIYVNTPETTPAETDLVLPWANFDFEKPIKSVPANSASTKSQKLPINQSNNNQTKLLLSRESNESVSQNQSNTLVTPKKSEKDVLNELSLDSIVTRLKDTFSLPVVSRLKVLANNSYTKLKWFSDTIFKAKSQVTKKLLSNDKWLYNPASQEATLFESNDLLKRGLESALLQIAEIVYKGKEKVQNEAKFIYVYLRNFMANAVKQYLIDNYELTEDDEIELNVLLSF
>NZ_CP020859.1|WP_081535655.1|170855_172199_-|IS200/IS605-family-accessory-protein-TnpB-related-protein
MVKKQKSKKKVIKTFKEVRAEKTEVQYEYLVEKHIIKSNDARYAILDKYAHLSNNVYNQALYRFRQAFFKGKWLSYEKLDKSFKQSFNQKDCMLYRSMKSVHLAQQILKLVNQNMTSWNKARKAYLKAPQKFTGKPKIPKYKPKGGKNIVIVDNQTAKLRANGIVEIPVIDSLKIKLQHKETNKIQQVRVIPKNNTFVIEIVYKTNKVIDYKEDNGRYLTIDPGLDNAFTLASNVKGFKPVIINGRPLKSVNQYYNKQKARLTRIYDLSKQNRNTKRLNKLDFYRNQKMLKFAHEASKRIVEIALSHELNTIVIGKNKGQKRSSNMGKRINQNFIGIPHQKMIEMIEYKANLAGIVVIQANEAYTSQTSFLDNEIPINQNGDKARKRKGLSPVKRRVKRGLFKSNKGILINADVNGALQILRKVVPNAFADGIDGIGLVPVKLNLNF
>NZ_CP020859.1|WP_003699335.1|173652_173988_+|DUF5388-domain-containing-protein
MAGGLLNHSKKSGQNKLVHSGPVKVENQVERGDVVTDENTVTFPANVRVDNHIRNQITALNNIGIGSTQKEVVGNLLSERIEKLSDSDRQRFNRILNILEQKDYLTSLSKK
>NZ_CP020859.1|WP_087449103.1|174626_177161_-|M1-family-metallopeptidase
MGQVSHLYDLFQPKHYQIYLDINREKKTFTGVTKISGNASQKEITLHQKFLNILDVKVNGNSTDFKFDDSSETVSFNVPNTGDLDLEVSYFAKLTDSMMGIYPSYYEVDGVKKQLIGTQFETTFARQAFPSIDEPVAKATFDLAIKFDEHEGETVLSNMPEVKTENGVHYFDTTVRMSTYLVAFAFGELQSKLTETKSGVKIGVFSTKAHAEKELDFALDIAKRSIEFYEDYYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLNPDNTSLDTKRIVATVIAHELAHQWFGDLVTMKWWDDLWLNESFANMMEYVAIDALQPDWNIWELFQTSEAPQALQRDATDGVQSVHVEVKDPAEIDSLFDPAIVYAKGSRLLVMVRALIGDEALRSGLKAYFESHKYNNAVGSDLWKALGEASNLDIGSIMNSWLEQPGYPVLNVNVKNGHLVVEQNQFFIGEGKNVDRLWQVPLHADFAQAPKLLTQKELDLGNYQELRKSADKPLRFNVGNTSHVVVNYAPELLEDVLVNSQNLTHIDKLQLLQDLRLLADSGLASYSKVIPLLKEFSNSDSAIVNETLYSIVNNLKFFVTPDSTDETNLKKFVNTLSADQVQRLSWLPKDTDSNDDQLVRPLVLSAALYAENPSAESEAHEIFTQNQDKLLSLSSDIRALVLQNEVKNYNSSQLFESLLEDYRKTSDSSYKQDILFALTSTKDADQIQQIVSYFEDADTIKPQDLRTWYFRTLSNNLGEQAAWNWIRNEWQWLEDTVGGDMEFTSYITVTARALHTEQRLAEFKEFFEPKLNTPGLTREIVMDTKVIESRVAMIERERDHVNAAISDILN
>NZ_CP020859.1|WP_087449104.1|177426_178698_+|GHKL-domain-containing-protein
MGIYIFGMLSTLMIEVITLSYSSKVKFDFWHIVAFILLMIVCIPIKISNLIMIIGGVLITYHQDNGRDSWLRYIIFVMYSFITTWILQVVLNFYGNKIYDWFNYNNYLGTLVCQSIIFLMQVGIIYWFKDSLEILSMSDSSKKRKMELVAIAFLAIYLIYGSTFNDNYNSWWVSIYVIGLILFWGYIRALALLETKRELDELKDFELQNIENYANKIEEMYQGLRRFRHDYLNILLSMDQAIKSGNLELIEGTYTKIMEPSKEKINAAYYDLGKLKHVKTSAIKSILYNKFSYATREGVELEIEINDDVTVQYTRLLDAVRILSILLDNAIEAALESKEPRLLVAYIKETDIERVIIENSTKVERVEIAPLFKENYTTKSGNRGQGLATVKRLIGHYSNASLKTSSRDYTFTQELVLNKEEKR
>NZ_CP020859.1|WP_087449105.1|178694_179432_+|response-regulator-transcription-factor
MKIFILEDDSLQILRLKLILESIQPSLVIQTFKESDKLLQHITQPDENNIYLLDIELKNSRYGGFEASQRIREIDNLGTIIFITTHSEFMRKTYEYRVAALDFIDKIQTNDEIKQSLVTDFQLIKERQNLNEETEFIELESNSEIFRIPVSDIYFFETITDLTKRKLSVYTKSQHFVVKGNLKSIETKSDSFMRVHRSFVANVNNIKKFDSKEKKLYFSENTYCLVSRKNVVPLKNILKEGFVDM
>NZ_CP020859.1|WP_087449106.1|179545_180820_+|Cys-Gln-thioester-bond-forming-surface-protein
MKVMRKIVVGLVFLLGFVINFHFGNNNVSADNIDRYIAYVGQSQDSYGMPIYVQNLSTGKVDVAYCINESKKLPYSAVYNRFDATPERLMALDNPLVDREQLPDIIKRIIYNGYPLNATKLQGKLSDGAFRRLTQLAIWHYSDSYNVNENELTQEERMVYNELIQSVNPVPVNLNLNIYVKDDSTYQDLLGTSFGQLPEHPQFSSSSSVSSSSSSKPSSSSFSSSIESSSSSVSSSSSSSSSSSVTKAESTSSSSSVSSSSSVSSSVPQTETSTVSSSSSSLNSSSSVTKAESTSSSSSSSSSVESSNVSSTSSVSSSSSSEQTSKVSSERSSSSSSEISSVPSVATSTSSSSSTNSEKVIPIETSSSSSKKELVSKKVNSSVKVDKKKDLPQTGEKHNEVLWLSILGCIVFAGSLWIFERKYK
>NZ_CP020859.1|WP_087449107.1|180964_181930_+|virulence-RhuM-family-protein
MFFNQKNIVDNDTIWATQKSIAQLFGKSVSTISRHIKNIYESHELNENMTIAKYATVVNRGIRGEVSEELTYYNLDMIISVGYRVNSIQATRFRQWATQTLREYMIKGFVLDDERLKQGSNLLDKDYFDELLERVRSIRASERRIWQKITDIFAEISIDYDKKSEVTKRFYANVQNKFHYAITRQIAAEIIYTTADHTKQNMGLTTWKNAPKGRILKSDTKVAKNYLDEKQIKQLERNVSGYFDYIEDLIERRNTFTMEQFAESIDRFLEFREYKILHGYGGVSMKQAQDKAGKEYDIFNKNQPINSDFDKSIKKMIDNIK
>NZ_CP020859.1|WP_003709292.1|181975_182899_-|IS30-family-transposase
MGTTILSFSDRIVIETLRHEKRSLRYIADYLGFSKTTIFNEIHRLKGEYHATSAQADHETKLSYRGRKCSLTANLKRLIEDKIKIQKWSIEQVAHVVRIAYKTIYNWVDQGLLDIRMTDLPDHGIRRKRAKETRGTFSHGRSIEDRPAEASDRNIAGHFEADTVLSGKRKGQAVATFVERKSRLTIVKRLGGRDSTSMTKAILELANQLGTNLKTLTVDHGKEFANYQSIEKNTGVPLYFAHAYSPHERGSNENRNRVLRRFIPKGQPIEEISDDELIQINWYLNSRPLKCLNWRTPIEIFLLNLRH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP020859_1	1.1\|166365\|32\|NZ_CP020859\|CRISPRCasFinder	166365-166396	32	NZ_CP020859	Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	166365-166396	0	1.0
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	NZ_CP020859	Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	167786-167827	0	1.0
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	NZ_LT604075	Lactobacillus salivarius isolate LPM01 plasmid II	138728-138769	0	1.0
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	NZ_CP007647	Lactobacillus salivarius strain JCM1046 plasmid pMP1046A, complete sequence	219122-219163	1	0.976
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	NC_007930	Lactobacillus salivarius UCC118 plasmid pMP118, complete sequence	241810-241851	1	0.976
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	NZ_CP017108	Lactobacillus salivarius strain CICC23174 plasmid pLS_1 sequence	126320-126361	1	0.976
NZ_CP020859_2	2.2\|167851\|61\|NZ_CP020859\|PILER-CR	167851-167911	61	NZ_CP020859	Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence	167849-167909	1	0.984
NZ_CP020859_2	2.2\|167851\|61\|NZ_CP020859\|PILER-CR	167851-167911	61	NZ_LT604075	Lactobacillus salivarius isolate LPM01 plasmid II	138791-138851	1	0.984
NZ_CP020859_2	2.2\|167851\|61\|NZ_CP020859\|PILER-CR	167851-167911	61	NC_007930	Lactobacillus salivarius UCC118 plasmid pMP118, complete sequence	241872-241932	2	0.967
NZ_CP020859_2	2.2\|167851\|61\|NZ_CP020859\|PILER-CR	167851-167911	61	NZ_CP017108	Lactobacillus salivarius strain CICC23174 plasmid pLS_1 sequence	126383-126443	2	0.967
NZ_CP020859_2	2.2\|167851\|61\|NZ_CP020859\|PILER-CR	167851-167911	61	NZ_CP007647	Lactobacillus salivarius strain JCM1046 plasmid pMP1046A, complete sequence	219185-219245	3	0.951
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	CP002037	Lactobacillus salivarius CECT 5713 plasmid pHN3, complete sequence	242086-242127	8	0.81
NZ_CP020859_2	2.1\|167788\|42\|NZ_CP020859\|PILER-CR	167788-167829	42	NZ_CP011404	Lactobacillus salivarius str. Ren plasmid pR1, complete sequence	144600-144641	9	0.786

1. spacer 1.1|166365|32|NZ_CP020859|CRISPRCasFinder matches to NZ_CP020859 (Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ctatcattgatacgacggcatttataactacc	CRISPR spacer
ctatcattgatacgacggcatttataactacc	Protospacer
********************************

2. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to NZ_CP020859 (Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	Protospacer
******************************************

3. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to NZ_LT604075 (Lactobacillus salivarius isolate LPM01 plasmid II) position: , mismatch: 0, identity: 1.0

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	Protospacer
******************************************

4. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to NZ_CP007647 (Lactobacillus salivarius strain JCM1046 plasmid pMP1046A, complete sequence) position: , mismatch: 1, identity: 0.976

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
aatttaattgtactcgaggtgtaaaaatagtctgtataaaaa	Protospacer
***********.******************************

5. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to NC_007930 (Lactobacillus salivarius UCC118 plasmid pMP118, complete sequence) position: , mismatch: 1, identity: 0.976

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
aatttaattgtactcgaggtgtaaaaatagtctgtataaaaa	Protospacer
***********.******************************

6. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to NZ_CP017108 (Lactobacillus salivarius strain CICC23174 plasmid pLS_1 sequence) position: , mismatch: 1, identity: 0.976

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
aatttaattgtactcgaggtgtaaaaatagtctgtataaaaa	Protospacer
***********.******************************

7. spacer 2.2|167851|61|NZ_CP020859|PILER-CR matches to NZ_CP020859 (Lactobacillus salivarius strain ZLS006 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.984

tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	CRISPR spacer
tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	Protospacer
************************************************************

8. spacer 2.2|167851|61|NZ_CP020859|PILER-CR matches to NZ_LT604075 (Lactobacillus salivarius isolate LPM01 plasmid II) position: , mismatch: 1, identity: 0.984

tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	CRISPR spacer
tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	Protospacer
************************************************************

9. spacer 2.2|167851|61|NZ_CP020859|PILER-CR matches to NC_007930 (Lactobacillus salivarius UCC118 plasmid pMP118, complete sequence) position: , mismatch: 2, identity: 0.967

tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	CRISPR spacer
tagattctgtccctttttcttttatttccttacattctaacttctttttttatctctatt	Protospacer
********************* **************************************

10. spacer 2.2|167851|61|NZ_CP020859|PILER-CR matches to NZ_CP017108 (Lactobacillus salivarius strain CICC23174 plasmid pLS_1 sequence) position: , mismatch: 2, identity: 0.967

tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	CRISPR spacer
tagattctgtccctttttcttttatttccttacattctaacttctttttttatctctatt	Protospacer
********************* **************************************

11. spacer 2.2|167851|61|NZ_CP020859|PILER-CR matches to NZ_CP007647 (Lactobacillus salivarius strain JCM1046 plasmid pMP1046A, complete sequence) position: , mismatch: 3, identity: 0.951

tagattctgtccctttttcttgtatttccttacattctaacttctttttttatctctatt	CRISPR spacer
tagattctgtccctttttcttttatttccttacattctaacttc-ttttttatctctatt	Protospacer
********************* ********************** ***************

12. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to CP002037 (Lactobacillus salivarius CECT 5713 plasmid pHN3, complete sequence) position: , mismatch: 8, identity: 0.81

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
cattatattgtgctcgaggtgtaaaaatagtcttttttatac	Protospacer
 ***  *************************** * * * *

13. spacer 2.1|167788|42|NZ_CP020859|PILER-CR matches to NZ_CP011404 (Lactobacillus salivarius str. Ren plasmid pR1, complete sequence) position: , mismatch: 9, identity: 0.786

aatttaattgtgctcgaggtgtaaaaatagtctgtataaaaa	CRISPR spacer
cattatattgtgctcgaggtgtaaaaatagtcttttttgtac	Protospacer
 ***  *************************** * * . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5372

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087449038.1\|510_738_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003704747.1\|1624_2308_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_087449039.1\|2324_2972_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_003708772.1\|3041_3566_+	hypothetical protein	NA	NA	NA	NA
WP_003708777.1\|5090_5372_-	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	1.8e-05	39.3

DBSCAN-SWA_2

20209 : 78982

Bacillus_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080564637.1\|20209_22030_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1C3S747	Escherichia_phage	1.5e-89	37.0
WP_003699121.1\|22040_22460_-	hypothetical protein	NA	NA	NA	NA
WP_087448686.1\|22584_23961_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-38	35.2
WP_087449045.1\|24020_24680_-	hypothetical protein	NA	NA	NA	NA
WP_081538411.1\|24697_26938_-	type IA DNA topoisomerase	NA	NA	NA	NA
WP_034998411.1\|26951_28121_-	toprim domain-containing protein	NA	NA	NA	NA
WP_167370867.1\|28324_32335_-	ArdC family protein	NA	NA	NA	NA
WP_003708803.1\|32334_32511_-	hypothetical protein	NA	NA	NA	NA
WP_087449046.1\|32713_33712_-	restriction endonuclease subunit S	A0A2H4J4K4	uncultured_Caudovirales_phage	1.3e-05	30.1
WP_003708805.1\|33936_34338_-	PIN domain-containing protein	NA	NA	NA	NA
WP_003704279.1\|34337_34559_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_004564436.1\|34659_34854_-	hypothetical protein	NA	NA	NA	NA
WP_087449047.1\|44760_45606_+	hypothetical protein	NA	NA	NA	NA
WP_174633257.1\|45737_46985_+	hypothetical protein	NA	NA	NA	NA
WP_003711234.1\|47024_48422_-\|transposase	transposase	NA	NA	NA	NA
WP_003710828.1\|48487_48928_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.1e-41	62.0
WP_081538445.1\|49541_49682_-	hypothetical protein	NA	NA	NA	NA
WP_034982193.1\|49674_49836_-	hypothetical protein	NA	NA	NA	NA
WP_087449048.1\|49941_51975_-	hypothetical protein	NA	NA	NA	NA
WP_003708456.1\|51990_52413_-	hypothetical protein	NA	NA	NA	NA
WP_003708458.1\|52409_52892_-	hypothetical protein	NA	NA	NA	NA
WP_003708459.1\|52904_53261_-	hypothetical protein	NA	NA	NA	NA
WP_087449049.1\|53987_54302_-	glutaredoxin family protein	NA	NA	NA	NA
WP_100190621.1\|55041_55701_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_003702407.1\|56038_56254_-	hypothetical protein	NA	NA	NA	NA
WP_034998308.1\|56486_57488_-	hypothetical protein	NA	NA	NA	NA
WP_003708469.1\|57502_57979_-	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_167370875.1\|57991_58204_-	hypothetical protein	NA	NA	NA	NA
WP_003699163.1\|58157_58565_-	hypothetical protein	NA	NA	NA	NA
WP_003708471.1\|58577_59693_-	hypothetical protein	NA	NA	NA	NA
WP_087366693.1\|59706_60720_-	replication initiator protein A	NA	NA	NA	NA
WP_087448686.1\|61155_62532_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.1e-38	35.2
WP_157664638.1\|62663_62816_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_003708474.1\|62949_63114_+	Arc family DNA-binding protein	A0A0A8WG21	Clostridium_phage	3.4e-09	54.7
WP_034998310.1\|63789_64212_+	helix-turn-helix transcriptional regulator	F0PIH1	Enterococcus_phage	8.1e-10	41.4
WP_002323245.1\|64503_65676_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_003699490.1\|66623_66926_+	hypothetical protein	NA	NA	NA	NA
WP_003708476.1\|67183_68062_+	patatin family protein	NA	NA	NA	NA
WP_087449051.1\|68246_69536_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.6e-45	30.0
WP_003708477.1\|69662_70499_-	pyruvate formate lyase-activating protein	NA	NA	NA	NA
WP_087449052.1\|70525_72793_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.8e-173	42.3
WP_167370876.1\|73103_73673_-	VIT1/CCC1 transporter family protein	NA	NA	NA	NA
WP_174633258.1\|73884_75309_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_069469549.1\|75280_75730_-	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_167370877.1\|75726_76953_-	SufS family cysteine desulfurase	Q2XUY6	environmental_halophage	3.1e-110	46.9
WP_087449055.1\|76939_78190_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003706792.1\|78202_78982_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	5.7e-09	28.7

DBSCAN-SWA_3

82389 : 124022

Staphylococcus_phage(15.38%)

transposase,integrase,bacteriocin

attL 90451:90467|attR 120342:120358

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087449057.1\|82389_85515_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	6.3e-67	25.7
WP_087449058.1\|85611_86682_-	restriction endonuclease subunit S	A0A1V0S9X4	Catovirus	9.8e-20	31.0
WP_003706797.1\|86678_87647_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAA2	uncultured_Caudovirales_phage	5.4e-33	31.1
WP_087449059.1\|87732_88281_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	2.5e-11	30.4
WP_087449060.1\|88277_88811_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_087449061.1\|88800_90324_-	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	1.8e-51	29.5
90451:90467	attL	NA	NA	NA	NA
WP_087449062.1\|90504_91920_-	N-6 DNA methylase	A0A1X9I6H1	Streptococcus_phage	1.0e-24	24.7
WP_087449063.1\|91912_92479_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_034982136.1\|92670_93720_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003702981.1\|93925_94921_+	D-2-hydroxyacid dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	3.1e-44	37.7
WP_087449064.1\|94981_95662_-	fructose-6-phosphate aldolase	A0A0E3EPH4	Synechococcus_phage	1.9e-21	30.4
WP_003699445.1\|95728_96109_-	PTS glucitol/sorbitol transporter subunit IIA	NA	NA	NA	NA
WP_087449065.1\|96146_97172_-	PTS glucitol/sorbitol transporter subunit IIB	NA	NA	NA	NA
WP_087449066.1\|97188_97731_-	PTS glucitol/sorbitol transporter subunit IIC	NA	NA	NA	NA
WP_087449067.1\|97742_98240_-	transcriptional regulator GutM	NA	NA	NA	NA
WP_087449068.1\|98240_100100_-	HTH domain-containing protein	NA	NA	NA	NA
WP_081537581.1\|100115_100919_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_087449155.1\|101220_101517_-	transglycosylase	Q8LTK2	Lactococcus_phage	7.4e-10	55.7
WP_087449069.1\|101854_102094_-	hypothetical protein	A0A2P0ZLG0	Lactobacillus_phage	2.3e-06	36.4
WP_087449070.1\|102171_102378_-	hypothetical protein	NA	NA	NA	NA
WP_087449071.1\|102400_102634_-	hypothetical protein	NA	NA	NA	NA
WP_003708516.1\|102668_102854_-	hypothetical protein	NA	NA	NA	NA
WP_034998323.1\|102868_103333_-	hypothetical protein	NA	NA	NA	NA
WP_087449072.1\|103836_104004_-	hypothetical protein	NA	NA	NA	NA
WP_081561764.1\|104017_104272_-	hypothetical protein	NA	NA	NA	NA
WP_087449073.1\|104274_104559_-	hypothetical protein	NA	NA	NA	NA
WP_087366637.1\|105402_106299_-	nitronate monooxygenase	NA	NA	NA	NA
WP_087449074.1\|106403_109061_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_081535606.1\|109594_111565_-	fructose-1,6-bisphosphatase	NA	NA	NA	NA
WP_087449075.1\|111909_112731_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_003699423.1\|112766_113033_+	hypothetical protein	NA	NA	NA	NA
WP_003699419.1\|114316_114514_-	hypothetical protein	NA	NA	NA	NA
WP_003699418.1\|114806_115037_-	hypothetical protein	NA	NA	NA	NA
WP_087449076.1\|115073_115868_-	response regulator transcription factor	NA	NA	NA	NA
WP_003703471.1\|117169_117286_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_034984297.1\|118071_118314_-\|bacteriocin	Blp family class II bacteriocin	NA	NA	NA	NA
WP_003710784.1\|118319_118577_-	hypothetical protein	NA	NA	NA	NA
WP_141566911.1\|119228_119414_-	hypothetical protein	NA	NA	NA	NA
WP_087449156.1\|120463_121111_-	HAD family phosphatase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	5.6e-10	27.2
120342:120358	attR	NA	NA	NA	NA
WP_167370868.1\|121224_121566_-	hypothetical protein	NA	NA	NA	NA
WP_167370869.1\|121586_121853_-	hypothetical protein	NA	NA	NA	NA
WP_087449079.1\|122213_123491_-\|transposase	transposase	A0A286QQE5	Streptococcus_phage	1.7e-55	36.2
WP_044005747.1\|123590_124022_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.0e-27	45.7

DBSCAN-SWA_4

132518 : 132956

Anguillid_herpesvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003699392.1\|132518_132956_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	3.9e-23	40.7

DBSCAN-SWA_5

139069 : 209926

Streptococcus_phage(24.0%)

transposase,integrase

attL 130703:130720|attR 203406:203423

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
130703:130720	attL	NA	NA	NA	NA
WP_087449085.1\|139069_140356_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.5e-43	29.7
WP_011476677.1\|140612_140882_-	30S ribosomal protein S14	NA	NA	NA	NA
WP_087449086.1\|141140_142262_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.9e-13	27.4
WP_081513040.1\|142302_142725_-	fucose isomerase	NA	NA	NA	NA
WP_081513041.1\|142729_144064_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_081513042.1\|144082_145552_-	rhamnulokinase	NA	NA	NA	NA
WP_081537304.1\|145564_147352_-	L-fucose isomerase	NA	NA	NA	NA
WP_087449087.1\|147494_148253_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	9.7e-22	28.1
WP_174633259.1\|148421_149201_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_087449089.1\|149675_150188_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_087449090.1\|150512_151322_-	conserved phage C-terminal domain-containing protein	A0A2H4JEZ8	uncultured_Caudovirales_phage	5.5e-23	31.4
WP_087449091.1\|151419_152085_-	DUF1211 domain-containing protein	NA	NA	NA	NA
WP_087449092.1\|152261_153551_-\|transposase	IS1380 family transposase	A0A1X9I6F6	Streptococcus_phage	3.3e-54	34.7
WP_087449157.1\|153994_155914_+	TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein	E4ZFJ7	Streptococcus_phage	4.4e-63	29.7
WP_162853948.1\|156226_156760_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A1B1P773	Bacillus_phage	7.3e-24	37.5
WP_162853949.1\|156732_157011_-\|transposase	transposase	NA	NA	NA	NA
WP_161022767.1\|157585_157702_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_087449093.1\|157800_158328_+	hypothetical protein	NA	NA	NA	NA
WP_157664640.1\|158617_158761_-	hypothetical protein	NA	NA	NA	NA
WP_087449159.1\|159186_159900_+	helix-turn-helix domain-containing protein	J7KJ52	Streptococcus_phage	1.4e-38	41.7
WP_087449094.1\|159922_160252_+	hypothetical protein	NA	NA	NA	NA
WP_087449095.1\|160254_161196_+	3'-5' exoribonuclease	A0A1S5SFA9	Streptococcus_phage	2.8e-47	37.2
WP_157664642.1\|161673_161823_+	hypothetical protein	NA	NA	NA	NA
WP_087449096.1\|162105_163365_+	Fic family protein	Q9AZ49	Lactococcus_phage	6.2e-74	39.5
WP_087449097.1\|163492_164545_+	NINE protein	A0A0A8WJ41	Clostridium_phage	1.2e-17	31.8
WP_087449098.1\|164839_165370_+	hypothetical protein	NA	NA	NA	NA
WP_087449099.1\|165425_165824_+	hypothetical protein	E9LUL0	Lactobacillus_phage	1.2e-18	42.5
WP_087449100.1\|166433_167246_+	putative DNA binding domain-containing protein	NA	NA	NA	NA
WP_087449101.1\|168413_169178_+	replication initiation protein	NA	NA	NA	NA
WP_087449102.1\|169462_170455_+	replication initiator protein A	NA	NA	NA	NA
WP_081535655.1\|170855_172199_-	IS200/IS605 family accessory protein TnpB-related protein	G3MB42	Bacillus_virus	6.4e-69	39.1
WP_003699335.1\|173652_173988_+	DUF5388 domain-containing protein	F0PIG7	Enterococcus_phage	1.3e-07	34.2
WP_087449103.1\|174626_177161_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	6.2e-65	26.5
WP_087449104.1\|177426_178698_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_087449105.1\|178694_179432_+	response regulator transcription factor	A0A1V0E029	Clostridioides_phage	2.4e-17	28.1
WP_087449106.1\|179545_180820_+	Cys-Gln thioester bond-forming surface protein	NA	NA	NA	NA
WP_087449107.1\|180964_181930_+	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	2.7e-69	46.7
WP_003709292.1\|181975_182899_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-50	41.0
WP_167370878.1\|183086_183941_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.7e-52	39.9
WP_167370872.1\|184021_184750_-	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_050754569.1\|184918_185389_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_035149339.1\|185423_185735_+	PTS galactitol transporter subunit IIB	NA	NA	NA	NA
WP_087449110.1\|185748_187299_+	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_087449111.1\|187304_187544_+	hypothetical protein	NA	NA	NA	NA
WP_087449112.1\|187540_188266_+	class II aldolase/adducin family protein	NA	NA	NA	NA
WP_167370866.1\|188394_188547_+	hypothetical protein	NA	NA	NA	NA
WP_087449114.1\|188585_189005_+	conjugal transfer protein	NA	NA	NA	NA
WP_087449115.1\|189129_190251_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.9e-13	27.8
WP_157664645.1\|190428_190608_+	hypothetical protein	NA	NA	NA	NA
WP_003699299.1\|190705_191356_-	membrane protein	NA	NA	NA	NA
WP_087449117.1\|191358_192378_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_049176196.1\|192645_193905_+	MFS transporter	NA	NA	NA	NA
WP_087449118.1\|193925_195383_+	rhamnulokinase	NA	NA	NA	NA
WP_003699292.1\|195387_195714_+	L-rhamnose mutarotase	NA	NA	NA	NA
WP_087449119.1\|195726_196992_+	L-rhamnose isomerase	NA	NA	NA	NA
WP_087449120.1\|197079_197895_+	rhamnulose-1-phosphate aldolase	NA	NA	NA	NA
WP_087449121.1\|198201_199917_-	hypothetical protein	NA	NA	NA	NA
WP_003699286.1\|200067_200277_+	hypothetical protein	NA	NA	NA	NA
WP_087449122.1\|200443_201370_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.9e-76	45.0
WP_044005691.1\|201586_202144_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_087449123.1\|202145_203537_+	N-6 DNA methylase	A0A1X9I6H1	Streptococcus_phage	2.4e-26	28.4
203406:203423	attR	NA	NA	NA	NA
WP_003699280.1\|203554_203797_+	hypothetical protein	NA	NA	NA	NA
WP_087449124.1\|204012_205902_+	site-specific DNA-methyltransferase	S5VTV9	Campylobacter_phage	1.1e-53	37.1
WP_087449125.1\|205916_207962_+	site-specific DNA-methyltransferase	A0A0M7Q8J6	Escherichia_phage	3.0e-65	40.0
WP_087449126.1\|207976_209926_+	site-specific DNA-methyltransferase	A0A1B0XWD0	Campylobacter_phage	5.9e-55	38.0

DBSCAN-SWA_6

222819 : 253793

Streptococcus_phage(35.0%)

transposase,integrase

attL 243549:243569|attR 247761:247781

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003699254.1\|222819_223095_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	4.1e-23	62.9
WP_087449132.1\|223401_228027_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	2.0e-16	30.8
WP_003703258.1\|228155_228515_+	hypothetical protein	NA	NA	NA	NA
WP_003706971.1\|228530_229343_+	SPFH domain-containing protein	S4VT23	Pandoravirus	1.1e-15	29.7
WP_167370873.1\|229396_229732_+	hypothetical protein	NA	NA	NA	NA
WP_002360685.1\|230340_230637_+	hypothetical protein	A0A2K5B2B2	Erysipelothrix_phage	4.6e-44	91.8
WP_087449133.1\|230637_231054_+	recombinase	A0A2K5B2B3	Erysipelothrix_phage	5.2e-70	97.1
WP_000136908.1\|231055_232618_+	recombinase family protein	A0A2K5B2B4	Erysipelothrix_phage	7.8e-260	88.8
WP_000205227.1\|232760_232985_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000233000.1\|232999_233869_+	nucleotidyltransferase domain-containing protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
WP_000662263.1\|233849_234584_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_002294505.1\|234616_235480_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	A0A1X9I6F2	Streptococcus_phage	8.7e-168	100.0
WP_000195429.1\|236108_237281_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_001028144.1\|237410_238850_-	aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A1X9I6C2	Streptococcus_phage	3.8e-285	100.0
WP_000393259.1\|238850_239243_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	6.9e-72	100.0
WP_000195429.1\|239299_240472_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_087449134.1\|240851_242171_+\|transposase	IS1380-like element ISSsu5 family transposase	A0A1X9I6F6	Streptococcus_phage	3.0e-252	99.8
WP_087449135.1\|242470_243166_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_087449136.1\|243323_243755_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	3.9e-28	46.5
243549:243569	attL	NA	NA	NA	NA
WP_087449137.1\|243854_245132_+\|transposase	transposase	A0A286QQE5	Streptococcus_phage	6.6e-55	35.9
WP_087449138.1\|245560_246265_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_157664647.1\|246468_246561_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_157664649.1\|246575_246875_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0C5AEA5	Paenibacillus_phage	6.1e-20	51.1
WP_087449139.1\|247508_247949_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	1.1e-41	62.0
247761:247781	attR	NA	NA	NA	NA
WP_087449140.1\|248014_249412_+\|transposase	transposase	NA	NA	NA	NA
WP_087449141.1\|249649_250402_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	6.4e-18	29.1
WP_003703247.1\|250448_251546_-	tyrosine recombinase XerS	NA	NA	NA	NA
WP_087449142.1\|251926_252184_+	hypothetical protein	NA	NA	NA	NA
WP_087449143.1\|252507_252732_+	hypothetical protein	NA	NA	NA	NA
WP_087449144.1\|252818_253793_+	choloylglycine hydrolase family protein	M1HWD6	Paramecium_bursaria_Chlorella_virus	5.6e-22	31.8

DBSCAN-SWA_7

257252 : 258128

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087449147.1\|257252_258128_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.0e-20	28.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP020858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8580 : 77718

Streptococcus_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087448445.1\|8580_9870_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.6e-45	29.5
WP_003701399.1\|10036_10393_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_044005553.1\|17537_18305_-	hypothetical protein	NA	NA	NA	NA
WP_087448446.1\|18487_20521_+	DHH family phosphoesterase	NA	NA	NA	NA
WP_003700898.1\|20534_20984_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_034983739.1\|21156_22548_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	7.5e-129	55.2
WP_003702159.1\|22621_23194_+	flavodoxin	NA	NA	NA	NA
WP_034983737.1\|23429_24722_+	adenylosuccinate synthase	A0A285PX35	Cedratvirus	1.1e-65	34.6
WP_034982990.1\|25294_26230_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.4e-83	51.1
WP_034982991.1\|26387_26915_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_034982992.1\|27013_27748_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_034982993.1\|27774_28518_+	peroxide stress protein YaaA	NA	NA	NA	NA
WP_034983678.1\|28863_29382_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	2.3e-14	35.8
WP_148305435.1\|29336_30281_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-40	37.8
WP_034982994.1\|31243_32377_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	2.8e-73	42.2
WP_081325430.1\|32406_33258_+	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_087448448.1\|33273_34572_+	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	S4VRH6	Pandoravirus	1.5e-09	23.7
WP_087448449.1\|34639_35680_-	alcohol dehydrogenase catalytic domain-containing protein	E3SJ82	Synechococcus_phage	9.9e-09	25.1
WP_143454463.1\|35756_36152_-	LysR family transcriptional regulator substrate-binding protein	NA	NA	NA	NA
WP_087448450.1\|36054_36750_+	FMN-binding protein	NA	NA	NA	NA
WP_087448451.1\|37139_38039_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_087367794.1\|38065_39682_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_167370840.1\|39866_40922_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_087448453.1\|41118_42450_+	citrate transporter	NA	NA	NA	NA
WP_049164593.1\|42567_43452_+	2-hydroxy-3-oxopropionate reductase	A0A077SLF7	Escherichia_phage	8.3e-33	30.6
WP_087448454.1\|43525_44860_+	glucarate dehydratase	NA	NA	NA	NA
WP_087448455.1\|44883_45774_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_087448456.1\|45793_46924_+	glycerate kinase	W6LM47	Streptococcus_phage	1.9e-34	34.1
WP_087448457.1\|46934_47783_+	aldo/keto reductase	NA	NA	NA	NA
WP_087448458.1\|47802_49320_+	UxaA family hydrolase	NA	NA	NA	NA
WP_087448459.1\|49345_49705_+	hypothetical protein	NA	NA	NA	NA
WP_002323245.1\|49742_50915_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_087448460.1\|51034_52015_+	glucarate dehydratase	NA	NA	NA	NA
WP_087448461.1\|52154_52379_+	hypothetical protein	NA	NA	NA	NA
WP_087448462.1\|52554_53478_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	4.5e-106	62.5
WP_087448463.1\|53491_54298_-	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_087448464.1\|54568_56383_-	glycerophosphoryl diester phosphodiesterase membrane domain-containing protein	I6XE30	Staphylococcus_phage	2.3e-08	28.0
WP_080563877.1\|56567_56654_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_087448465.1\|56680_57823_+	glycerate kinase	W6LM47	Streptococcus_phage	1.1e-45	40.0
WP_081514198.1\|57945_58320_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_081514196.1\|58336_58600_+	cupredoxin domain-containing protein	NA	NA	NA	NA
WP_087448466.1\|58599_60510_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	6.3e-110	40.6
WP_081541128.1\|60628_61285_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	6.4e-06	38.1
WP_087448467.1\|61303_62104_+	HAD family hydrolase	NA	NA	NA	NA
WP_003700953.1\|62255_62813_+	elongation factor P	NA	NA	NA	NA
WP_081535272.1\|63187_64588_+	amino acid permease	NA	NA	NA	NA
WP_034990335.1\|66837_67773_+	ABC transporter permease	NA	NA	NA	NA
WP_003700958.1\|67772_68801_+	ABC transporter permease	NA	NA	NA	NA
WP_003705591.1\|68811_69855_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-16	29.3
WP_087448468.1\|69873_70821_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.4e-22	32.4
WP_041822967.1\|70903_71344_-	phosphate-starvation-inducible protein PsiE	NA	NA	NA	NA
WP_087448469.1\|71377_72745_-	amino acid permease	NA	NA	NA	NA
WP_034983016.1\|72858_73782_+	homocysteine S-methyltransferase	NA	NA	NA	NA
WP_003705586.1\|73935_74370_+	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_034983017.1\|74366_74825_+	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_034983018.1\|74910_75858_+	Dyp-type peroxidase	NA	NA	NA	NA
WP_087448470.1\|76497_77718_+\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	2.8e-95	45.6

DBSCAN-SWA_2

212173 : 220620

Escherichia_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087448539.1\|212173_213043_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	1.5e-106	64.7
WP_003701105.1\|213045_213627_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	3.0e-31	43.5
WP_087448540.1\|213638_214670_+	dTDP-glucose 4,6-dehydratase	H9NC62	Sphingomonas_phage	4.6e-51	36.0
WP_087448541.1\|214725_215565_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.1e-37	39.5
WP_003709292.1\|215718_216642_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-50	41.0
WP_034982827.1\|216781_217234_-	hypothetical protein	NA	NA	NA	NA
WP_087449015.1\|217509_219048_+	peptidoglycan DD-metalloendopeptidase family protein	Q6SEC2	Lactobacillus_prophage	4.5e-42	60.7
WP_087448542.1\|219075_220620_+	glucosaminidase domain-containing protein	A0A0K2CP65	Brevibacillus_phage	5.0e-17	38.9

DBSCAN-SWA_3

297490 : 301543

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003705375.1\|297490_297814_+	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.5e-19	39.4
WP_011476362.1\|297871_298261_+	CrcB family protein	A0A2H4PQR0	Staphylococcus_phage	1.5e-05	34.2
WP_081540996.1\|298257_298602_+	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	3.6e-08	36.2
WP_087448565.1\|298673_299546_+	DegV family EDD domain-containing protein	NA	NA	NA	NA
WP_087448566.1\|300046_300544_+	QueT transporter family protein	E7DN70	Pneumococcus_phage	4.4e-15	37.4
WP_041822915.1\|300557_300785_+	DUF2829 domain-containing protein	A8AT88	Listeria_phage	1.9e-05	35.6
WP_087448567.1\|300784_301543_+	3-oxoacyl-ACP reductase	Q06VL0	Trichoplusia_ni_ascovirus	5.3e-12	29.8

DBSCAN-SWA_4

380332 : 492390

Erysipelothrix_phage(47.5%)

protease,integrase,capsid,terminase,portal,holin,head,tRNA,transposase,tail

attL 399958:399980|attR 426148:426170

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003701368.1\|380332_381583_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	7.0e-86	41.4
WP_003703671.1\|381652_382615_-	ketopantoate reductase family protein	NA	NA	NA	NA
WP_003701371.1\|383020_383659_-	CBS domain-containing protein	NA	NA	NA	NA
WP_003703196.1\|383851_384820_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_034982616.1\|385068_385626_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_034982614.1\|385647_389172_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_034982641.1\|389181_390759_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_003709726.1\|390758_391028_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_034982613.1\|391066_391462_+	septum formation initiator family protein	NA	NA	NA	NA
WP_003703194.1\|391550_392015_+	RNA-binding protein S1	NA	NA	NA	NA
WP_034982639.1\|392071_393430_+\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	4.9e-16	27.5
WP_003701387.1\|393446_393986_+	hypoxanthine phosphoribosyltransferase	A0A2K9L634	Tupanvirus	2.9e-12	30.2
WP_003701388.1\|394126_396205_+\|protease	ATP-dependent zinc metalloprotease FtsH	E5ESM9	Bathycoccus_sp._RCC1105_virus	4.1e-107	49.7
WP_034983799.1\|396337_397228_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003701390.1\|397245_398238_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_034983798.1\|398331_399864_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	4.6e-87	37.5
399958:399980	attL	NA	NA	NA	NA
WP_087448583.1\|401646_407385_+	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_087448584.1\|407684_408974_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.4e-44	29.7
WP_052399055.1\|409093_409924_+\|transposase	transposase	A0A146ICT8	Staphylococcus_phage	5.8e-36	38.0
WP_034983523.1\|411170_411512_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_034983521.1\|411825_412683_+	KxYKxGKxW signal peptide domain-containing protein	NA	NA	NA	NA
WP_157664618.1\|412700_414596_+	SEC10/PgrA surface exclusion domain-containing protein	NA	NA	NA	NA
WP_034983519.1\|416550_416775_-	hypothetical protein	NA	NA	NA	NA
WP_034983518.1\|416755_417010_-	hypothetical protein	NA	NA	NA	NA
WP_034983516.1\|417198_417699_-	hypothetical protein	NA	NA	NA	NA
WP_034983515.1\|417695_418337_-	recombinase family protein	NA	NA	NA	NA
WP_034983513.1\|418979_419555_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	3.5e-32	43.6
WP_034983506.1\|423779_424013_+	hypothetical protein	NA	NA	NA	NA
WP_034983503.1\|424025_424592_+	hypothetical protein	NA	NA	NA	NA
WP_003672053.1\|424642_424843_+	excisionase family DNA-binding protein	A0A1S5SF07	Streptococcus_phage	7.9e-08	42.6
WP_087448586.1\|424913_426146_+\|integrase	site-specific integrase	H7BUX8	unidentified_phage	4.5e-85	41.1
WP_087448587.1\|432075_433215_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
426148:426170	attR	NA	NA	NA	NA
WP_167370857.1\|433334_435557_+	DNA helicase PcrA	A7KV33	Bacillus_phage	1.0e-135	42.3
WP_034982967.1\|435573_437592_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	4.4e-106	34.9
WP_034982968.1\|437588_438734_+	CamS family sex pheromone protein	NA	NA	NA	NA
WP_003702422.1\|438885_439185_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_004564244.1\|439187_440651_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_087448589.1\|440650_442084_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003705249.1\|442116_443136_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.5e-17	29.0
WP_087448590.1\|443216_444590_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.2e-125	50.0
WP_087448591.1\|444890_445211_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_087448592.1\|445367_446954_-	recombinase family protein	A0A2K5B2B4	Erysipelothrix_phage	2.0e-125	47.3
WP_087448593.1\|446940_447345_-	recombinase	NA	NA	NA	NA
WP_087448594.1\|447331_448885_-	recombinase family protein	A0A2K5B2B2	Erysipelothrix_phage	2.3e-86	34.9
WP_003672653.1\|448946_449135_-	hypothetical protein	NA	NA	NA	NA
WP_087448595.1\|449232_449655_-\|holin	phage holin family protein	A0A2K5B2A2	Erysipelothrix_phage	4.4e-40	65.8
WP_087448596.1\|449644_450025_-\|head	phage head closure protein	NA	NA	NA	NA
WP_087448597.1\|450025_450304_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_087448598.1\|450317_451496_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	3.7e-129	58.7
WP_003672645.1\|451516_452179_-\|protease	Clp protease ClpP	A0A2K5B288	Erysipelothrix_phage	4.2e-53	56.0
WP_167370843.1\|452175_453432_-\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	4.4e-152	62.8
WP_003672642.1\|453488_453650_+	hypothetical protein	NA	NA	NA	NA
WP_003672640.1\|453790_453952_-	hypothetical protein	NA	NA	NA	NA
WP_013923830.1\|453979_455581_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	1.5e-250	78.7
WP_003672638.1\|455646_455853_-	DUF5049 domain-containing protein	NA	NA	NA	NA
WP_087448599.1\|455845_456478_-	hypothetical protein	A0A2K5B280	Erysipelothrix_phage	4.4e-36	38.6
WP_087448600.1\|456551_457781_-	DNA modification methylase	A0A2I4R670	Erysipelothrix_phage	2.9e-148	62.4
WP_087448601.1\|457780_458323_-\|terminase	terminase	A0A2K5B277	Erysipelothrix_phage	2.7e-58	59.6
WP_087448602.1\|458445_458823_-	HNH endonuclease	A0A2K5B276	Erysipelothrix_phage	2.5e-31	53.0
WP_081509815.1\|458957_459428_-	restriction endonuclease	NA	NA	NA	NA
WP_087448603.1\|459396_460779_-	DEAD/DEAH box helicase	A0A2K5B273	Erysipelothrix_phage	2.6e-158	66.9
WP_087448604.1\|460738_461041_-	VRR-NUC domain-containing protein	A0A2K5B272	Erysipelothrix_phage	3.6e-20	56.7
WP_087448605.1\|461235_463482_-	primase C-terminal domain-containing protein	E4ZFK6	Streptococcus_phage	9.7e-211	48.4
WP_087449017.1\|463484_463883_-	hypothetical protein	A0A2K5B270	Erysipelothrix_phage	8.4e-17	36.4
WP_087448606.1\|463977_465912_-	DNA polymerase	A0A2K5B2B0	Erysipelothrix_phage	2.9e-224	58.3
WP_162854412.1\|465962_466514_-	DUF2815 family protein	A0A2K5B2A9	Erysipelothrix_phage	4.8e-71	71.6
WP_087448608.1\|466515_467658_-	DUF2800 domain-containing protein	A0A2K5B2A8	Erysipelothrix_phage	2.1e-113	54.8
WP_087448609.1\|467641_467974_-	hypothetical protein	NA	NA	NA	NA
WP_087448610.1\|467960_468158_-	hypothetical protein	A0A2I4R673	Erysipelothrix_phage	8.6e-07	40.4
WP_087448611.1\|468262_468790_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_087448612.1\|469165_470485_+	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_087448613.1\|470489_473105_+	helicase	NA	NA	NA	NA
WP_087448614.1\|473118_473340_+	helix-turn-helix transcriptional regulator	A0A2K5B263	Erysipelothrix_phage	6.1e-17	67.2
WP_087448615.1\|473372_476447_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	1.3e-24	24.5
WP_087448616.1\|476452_478081_+	SAM-dependent DNA methyltransferase	A0A2H4PQP4	Staphylococcus_phage	2.1e-29	27.7
WP_087448617.1\|478084_479272_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_087448618.1\|479387_480662_+	hypothetical protein	NA	NA	NA	NA
WP_167370844.1\|480861_481023_-	hypothetical protein	NA	NA	NA	NA
WP_087448619.1\|481362_482220_+	Mrr restriction system protein	NA	NA	NA	NA
WP_044005169.1\|482304_482634_+	hypothetical protein	NA	NA	NA	NA
WP_002323245.1\|482757_483930_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_003705217.1\|486790_487348_-	TIGR01440 family protein	NA	NA	NA	NA
WP_034982985.1\|487526_489704_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	2.1e-258	60.0
WP_003703613.1\|489693_490374_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	7.5e-58	60.2
WP_003703607.1\|490601_491000_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_087448620.1\|491100_492390_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	6.2e-45	30.0

DBSCAN-SWA_5

608317 : 617336

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034983632.1\|608317_610489_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.2e-266	64.0
WP_003700671.1\|610469_610853_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	R4JF54	Bacillus_phage	5.8e-15	38.7
WP_003703366.1\|610849_611080_-	glutaredoxin-like protein NrdH	X2KRY7	Enterococcus_phage	6.1e-12	40.3
WP_003703376.1\|611282_611894_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_044005603.1\|611940_612408_+	nucleoside deaminase	NA	NA	NA	NA
WP_011476228.1\|612613_614353_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	6.6e-58	38.9
WP_003700666.1\|614370_614685_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_011476227.1\|615323_615563_+	YaaL family protein	NA	NA	NA	NA
WP_003700663.1\|615682_616309_+	dTMP kinase	M1PSC7	Streptococcus_phage	6.9e-50	51.0
WP_081537012.1\|616343_617336_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.4e-35	30.9

DBSCAN-SWA_6

653407 : 662210

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003700627.1\|653407_656242_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.0e-310	56.7
WP_003700626.1\|656317_656788_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_087448638.1\|656811_657453_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003700624.1\|657600_658518_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	7.9e-10	34.5
WP_003700623.1\|658514_659528_+	YvcK family protein	A1IMD5	Streptococcus_phage	8.5e-98	56.0
WP_003700622.1\|659550_660498_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.9e-51	39.4
WP_003700621.1\|660547_661141_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.5e-54	54.8
WP_003709292.1\|661286_662210_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-50	41.0

DBSCAN-SWA_7

985043 : 1044668

Streptococcus_phage(15.79%)

tRNA,transposase,integrase

attL 983714:983731|attR 1054044:1054061

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
983714:983731	attL	NA	NA	NA	NA
WP_044005740.1\|985043_986333_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.6e-45	30.0
WP_087448717.1\|986440_987361_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_003706230.1\|987386_988343_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_087448718.1\|988456_989077_-	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	1.2e-33	34.6
WP_003704381.1\|989076_989790_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_087448719.1\|989786_991718_-	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
WP_086201542.1\|991695_992796_-	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
WP_003700158.1\|992857_994165_-	uracil transporter	Q9KX94	Enterobacteria_phage	3.6e-64	37.0
WP_003704375.1\|994191_994728_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_087448720.1\|994934_995831_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.2e-12	30.0
WP_081512044.1\|995823_996270_-	signal peptidase II	NA	NA	NA	NA
WP_081512042.1\|996336_996951_-	HAD family hydrolase	NA	NA	NA	NA
WP_003700152.1\|996955_997402_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_087448721.1\|997416_999636_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	U5J9N6	Bacillus_phage	7.5e-14	40.6
WP_087448722.1\|999675_1000407_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_087448723.1\|1000406_1001297_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_003700147.1\|1001313_1001826_-	DUF3013 family protein	NA	NA	NA	NA
WP_087448724.1\|1002080_1003043_+	nucleoside hydrolase	NA	NA	NA	NA
WP_087448725.1\|1003647_1004937_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.8e-45	30.0
WP_087448726.1\|1005064_1005535_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_003700143.1\|1005551_1006193_-	uridine kinase	A0A1V0SAA3	Catovirus	1.3e-35	39.6
WP_087448727.1\|1006215_1007355_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_087448728.1\|1007507_1009925_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003700137.1\|1009931_1010978_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	3.1e-26	37.4
WP_003700136.1\|1011323_1011671_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003700135.1\|1011812_1012337_-	HD domain-containing protein	NA	NA	NA	NA
WP_087448729.1\|1012445_1013207_-	RNA methyltransferase	NA	NA	NA	NA
WP_003700133.1\|1013341_1013830_+	hypothetical protein	NA	NA	NA	NA
WP_034984149.1\|1013826_1014009_-	hypothetical protein	NA	NA	NA	NA
WP_087448730.1\|1014600_1017075_-	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	9.4e-58	28.0
WP_087448731.1\|1017067_1017736_-	hypothetical protein	NA	NA	NA	NA
WP_087448732.1\|1017751_1018408_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_087448734.1\|1020021_1021425_-	PTS galactitol transporter subunit IIC	NA	NA	NA	NA
WP_081536865.1\|1021579_1022728_-\|integrase	site-specific integrase	Q38159	Streptococcus_phage	9.4e-61	38.1
WP_087448735.1\|1023270_1023780_-	XRE family transcriptional regulator	L0P7E1	Lactobacillus_phage	2.8e-09	54.2
WP_087448736.1\|1023920_1024115_+	hypothetical protein	NA	NA	NA	NA
WP_087449019.1\|1024318_1024513_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_087448737.1\|1024515_1025178_+	Rha family transcriptional regulator	R9QNB1	Lactococcus_phage	1.0e-27	41.4
WP_087448738.1\|1025229_1025535_+	hypothetical protein	NA	NA	NA	NA
WP_087448739.1\|1025549_1025759_+	hypothetical protein	NA	NA	NA	NA
WP_087448740.1\|1025755_1026094_+	hypothetical protein	NA	NA	NA	NA
WP_087448741.1\|1026352_1026724_+	hypothetical protein	NA	NA	NA	NA
WP_087448742.1\|1026736_1027141_+	hypothetical protein	NA	NA	NA	NA
WP_087448743.1\|1027153_1027921_+	bifunctional DNA primase/polymerase	A0A060ADS5	Enterococcus_phage	3.3e-17	29.2
WP_087448744.1\|1027935_1029330_+	DNA primase family protein	H7BVJ4	unidentified_phage	1.9e-23	27.9
WP_087448745.1\|1029613_1029922_+	hypothetical protein	NA	NA	NA	NA
WP_081536854.1\|1029981_1030422_+	hypothetical protein	NA	NA	NA	NA
WP_087448746.1\|1030426_1030645_+	hypothetical protein	NA	NA	NA	NA
WP_044004860.1\|1032389_1033700_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_003706174.1\|1033722_1035834_-	type I DNA topoisomerase	A0A1V0SB35	Catovirus	3.9e-97	35.1
WP_148305435.1\|1036259_1037204_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-40	37.8
WP_034983678.1\|1037158_1037677_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	2.3e-14	35.8
WP_087448747.1\|1038147_1038534_+	hypothetical protein	NA	NA	NA	NA
WP_034983384.1\|1038557_1039052_+	hypothetical protein	NA	NA	NA	NA
WP_087448748.1\|1041799_1043029_-	argininosuccinate synthase	NA	NA	NA	NA
WP_087448749.1\|1043200_1044178_-	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	1.1e-22	30.5
WP_034983829.1\|1044329_1044668_-\|transposase	transposase	A0A146ICT8	Staphylococcus_phage	4.0e-12	36.8
1054044:1054061	attR	NA	NA	NA	NA

DBSCAN-SWA_8

1059801 : 1067309

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087448751.1\|1059801_1060662_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.1e-56	42.4
WP_014568348.1\|1060838_1061342_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	2.2e-30	44.6
WP_003700096.1\|1061359_1062316_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	2.0e-117	61.5
WP_087448752.1\|1062333_1064241_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.6e-57	31.3
WP_014568347.1\|1064237_1065452_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	6.7e-49	34.8
WP_011475876.1\|1065448_1066237_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_034983150.1\|1066412_1067309_+	YitT family protein	M1Q1P6	Streptococcus_phage	5.1e-54	37.3

DBSCAN-SWA_9

1098557 : 1111529

Prochlorococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087448640.1\|1098557_1099847_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-45	30.2
WP_003700050.1\|1099934_1101191_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_087448759.1\|1101207_1102746_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.3e-69	47.6
WP_087448760.1\|1102757_1103345_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.5e-25	36.9
WP_087448761.1\|1103357_1104395_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.9e-62	42.3
WP_011475859.1\|1104395_1105847_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-63	35.6
WP_034982879.1\|1105822_1108048_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.5e-142	39.7
WP_087448762.1\|1108049_1108724_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003700038.1\|1108723_1108972_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003700037.1\|1108990_1109704_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4R1E8	Synechococcus_phage	3.1e-38	37.4
WP_087448763.1\|1110015_1111050_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_011475856.1\|1111046_1111529_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.6e-22	41.1

DBSCAN-SWA_10

1204154 : 1294535

116

Lactobacillus_phage(28.21%)

protease,capsid,integrase,terminase,portal,plate,head,tRNA,transposase,tail

attL 1278656:1278673|attR 1300469:1300486

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014568277.1\|1204154_1205063_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_003699907.1\|1205131_1205491_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_044004747.1\|1205514_1207728_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.6e-24	23.6
WP_003699904.1\|1207799_1208105_-	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_003699903.1\|1208094_1208394_-	YlxR family protein	NA	NA	NA	NA
WP_003703149.1\|1208396_1209524_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003699900.1\|1209549_1210023_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_044004745.1\|1210231_1214566_-	PolC-type DNA polymerase III	Q8W6C3	Saccharomonospora_phage	4.1e-24	22.2
WP_003699897.1\|1214663_1216379_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_044004743.1\|1216429_1217707_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003699893.1\|1217731_1218520_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003699891.1\|1218522_1219305_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-25	47.6
WP_003699890.1\|1219440_1220004_-	ribosome recycling factor	NA	NA	NA	NA
WP_003703168.1\|1220006_1220729_-	UMP kinase	NA	NA	NA	NA
WP_003699888.1\|1220841_1221219_-	DUF956 family protein	NA	NA	NA	NA
WP_003699887.1\|1221305_1221767_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.1e-23	40.5
WP_087448782.1\|1221872_1223162_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.4e-44	29.3
WP_003699883.1\|1223698_1225042_-	type I glutamate--ammonia ligase	A0A0G2Y3D5	Acanthamoeba_polyphaga_mimivirus	1.3e-08	24.8
WP_003699881.1\|1225071_1225458_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003699880.1\|1225548_1226811_-	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_044004737.1\|1226832_1227756_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003705942.1\|1227887_1228064_+	DUF3042 family protein	NA	NA	NA	NA
WP_003705941.1\|1228133_1228547_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_044004733.1\|1228589_1229552_-	ROK family glucokinase	NA	NA	NA	NA
WP_011475814.1\|1229548_1229788_-	YqgQ family protein	NA	NA	NA	NA
WP_044004731.1\|1229827_1230490_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_087448783.1\|1230503_1231052_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_003699868.1\|1231106_1231256_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_087448784.1\|1231403_1233557_-	SEC10/PgrA surface exclusion domain-containing protein	NA	NA	NA	NA
WP_087449021.1\|1233714_1235454_-	DUF2207 domain-containing protein	NA	NA	NA	NA
WP_003699862.1\|1235631_1235931_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1S7FYY8	Listeria_phage	8.5e-22	51.5
WP_003709878.1\|1235948_1236539_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003699860.1\|1236621_1236846_-	YneF family protein	NA	NA	NA	NA
WP_003704077.1\|1236972_1237227_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003699857.1\|1237373_1237994_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	3.2e-15	58.8
WP_003709292.1\|1238050_1238974_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-50	41.0
WP_087448785.1\|1239116_1240784_-	DNA repair protein RecN	NA	NA	NA	NA
WP_003699854.1\|1240788_1241247_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_003704070.1\|1241271_1242099_-	TlyA family rRNA (cytidine-2'-O)-methyltransferase	NA	NA	NA	NA
WP_174633251.1\|1242101_1243019_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_003699848.1\|1242984_1243212_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_034982367.1\|1243211_1244552_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	2.1e-35	30.9
WP_011475808.1\|1244544_1245402_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	8.1e-41	44.0
WP_003699843.1\|1245546_1245942_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_003699841.1\|1245941_1246364_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003699839.1\|1246380_1246938_-	elongation factor P	NA	NA	NA	NA
WP_087448786.1\|1247071_1247524_-	dUTPase	NA	NA	NA	NA
WP_087448787.1\|1247554_1248550_-	hypothetical protein	NA	NA	NA	NA
WP_044004716.1\|1248551_1249433_-	hypothetical protein	NA	NA	NA	NA
WP_087448788.1\|1249831_1250758_-	SH3 domain-containing protein	A0A0A1ERA5	Lactobacillus_phage	5.9e-114	66.7
WP_034983548.1\|1250759_1251119_-	hypothetical protein	A0A0A1ELI5	Lactobacillus_phage	8.1e-19	44.5
WP_034983550.1\|1251119_1251431_-	hypothetical protein	NA	NA	NA	NA
WP_087448789.1\|1251483_1251648_-	XkdX family protein	NA	NA	NA	NA
WP_087448790.1\|1251649_1252009_-	hypothetical protein	NA	NA	NA	NA
WP_167370863.1\|1252030_1252396_-	hypothetical protein	NA	NA	NA	NA
WP_087448792.1\|1252446_1253397_-	carbohydrate binding domain-containing protein	NA	NA	NA	NA
WP_087448793.1\|1253402_1253912_-	Ig-like domain-containing protein	A0A1D6Z291	Staphylococcus_phage	1.0e-06	37.9
WP_087448794.1\|1253918_1255265_-\|plate	BppU family phage baseplate upper protein	NA	NA	NA	NA
WP_087448795.1\|1255264_1255711_-	hypothetical protein	NA	NA	NA	NA
WP_087448796.1\|1256519_1258196_-\|tail	phage tail protein	D2KRB9	Lactobacillus_phage	2.4e-25	30.8
WP_087448797.1\|1258192_1259098_-\|tail	phage tail family protein	W5RV36	Staphylococcus_phage	2.0e-18	28.6
WP_087448798.1\|1259099_1260617_-	transglycosylase SLT domain-containing protein	V5URV5	Oenococcus_phage	6.0e-39	39.1
WP_087448800.1\|1260874_1263580_-	tape measure protein	A0A220GC82	Streptococcus_phage	2.1e-74	37.3
WP_087448801.1\|1263590_1263914_-	hypothetical protein	NA	NA	NA	NA
WP_087448802.1\|1263934_1264393_-	hypothetical protein	NA	NA	NA	NA
WP_081561390.1\|1264455_1265112_-	hypothetical protein	NA	NA	NA	NA
WP_087448803.1\|1265126_1265534_-	hypothetical protein	NA	NA	NA	NA
WP_087448804.1\|1265535_1266018_-	hypothetical protein	NA	NA	NA	NA
WP_087448805.1\|1266004_1266322_-	hypothetical protein	NA	NA	NA	NA
WP_087448806.1\|1266315_1266669_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_174633252.1\|1266677_1267712_-	replication protein	O03966	Lactobacillus_phage	1.1e-76	45.2
WP_087448807.1\|1267723_1268311_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_087448808.1\|1268441_1268654_-	hypothetical protein	NA	NA	NA	NA
WP_087448809.1\|1268704_1268947_-	hypothetical protein	NA	NA	NA	NA
WP_087448810.1\|1268952_1270299_-\|capsid	minor capsid protein	X5JAI9	Clostridium_phage	2.5e-12	21.6
WP_087448811.1\|1270298_1272005_-\|portal	phage portal protein	A7J292	Streptococcus_phage	3.2e-65	37.7
WP_087448812.1\|1272015_1273284_-\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.8e-121	54.9
WP_087448813.1\|1273261_1273756_-\|terminase	small terminase subunit	A9D9R6	Lactobacillus_prophage	1.5e-39	55.6
WP_087448814.1\|1273772_1274258_-	QueT transporter family protein	NA	NA	NA	NA
WP_087448815.1\|1274250_1275096_-	hypothetical protein	NA	NA	NA	NA
WP_087448816.1\|1275092_1275596_-	ParB N-terminal domain-containing protein	X2CXX2	Lactobacillus_phage	4.7e-41	57.5
WP_087449024.1\|1276130_1276562_-	transcriptional regulator	B8R690	Lactobacillus_phage	1.2e-08	32.0
WP_087448817.1\|1276647_1276842_-	hypothetical protein	NA	NA	NA	NA
WP_087448818.1\|1276844_1277342_-	hypothetical protein	NA	NA	NA	NA
WP_087448819.1\|1277341_1277692_-	hypothetical protein	NA	NA	NA	NA
WP_087448820.1\|1278160_1278379_-	hypothetical protein	NA	NA	NA	NA
WP_087448821.1\|1278474_1278789_-	hypothetical protein	NA	NA	NA	NA
1278656:1278673	attL	NA	NA	NA	NA
WP_087448823.1\|1278978_1279251_-	hypothetical protein	NA	NA	NA	NA
WP_087448824.1\|1279240_1279516_-	hypothetical protein	NA	NA	NA	NA
WP_087448825.1\|1279530_1280295_-	site-specific DNA-methyltransferase	A0A097QQ03	Enterococcus_phage	3.0e-95	69.2
WP_087448826.1\|1280316_1280943_-	HNH endonuclease	A0A220GJG3	Streptococcus_phage	3.8e-48	62.0
WP_087448827.1\|1280926_1281340_-	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	3.5e-26	45.5
WP_087448828.1\|1281323_1281560_-	hypothetical protein	NA	NA	NA	NA
WP_087448829.1\|1281552_1281783_-	hypothetical protein	NA	NA	NA	NA
WP_087448830.1\|1281775_1282312_-	helix-turn-helix domain-containing protein	A0A286QN41	Streptococcus_phage	6.0e-26	39.8
WP_087448831.1\|1282314_1282506_-	hypothetical protein	NA	NA	NA	NA
WP_157664622.1\|1282505_1283330_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	1.4e-26	34.6
WP_087448833.1\|1283322_1284117_-	DnaD domain protein	A0A2H4JAS0	uncultured_Caudovirales_phage	8.6e-21	41.4
WP_081510371.1\|1284223_1284454_+	hypothetical protein	NA	NA	NA	NA
WP_087448834.1\|1284434_1284728_-	hypothetical protein	NA	NA	NA	NA
WP_087448835.1\|1284738_1284927_-	hypothetical protein	NA	NA	NA	NA
WP_087448836.1\|1284939_1285758_-	PD-(D/E)XK nuclease-like domain-containing protein	E9LUM4	Lactobacillus_phage	1.2e-89	55.2
WP_087448837.1\|1285767_1286697_-	recombinase RecT	E9LUM3	Lactobacillus_phage	9.3e-75	54.5
WP_157664623.1\|1286680_1286848_-	hypothetical protein	NA	NA	NA	NA
WP_087448838.1\|1287173_1287458_-	hypothetical protein	NA	NA	NA	NA
WP_087448839.1\|1287461_1288424_-	phage antirepressor KilAC domain-containing protein	A9D9L9	Lactobacillus_prophage	1.1e-51	46.1
WP_087449025.1\|1288435_1289029_-	hypothetical protein	B5SP25	Lactococcus_phage	9.0e-15	31.4
WP_087448840.1\|1289337_1289544_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081530997.1\|1289712_1290054_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	1.1e-28	59.6
WP_087448841.1\|1290069_1290327_+	hypothetical protein	NA	NA	NA	NA
WP_003709292.1\|1290427_1291351_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-50	41.0
WP_157664624.1\|1291589_1291766_+	hypothetical protein	NA	NA	NA	NA
WP_087448842.1\|1291832_1292357_+	hypothetical protein	Q6SEG3	Lactobacillus_prophage	3.2e-08	46.8
WP_087448843.1\|1292419_1292869_+	hypothetical protein	NA	NA	NA	NA
WP_087448844.1\|1292868_1293303_+	hypothetical protein	NA	NA	NA	NA
WP_087448845.1\|1293377_1294535_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	2.4e-72	41.7
1300469:1300486	attR	NA	NA	NA	NA

DBSCAN-SWA_11

1474479 : 1486385

Catovirus(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087448898.1\|1474479_1475409_+	YegS/Rv2252/BmrU family lipid kinase	A0A1V0SBJ0	Catovirus	2.1e-10	26.5
WP_087448899.1\|1475457_1476174_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003705736.1\|1476272_1476683_+	peptide deformylase	A0A2I7S809	Vibrio_phage	4.9e-12	38.4
WP_087367728.1\|1476696_1477788_+	phosphoesterase	NA	NA	NA	NA
WP_003710743.1\|1477805_1478642_+	DUF72 domain-containing protein	A0A1V0CNL1	Kaumoebavirus	7.7e-12	29.6
WP_087448900.1\|1478683_1479052_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A2P0ZKX3	Lactobacillus_phage	3.7e-11	34.2
WP_003699582.1\|1479067_1479316_-	hypothetical protein	NA	NA	NA	NA
WP_081536739.1\|1479362_1480478_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.9e-34	32.4
WP_003699585.1\|1480496_1480904_-	holo-ACP synthase	NA	NA	NA	NA
WP_087448901.1\|1481033_1482512_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.4e-64	36.8
WP_087448902.1\|1482647_1484018_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_087448903.1\|1484155_1484926_-	TIGR02452 family protein	G3MBH6	Bacillus_virus	4.4e-22	31.2
WP_087118595.1\|1485071_1486385_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.0e-50	33.9

DBSCAN-SWA_12

1500583 : 1561741

Streptococcus_phage(17.65%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003705110.1\|1500583_1501015_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	7.9e-29	47.2
WP_087448910.1\|1501114_1502392_+\|transposase	transposase	A0A286QQE5	Streptococcus_phage	6.6e-55	35.9
WP_080767659.1\|1502651_1504007_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.6e-28	32.1
WP_034983530.1\|1504022_1504844_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_034983531.1\|1504907_1505837_+	DMT family transporter	NA	NA	NA	NA
WP_087448911.1\|1505983_1507273_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	8.1e-45	30.0
WP_087448912.1\|1507419_1508136_-	hypothetical protein	NA	NA	NA	NA
WP_087448913.1\|1508153_1509245_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_087448914.1\|1509298_1511914_-	hypothetical protein	NA	NA	NA	NA
WP_034983534.1\|1511906_1513919_-	ATP-dependent helicase	NA	NA	NA	NA
WP_034983536.1\|1513911_1515207_-	hypothetical protein	NA	NA	NA	NA
WP_087448915.1\|1515210_1516818_-	AAA family ATPase	V5UQM2	Mycobacterium_phage	8.9e-33	37.2
WP_034983539.1\|1516817_1517843_-	hypothetical protein	NA	NA	NA	NA
WP_034983540.1\|1518062_1518812_-	YibE/F family protein	NA	NA	NA	NA
WP_167370852.1\|1518808_1519909_-	YibE/F family protein	NA	NA	NA	NA
WP_034982703.1\|1520037_1521003_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_003709305.1\|1521782_1523405_-	ATP-binding cassette domain-containing protein	A0A1V0SKJ1	Klosneuvirus	8.6e-52	27.5
WP_087448917.1\|1523479_1524250_-	nucleoside phosphorylase	F5CA76	Streptococcus_phi-m46.1-like_phage	2.2e-37	46.9
WP_003699642.1\|1524392_1524629_+	hypothetical protein	NA	NA	NA	NA
WP_003709302.1\|1524634_1525474_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	6.2e-46	39.1
WP_003699645.1\|1525624_1526149_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003699646.1\|1526222_1527200_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	1.5e-43	37.0
WP_003702576.1\|1527290_1528700_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	4.6e-25	30.6
WP_087448918.1\|1528842_1530060_-	MFS transporter	NA	NA	NA	NA
WP_087448919.1\|1530256_1531546_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.1e-44	30.7
WP_003709294.1\|1531706_1532546_-	pur operon repressor	NA	NA	NA	NA
WP_034982715.1\|1532715_1532988_-	hypothetical protein	NA	NA	NA	NA
WP_087448920.1\|1532987_1533524_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_034982716.1\|1533535_1533943_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_087448921.1\|1534172_1535264_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_087449026.1\|1535862_1536912_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_044004510.1\|1536931_1537921_-	D-2-hydroxyacid dehydrogenase	Q89388	Paramecium_bursaria_Chlorella_virus	3.1e-44	38.5
WP_087448923.1\|1537936_1539112_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_087448924.1\|1539673_1540885_+	argininosuccinate synthase	NA	NA	NA	NA
WP_087448925.1\|1540908_1542291_+	argininosuccinate lyase	NA	NA	NA	NA
WP_087448926.1\|1542512_1543727_-\|transposase	transposase	A0A0P0IJS6	Lactobacillus_phage	9.5e-96	45.9
WP_034982926.1\|1544151_1545021_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_034982925.1\|1545059_1545530_-	hypothetical protein	NA	NA	NA	NA
WP_087448927.1\|1545573_1546692_-	aminotransferase	NA	NA	NA	NA
WP_087448928.1\|1546704_1547559_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003702215.1\|1547647_1547881_-	Veg family protein	NA	NA	NA	NA
WP_087448929.1\|1547968_1548859_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_080767637.1\|1548870_1549428_-	ribonuclease M5	NA	NA	NA	NA
WP_034982920.1\|1549438_1550209_-	TatD family hydrolase	NA	NA	NA	NA
WP_014568129.1\|1550342_1552370_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.4e-99	38.3
WP_086201643.1\|1552473_1553430_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_034982917.1\|1553429_1554695_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_086201645.1\|1554774_1555578_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003704876.1\|1555614_1556262_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003707052.1\|1557389_1558115_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.3e-22	30.6
WP_034982912.1\|1558206_1559136_-	exopolyphosphatase	NA	NA	NA	NA
WP_087448930.1\|1559224_1560244_-\|tRNA	tryptophan--tRNA ligase	A0A1V0SFS8	Hokovirus	1.3e-05	25.9
WP_002323245.1\|1560568_1561741_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8

DBSCAN-SWA_13

1670118 : 1706631

Staphylococcus_phage(21.43%)

integrase,transposase

attL 1669576:1669593|attR 1671523:1671540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1669576:1669593	attL	NA	NA	NA	NA
WP_191981151.1\|1670118_1671522_-\|integrase	tyrosine-type recombinase/integrase	A8ATD6	Listeria_phage	2.6e-81	49.8
WP_034982262.1\|1671604_1673200_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	3.5e-130	52.0
1671523:1671540	attR	NA	NA	NA	NA
WP_087449027.1\|1673224_1674466_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	4.6e-21	26.2
WP_034982263.1\|1674482_1677695_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	4.4e-15	23.4
WP_034982264.1\|1677695_1678262_-	restriction endonuclease subunit M	NA	NA	NA	NA
WP_034982265.1\|1678402_1680502_-	putative ornithine decarboxylase	NA	NA	NA	NA
WP_087448952.1\|1680791_1682147_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_087448953.1\|1682204_1683086_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003700808.1\|1683102_1683936_-	acetoacetate decarboxylase family protein	NA	NA	NA	NA
WP_003702509.1\|1684103_1684748_+	nitroreductase family protein	NA	NA	NA	NA
WP_087449028.1\|1684819_1685944_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	3.7e-70	41.4
WP_034982273.1\|1686386_1686704_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_087448954.1\|1686715_1687126_-	cupin domain-containing protein	NA	NA	NA	NA
WP_087448955.1\|1688078_1689476_-\|transposase	transposase	NA	NA	NA	NA
WP_087448956.1\|1689541_1689982_+\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	7.1e-41	61.2
WP_002323245.1\|1690238_1691411_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_087448957.1\|1691654_1692761_+	hypothetical protein	NA	NA	NA	NA
WP_087448958.1\|1693160_1693427_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_087448959.1\|1693521_1693857_-	hypothetical protein	NA	NA	NA	NA
WP_087448960.1\|1694402_1695374_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.6e-22	31.7
WP_143453819.1\|1697684_1697843_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_087448961.1\|1698256_1698955_+	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	2.4e-27	36.5
WP_157664628.1\|1699047_1699371_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.8e-05	39.2
WP_095842242.1\|1699330_1699828_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	3.7e-38	52.0
WP_087448962.1\|1699824_1700280_-	hypothetical protein	NA	NA	NA	NA
WP_087448963.1\|1700311_1701115_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_087449029.1\|1701129_1702017_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.1e-36	34.7
WP_087448964.1\|1702481_1703174_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-29	34.6
WP_087448965.1\|1704048_1704312_-	SHOCT domain-containing protein	NA	NA	NA	NA
WP_087448966.1\|1704483_1706631_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.2e-58	28.7

DBSCAN-SWA_14

1726591 : 1795512

Streptococcus_phage(25.0%)

protease,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087448970.1\|1726591_1726903_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003704561.1\|1727238_1727469_-	PspC domain-containing protein	NA	NA	NA	NA
WP_034982286.1\|1727486_1728452_-	DUF4097 domain-containing protein	NA	NA	NA	NA
WP_003704556.1\|1728454_1729060_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_034982287.1\|1729062_1729383_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_087448971.1\|1729641_1730139_-	hypothetical protein	NA	NA	NA	NA
WP_080739304.1\|1730234_1730831_-	uracil-DNA glycosylase family protein	NA	NA	NA	NA
WP_034982290.1\|1730832_1732017_-	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.8e-99	45.9
WP_034982291.1\|1732024_1733116_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.9e-99	52.6
WP_034982292.1\|1733536_1735093_+	LysM peptidoglycan-binding domain-containing protein	A0A1J0GW44	Streptomyces_phage	6.8e-22	46.4
WP_087448778.1\|1735223_1736513_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.4e-44	29.7
WP_003701867.1\|1736856_1737246_-	DUF956 family protein	NA	NA	NA	NA
WP_003705037.1\|1737266_1738181_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_003700745.1\|1738199_1739009_-	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_087448972.1\|1739027_1740026_-	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_034982294.1\|1740296_1741289_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003709098.1\|1741288_1742587_+	sensor histidine kinase	NA	NA	NA	NA
WP_003705044.1\|1742601_1743258_+	response regulator transcription factor	NA	NA	NA	NA
WP_003705046.1\|1743267_1744563_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_087448973.1\|1744721_1745408_+	DUF554 domain-containing protein	NA	NA	NA	NA
WP_003707229.1\|1745455_1745836_-	VOC family protein	NA	NA	NA	NA
WP_051454347.1\|1745835_1746276_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_044004365.1\|1746398_1747910_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_087448974.1\|1747909_1748611_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_034982298.1\|1748674_1749481_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_080739303.1\|1750467_1751724_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.7e-18	25.4
WP_087448975.1\|1751925_1753362_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_034982302.1\|1753397_1753934_-	biotin transporter BioY	NA	NA	NA	NA
WP_087448976.1\|1754070_1755864_-	DUF2207 domain-containing protein	NA	NA	NA	NA
WP_003701855.1\|1756048_1756321_+	hypothetical protein	NA	NA	NA	NA
WP_034982304.1\|1756398_1757415_-	glycosyltransferase	NA	NA	NA	NA
WP_034982305.1\|1757441_1758104_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_034982306.1\|1758180_1758819_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_034997509.1\|1758838_1760227_-	potassium transporter KtrB	NA	NA	NA	NA
WP_034982308.1\|1760341_1762087_-	alpha amylase N-terminal ig-like domain-containing protein	NA	NA	NA	NA
WP_034982309.1\|1762202_1764137_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_034982310.1\|1764539_1766030_+	sucrose-6-phosphate hydrolase	NA	NA	NA	NA
WP_003700709.1\|1766048_1767041_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-19	26.3
WP_003701500.1\|1772859_1773894_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_003707259.1\|1774133_1775591_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003709061.1\|1775694_1775871_+	hypothetical protein	NA	NA	NA	NA
WP_003705083.1\|1775930_1776407_-	universal stress protein	NA	NA	NA	NA
WP_087448977.1\|1776618_1778727_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.0e-121	39.0
WP_003705087.1\|1778852_1779083_-	hypothetical protein	NA	NA	NA	NA
WP_087448978.1\|1779285_1780644_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_003705091.1\|1780696_1781416_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A2I7RZT1	Vibrio_phage	2.1e-05	26.9
WP_087448979.1\|1781566_1782151_-	peptidylprolyl isomerase	A0A076FI46	Aureococcus_anophage	7.7e-27	44.1
WP_087448980.1\|1782517_1783999_+	ABC-F type ribosomal protection protein	A0A2I4R674	Erysipelothrix_phage	5.7e-34	27.5
WP_157664629.1\|1784370_1785693_-	MATE family efflux transporter	NA	NA	NA	NA
WP_087448981.1\|1785939_1788060_-	glycosyltransferase	NA	NA	NA	NA
WP_034998092.1\|1788177_1788696_+\|transposase	transposase	A0A1B1P776	Bacillus_phage	1.0e-14	36.5
WP_157664634.1\|1788692_1789595_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.2e-40	37.4
WP_087448983.1\|1789660_1790536_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	7.0e-08	36.0
WP_087448984.1\|1790559_1791468_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.6e-10	38.1
WP_087448885.1\|1791688_1792978_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.0e-44	29.5
WP_087448985.1\|1793709_1794615_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_087448986.1\|1794615_1795512_-	glycosyltransferase family 2 protein	K7Z8A5	Megavirus	5.5e-08	32.1

DBSCAN-SWA_15

1842349 : 1891959

Bacillus_phage(22.22%)

bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157664631.1\|1842349_1842511_-\|bacteriocin	bactofencin A family cationic bacteriocin	NA	NA	NA	NA
WP_003701471.1\|1842611_1843439_-	sugar-phosphatase	NA	NA	NA	NA
WP_034982766.1\|1843560_1844190_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_087449000.1\|1844296_1846081_-	DUF87 domain-containing protein	NA	NA	NA	NA
WP_081513189.1\|1846097_1846829_-	hypothetical protein	NA	NA	NA	NA
WP_087449001.1\|1846948_1848730_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-50	28.2
WP_034982760.1\|1848722_1850456_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-33	26.3
WP_003705682.1\|1850467_1850917_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_087449002.1\|1851114_1852506_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_003701461.1\|1852595_1852796_-	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_087449003.1\|1852901_1853198_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_087449004.1\|1853312_1853747_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_087449005.1\|1853831_1854941_-	iron-containing alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_034982756.1\|1855096_1856239_-	PLP-dependent transferase	A0A0B5JD48	Pandoravirus	1.3e-17	26.4
WP_087449006.1\|1856254_1857172_-	cysteine synthase family protein	C3U2M1	Lactococcus_phage	9.2e-59	40.9
WP_034982754.1\|1857525_1859328_+	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	6.3e-136	43.0
WP_003702035.1\|1859496_1860411_-	EamA family transporter	NA	NA	NA	NA
WP_003707363.1\|1860609_1861170_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_034982753.1\|1861184_1862531_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_003707369.1\|1862707_1863574_-	sugar transporter	NA	NA	NA	NA
WP_034982752.1\|1863693_1864260_-	TetR/AcrR family transcriptional regulator	Q6A200	Oenococcus_phage	8.0e-13	31.2
WP_087449007.1\|1864393_1865617_+	MFS transporter	NA	NA	NA	NA
WP_147781572.1\|1865684_1866587_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.9e-42	38.1
WP_087449009.1\|1866583_1867102_-\|transposase	transposase	A0A1B1P776	Bacillus_phage	3.0e-14	35.2
WP_003708940.1\|1867169_1867883_-	amino acid racemase	NA	NA	NA	NA
WP_034982748.1\|1867892_1869143_-	carboxylate--amine ligase	NA	NA	NA	NA
WP_087449010.1\|1869142_1870675_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_003701440.1\|1870818_1871145_-	hypothetical protein	NA	NA	NA	NA
WP_002323245.1\|1871635_1872808_-\|transposase	IS256-like element IS1542 family transposase	A0A0N9STL0	Staphylococcus_phage	1.3e-121	88.8
WP_087449011.1\|1873006_1874893_+	pyruvate oxidase	A9YVT5	Ostreococcus_tauri_virus	1.2e-09	22.7
WP_044004264.1\|1874953_1875331_-	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_044004262.1\|1876162_1878085_-	asparagine synthase (glutamine-hydrolyzing)	R4TIC1	Phaeocystis_globosa_virus	3.9e-27	27.3
WP_044005558.1\|1878323_1879106_-	M23 family metallopeptidase	A0A7K9	Microcystis_virus	2.6e-06	37.5
WP_044004260.1\|1879333_1880347_-	glycosyltransferase	NA	NA	NA	NA
WP_044004258.1\|1880494_1881358_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	3.2e-21	26.8
WP_044004256.1\|1881444_1882734_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.8e-45	30.0
WP_003701427.1\|1882923_1883160_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_003708930.1\|1883181_1883733_-	single-stranded DNA-binding protein	A8ATZ7	Listeria_phage	1.1e-43	53.8
WP_003703382.1\|1883773_1884064_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_087449012.1\|1884282_1886835_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.2e-111	36.9
WP_044004246.1\|1886871_1888830_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.2e-140	44.7
WP_003705635.1\|1888832_1889972_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003701414.1\|1889971_1890193_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_087448778.1\|1890669_1891959_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.4e-44	29.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP020860

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP020859

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP020858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection