CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021528	Lactiplantibacillus plantarum subsp. plantarum isolate SRCM100434 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,DinG,WYL	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021528_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021528_1

537295-537434

Orphan

Consensus_repeat	Method
CCTGAGCAACCAAGTCAACCAGAAGAACCGGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP021528_1

>merge|NZ_CP021528|1|537295-537434|CRISPRCasFinder
CCGGAAGAACCGGGTCAACCTGAGCAACCAAGTCAACCAGAAGAACCGGGGCACCCTGAGCAACCAAGTCAACCAGAAGAACCGGGGCACCCTGAGCAACCAAGTCAACCAGAAGAGCCGGGTCAACCCGAGCAACCGAG

>NZ_CP021528|1|1|537295-537434|CRISPRCasFinder
CCGGAAGAACCGGGTCAACCTGAGCAACCAAG	TCAACCAGAAGAACCGGGGCAC
CCTGAGCAACCAAGTCAACCAGAAGAACCGGG	GCACCCTGAGCAACCAAGTCAA
CCAGAAGAGCCGGGTCAACCCGAGCAACCGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021528.1\|WP_011102020.1\|545681_547166_+\|glutamate/gamma-aminobutyrate-family-transporter-YjeM	unknown	unknown	gnl\|CDD\|237929
NZ_CP021528.1\|WP_003642323.1\|522907_523951_+\|DUF916-and-DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|371730
NZ_CP021528.1\|WP_003644879.1\|543521_544694_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341467
NZ_CP021528.1\|WP_013355922.1\|524859_525255_+\|iron-sulfur-cluster-biosynthesis-family-protein	unknown	unknown	gnl\|CDD\|366687
NZ_CP021528.1\|WP_087614940.1\|548270_548696_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP021528.1\|WP_003642322.1\|524131_524764_+\|GyrI-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|227169
NZ_CP021528.1\|WP_087614938.1\|525279_526248_+\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176215
NZ_CP021528.1\|WP_011102021.1\|544989_545385_-\|transglycosylase	unknown	unknown	unknown
NZ_CP021528.1\|WP_003642317.1\|528825_529251_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021528.1\|WP_003643384.1\|527733_528798_+\|DUF916-and-DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|368712
NZ_CP021528.1\|WP_003642310.1\|538222_538597_+\|cupredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|226980
NZ_CP021528.1\|WP_003642312.1\|532886_533648_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP021528.1\|WP_047674069.1\|538612_538882_+\|cupredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|379208
NZ_CP021528.1\|WP_003642319.1\|526972_527677_+\|WxL-domain-containing-protein	unknown	unknown	gnl\|CDD\|372694
NZ_CP021528.1\|WP_003642314.1\|532271_532556_+\|TfoX/Sxy-family-protein	unknown	unknown	gnl\|CDD\|377439
NZ_CP021528.1\|WP_187338229.1\|530987_532268_+\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|225827
NZ_CP021528.1\|WP_003642299.1\|548685_548823_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021528.1\|WP_011102019.1\|547292_548114_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP021528.1\|WP_003642307.1\|541169_542291_+\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NZ_CP021528.1\|WP_063721955.1\|538881_540807_+\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783

Protein	Function_ID	Function_description	E-value
NZ_CP021528.1\|WP_003642323.1\|522907_523951_+\|DUF916-and-DUF3324-domain-containing-protein	gnl\|CDD\|371730	pfam11797, DUF3324, Protein of unknown function C-terminal (DUF3324). This family consists of several hypothetical bacterial proteins of unknown function.	2.31756e-50
NZ_CP021528.1\|WP_003644879.1\|543521_544694_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341467	cd08188, PDDH, 1,3-Propanediol (1,3-PD) dehydrogenase. This family includes 1,3-propanediol (1,3-PD) dehydrogenase, a key enzyme in the microbial production of 1,3-PD that has been previously characterized as the product of dhaT gene in Klebsiella pneumoniae. 1,3-PD dehydrogenase is a member of the family III metal-dependent polyol dehydrogenases, which are shown to require a divalent metal ion for catalysis. However, some members of this family showed a dependence on Fe(2+) or Zn(2+) for activity.	0
NZ_CP021528.1\|WP_013355922.1\|524859_525255_+\|iron-sulfur-cluster-biosynthesis-family-protein	gnl\|CDD\|366687	pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis. This family is involved in iron-sulphur cluster biosynthesis. Its members include proteins that are involved in nitrogen fixation such as the HesB and HesB-like proteins.	3.55441e-20
NZ_CP021528.1\|WP_087614940.1\|548270_548696_+\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	0.00024924
NZ_CP021528.1\|WP_003642322.1\|524131_524764_+\|GyrI-like-domain-containing-protein	gnl\|CDD\|227169	COG4832, COG4832, Uncharacterized conserved protein [Function unknown].	5.02222e-59
NZ_CP021528.1\|WP_087614938.1\|525279_526248_+\|zinc-binding-dehydrogenase	gnl\|CDD\|176215	cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.323e-66
NZ_CP021528.1\|WP_011102020.1\|545681_547166_+\|glutamate/gamma-aminobutyrate-family-transporter-YjeM	gnl\|CDD\|237929	PRK15238, PRK15238, inner membrane transporter YjeM; Provisional.	0
NZ_CP021528.1\|WP_003643384.1\|527733_528798_+\|DUF916-and-DUF3324-domain-containing-protein	gnl\|CDD\|368712	pfam06030, DUF916, Bacterial protein of unknown function (DUF916). This family consists of several hypothetical bacterial proteins of unknown function.	1.39383e-47
NZ_CP021528.1\|WP_003642310.1\|538222_538597_+\|cupredoxin-domain-containing-protein	gnl\|CDD\|226980	COG4633, COG4633, Plastocyanin domain containing protein [General function prediction only].	1.52584e-33
NZ_CP021528.1\|WP_003642312.1\|532886_533648_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	5.00029e-17
NZ_CP021528.1\|WP_047674069.1\|538612_538882_+\|cupredoxin-domain-containing-protein	gnl\|CDD\|379208	pfam13473, Cupredoxin_1, Cupredoxin-like domain. The cupredoxin-like fold consists of a beta-sandwich with 7 strands in 2 beta-sheets, which is arranged in a Greek-key beta-barrel.	1.09731e-20
NZ_CP021528.1\|WP_003642319.1\|526972_527677_+\|WxL-domain-containing-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	1.74207e-32
NZ_CP021528.1\|WP_003642314.1\|532271_532556_+\|TfoX/Sxy-family-protein	gnl\|CDD\|377439	pfam04994, TfoX_C, TfoX C-terminal domain. TfoX may play a key role in the development of genetic competence by regulating the expression of late competence-specific genes. This family corresponds to the C-terminal presumed domain of TfoX. The domain is found associated with pfam00383 in Neisseria meningitidis TadA. It is also found as an isolated domain in some proteins suggesting this is an autonomous domain.	1.71819e-21
NZ_CP021528.1\|WP_187338229.1\|530987_532268_+\|GHKL-domain-containing-protein	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	1.22789e-08
NZ_CP021528.1\|WP_011102019.1\|547292_548114_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.44187e-09
NZ_CP021528.1\|WP_003642307.1\|541169_542291_+\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP021528.1\|WP_063721955.1\|538881_540807_+\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0

>NZ_CP021528.1|WP_003642312.1|532886_533648_+|helix-turn-helix-transcriptional-regulator
MGTELQFVQYLHQMRDYNDQHPTTKGLILLGYLERDFIRFYRAGKIEEGIQFAKKNLTRSRDLLNKLSSEEKQLQLSALVDVLAFEGIQNHAEIYEFVKLRNDYHRWLVKLPVTTERYQPLVVQIIRDFAAIAKPNALAYNAHLESTLDVMYYTNAHLHDQLSVKKVLAHVNARCNPESVRRSFSQEMHMSIRDYINAKKIQEAEHMLLATDLTIRAIAAELCFYDAADFSKRFKKETGQTPLEFRQLNTRTD
>NZ_CP021528.1|WP_003642314.1|532271_532556_+|TfoX/Sxy-family-protein
MIMNRKDLNLVALLTTLPNIGPTLAKQLQAVAITTPEQLKSTGSKVAFTAIKKANPHACIQLLYSLQGAIENCAYPQLSPATREDLKQFFRSLL
>NZ_CP021528.1|WP_187338229.1|530987_532268_+|GHKL-domain-containing-protein
MLFLMIGFREYVTWRIAIIWLSLVIITMSLGEVASNLWPQVPLAYFWIIPIVCVTTFMSSRLLYTQWILMLPVAIFLNALKRLVGAIMGVIAKAVAQSASPMLLRQAIGLHSTADINLFLASIMMLPVIIILGMLAHRWLVQVSAADFLQRARVNISDYLLVILFFAIYIIAYVFAMEWSVNAQTYMAIAAIVTFGIIGSYLISNKNSHLNDAQLLLQVSNYNELLSHHNRDLHLFKHDYENILLSMSAFIQNNDMAGLKRYFTTEVMPARVTLNRQSGLSDLSRLDMPTVSGLIYAKYEAANGRNVHLVVTILEKVTLADIPQIKVVRILGNLLDNATDAAARANHQVALTVKNRDAHTTVFSITNQIPTHEAVDLSVIKKSRFTTKPGHLGYGLSSIEQLTTDQLVVNYCIEEGNFIAELIIKH
>NZ_CP021528.1|WP_003642317.1|528825_529251_+|hypothetical-protein
MPNKWWRLILGVMLVLSWAIPVRAATHGRTEISVGFYETEYSADRIIPARVIPDGGHPYVIRPADPGTQGQRNQSERKPIRRQLIIDGWLRGQSRNGQQLPQTSERLVIGSILGGMGLLASVLAGALYRILKRQDGGERNA
>NZ_CP021528.1|WP_003643384.1|527733_528798_+|DUF916-and-DUF3324-domain-containing-protein
MQLLKRIMVIVGTLILGLQVSSVSGLAASSASSSSSKTTQSNDIGFSVAAKIPNNQIDQHNSYFDLKMTRGRQQQIQTTIYNVTNADIKVQTAIHTAYTNGNGIIEYVTPTKSYDPSLKYRMDQITKIQGPTTITIPANGSKVVTATVTMPKQAVNGVILGGWYFKRVANKVTGSVKGSMNIANQYSYVIGLKYTAGIVPQPQLKLDTITVGMQNYRRGVFPQLRNVTAVIVPKLTITARLTSKNSGKVIKNFTQKNVQLAPNSVYKVPILTGTNRLQAGSYHVRLVAKNTDHRWVFDKDFVISTAAADKYNQASVDNSGMSVGWFILFGALGMLIIGLIGLLIFFWIKKRRRA
>NZ_CP021528.1|WP_003642319.1|526972_527677_+|WxL-domain-containing-protein
MKPMLGHLLMAGTLLLAGSTPIVANAAENRSGNTDIKAEFTKSTSTVTPVDPSNPDVPSTDGDGDNGAAAGGDLSLIFVSKSLGYGTHELDVLNDQQYKVDPTSSYTLLWQDKMVVEVSDVRGTNAGWKLTVTGSNLTGTDGTAAKGATLSLPKGDVVNSGSEANGAVATASEVALNGTVGSSAVLNADKGGGSGVTVSRLDPKALTLNIKANTVKAQAYSANLNWTLSDLPTN
>NZ_CP021528.1|WP_087614938.1|525279_526248_+|zinc-binding-dehydrogenase
MKSVIFDDFGSPDVLRIADVQRPVATTATVLVKVMAVAVNHVDTFVRSGAFKTALAAPHVAGRDLVGEVVASSQPDFQIGDQVWTNSMGYEGRMGATAEYVAVPTDRLYHVPDGVAPIPLVAAVHSAATAAIVLNDVMEIRRGQTLLIEGAAGNVGRKLIQLAHQMGVTVVITASPRDFARCQQLGSTACYDYHVGFADQLTTDQWTFDHVIDTSGRVPLAINLALLRLGGQVTLITAPQDNQFEFPVRQFYMSQQRITGFVISHATVDQLAQAASRLNRAFSAGLLLDDQVSQRYFKDAAQCHAQLEAGTDHHQRFVLLPS
>NZ_CP021528.1|WP_013355922.1|524859_525255_+|iron-sulfur-cluster-biosynthesis-family-protein
MTQIEISDRLKALLVAKGFDKKQLVLVTDDGGGKYSLHGGACSIGTKFTIIVLDQPDPEYNVTVVNDQGLALWTSTYDLIFFNDGIKMDYDQGRIAIKDNAHMLDNAVQIAKGAEVLAAFEQGVPADNLTC
>NZ_CP021528.1|WP_003642322.1|524131_524764_+|GyrI-like-domain-containing-protein
MKMKYEWRKQEKTTYATKKQPQLLTIPAQTFMSIHGTGNPNGPEFQTHLQTLYPAAYGLKHAYKQYAQTQACEFDDYVVFPLEGVWSLTIKGQQLDHLDKDEFSYDIMIRVPDFVPNELIAPALAAVKAKKQLPTEQINVQQFDAMQVAQILHLGAYDDEPASFAKIDELVANQGMHRTSKIHREIYLSDARRVAPDKLKTILRYRVASN
>NZ_CP021528.1|WP_003642323.1|522907_523951_+|DUF916-and-DUF3324-domain-containing-protein
MMLTKRWWQLGIGLLVGLVSLSWGRTGSANTVGFEVAPVASKYQIDKAVSYYDLKLKPSQTTTLAVKVTNTSTQEITVHTAIVPATTNPNGVVEYQATADGKNIDLPADASQLITTAANKITLAKGTSKIVTFKVKMPAQKYDGVVVGGLSFLKKAAKQQSKSAMAIKNQYAYSVAVVLHGDHALTKNKLTLGKIDATQNNGYNQISLPLQNRTAAFLNQVKTDVQIYRRGSNKVRYKQVNEHGQMAPNSVYALPLRVGRDALKPGQYTAKLAVKSKKQHWTFTKDFEITRDRANQLNKTAVIEHHTNWGLWISLGLLVILLLLIAWYIHRKQLKIKRLEERLKDKS
>NZ_CP021528.1|WP_003642310.1|538222_538597_+|cupredoxin-domain-containing-protein
MMIKVLVLLIGGLAIGFILWWFFGKHATTTVTASAVDDLQQVDVEVKGGYSPEQIVLKKGVPAVLNFTRKDASGCLDHVVFSDFGINQELPQNQVEAITIDTSKSGEYQWACGMDMFHGKLIIK
>NZ_CP021528.1|WP_047674069.1|538612_538882_+|cupredoxin-domain-containing-protein
MSARQQIKITVDGHYDPAEVTLQQGVPAQLTFTRTSTQGCLEQVHSTDLHFTTELPLDQPQTVTVPTDQAGEFHFSCGMDMVSGKVVIA
>NZ_CP021528.1|WP_063721955.1|538881_540807_+|copper-translocating-P-type-ATPase
MSTTKRFWISLIFSLPLLANMILMPFGWMLPGGDWTQLILTTIIMAVSARPFLQSAWASFTKHHANMDTLVAIGTATAYFYSLYAMATGQAVFFESAALVTTFVLLGQVFEERMRHNASSAVAKLVGLQAKEAEVLRDQEFVKVPLDQVVVGDIIRVKPGEKIPVDGVITTGRSTVDESMVTGESMPVQKTVADAVIGSTINSNGTFQFKASKVGDQTMLAQIVELVKKAQNSHAPIQKLTDKVSDIFVPIVLIIAIVTFLTWYVFLNASLANALIFAVAVVVIACPCALGLATPTALMVGTGRGAKMGILIKNGEVLEAVNDVKTVIFDKTGTITVGHPQVTDVIGDEARVLRVATSLEAASEHPLAAAILKRGTARGIQAPTATNFQAIEGKGVTAQVEGQLAVVGNHKLLTDEPISAELQRQATELQDAAKTVVYVGLNHEIIGLIAIQDVAKSTSEAAIASLKARGLKTVMLTGDNERVAQAVADQVGIDEVIADVLPGDKAEHVHAFQKAGKVAFVGDGINDAPALTTADVGIAMGSGTDIAIDAGGIVLVKNDLRDVDRALALSKKTFNRIKLNLFWAFVYNVLGIPVAAGLFFAIGLTLSPELAGLAMAFSSLSVVTSSVLLNKAKISSNAQPA
>NZ_CP021528.1|WP_003642307.1|541169_542291_+|NAD(P)-dependent-alcohol-dehydrogenase
MKIKAAVVDKVNDPFVIKDDIELAEMKATDLQIKMVATGICHSDEAIRRGDASLGYPVILGHEGSGIVEKVGSEVTNFEVGDHVILSFYADGTCDNCLKGMPTKCRNYADYNLSGTRPDGSDHFQENGHHISDMFDQSSFTTHTVVDQRNAVKVPKELDLRRLGPLGCGYVTGSGTVLNSLQPRPGQTIAVFGTGAVGLAAMMAGKISGCTEVIAVDIVDSRLELAKELGATHAINSKEEDPVEAIKKLTHGYGVDFAVDTTGVEPVMVSAIHALAQGGTAALIAVTAKNITISSWNDLCVDDKKVIGVNMGDAIPGVDIPRLIDFYQHGMFPFEKTEKFYKFEDINQANADSGSGKTIKPVLIIDEDYQPGK
>NZ_CP021528.1|WP_003644879.1|543521_544694_-|iron-containing-alcohol-dehydrogenase
MTERNFDFLMPSVNFFGPGVISKIGERAKTLGMHKPVIVTDKFLESLPDGAVAQVRRSLDAAGIDYVIYNQVEPNPKIHNIQAVKALYQANQADSLITIGGGSAHDTGKGAGIIMTNGDDITKLAGIETLKNALPPLIAVNTTAGTGSELTRHCVITNEETHYKFVVASWRNMPLVSFNDPTLMLDVPKGLTAATGMDAFVQAIEPFVSVDHNPITDSQCIQAIKLIETSLREAVANGHNLEARTHMVEAEMLAGMAFNNANLGYVHAMAHQLGGQYDAPHGVCCALLLPYVEEYNLIACPERFAELAKIMGENTDGLSTRDAAELAIKAMKQLSEDVGIPHSIKEIGAKIEDFEHMATNALKDGNAFSNPRKGTKEDIIKIFQAAYDAK
>NZ_CP021528.1|WP_011102021.1|544989_545385_-|transglycosylase
MKKFNFKTMLLLVLASCVFGVVVNVTTSLGPQTAITAQASKKLSQAQQIAKINAKLSKANRAAKNWIAYRESGYSYTARNGRCYGRYQLLRSYLHGNLSPVNQEKRANTYVASRYGSWVKAKRFWQHHHWY
>NZ_CP021528.1|WP_011102020.1|545681_547166_+|glutamate/gamma-aminobutyrate-family-transporter-YjeM
MATKDNEKITLMALVMMIFTTVFGFANSTVAYYLMGYSSILFYLVAAVLFFIPFALMMAEFGAAVKSDSSGMYKWLEVSVNAKFAFVGTFMWFASYIIWLVSTSAKVWIPFTTIFFGSDQTQRFAMFGLNATQMIGILSCLWMVLVTFVSIKGMKGIVRVTSLGGLAVTSLTAILLVVSGVVLALNHGQFAQPLQHVMTSPNPSYQHPVGLLGFAVFAIFAYGGLEVLGGMVDKTKNPEKTFPRGIIISAIVITLGYGLGIFCWGISTNWQAVLSNPTTNLGNISYVMMQNLGYVLGQALGLSTAAAKTMGLWFARYTGLGMFLAYSGAFFTLTYSPLKTLILGTPKELWPKKFTKLNKAGMPSYAMMVQCAIVIVIILVASFATADASAFYNVLTLMANVSMTLPYLFLLYAFPKFKENQNIVKPFEVYKSLTWTKIISWVVFIVVLGANVFTLIQPILETGQIQNTIWMLVGPIVFGVAGIIWYQVRERHVN
>NZ_CP021528.1|WP_011102019.1|547292_548114_+|helix-turn-helix-transcriptional-regulator
MTLGTALKQARKAQQLNQKQAARGICAQSMLSAIENDRYVPNARLLLALCQRLGVAVSTLSLADDFEISAEQAFNDRVRQMCNAHQYQQLKDWLLQPTTLEHVQTDEQTQAYYYYLGVACWQVDRTSDAAQQNLRLAIGMAAPSSPPTTLTRLALISLAVVKAHHHPQAPVAALVTRALADIDAGAYEENANIVFYLAGLVAYEQHDSQLAVARLTQGLAFATTHDSHYMLANIYQLMAQLAMAAGETATAQVASQRSQVFKDLFKEQINDRL
>NZ_CP021528.1|WP_087614940.1|548270_548696_+|SRPBCC-family-protein
MTTALFTNQVLTQATPATVRALLADPLNLPAWATAITTVKPTATGYVLQRSGSVFDQPEQLQVTVGADQVVYHGEGGQLGYEIVFTMTPLAERTAVQEEVSLTTTPPSWLPLPLVKPVMQRDFQRKLGQLATLAEEQPNDD
>NZ_CP021528.1|WP_003642299.1|548685_548823_+|hypothetical-protein
MTINDGMTLIKVLVTWWSVSWLLRATLIGVVGIIAYRFLKQRQFK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

825559 : 834070

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645861.1\|825559_826042_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_046811071.1\|826025_827156_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|827158_827890_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|827891_828146_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|828145_828826_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_087614978.1\|828818_831038_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.9e-144	39.3
WP_003642591.1\|831022_832477_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_027821845.1\|832473_833499_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.3e-60	41.3
WP_003645867.1\|833491_834070_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_2

1321067 : 1408232

Lactobacillus_phage(79.07%)

transposase,head,protease,integrase,tRNA,tail,holin,terminase

attL 1313867:1313884|attR 1382646:1382663

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1313867:1313884	attL	NA	NA	NA	NA
WP_072534013.1\|1321067_1321343_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_013355652.1\|1321684_1322875_+	NUDIX hydrolase	NA	NA	NA	NA
WP_087615009.1\|1323192_1324356_-\|integrase	site-specific integrase	E9LUK6	Lactobacillus_phage	1.0e-62	37.4
WP_003641356.1\|1324524_1324839_-	hypothetical protein	NA	NA	NA	NA
WP_087615012.1\|1325944_1326163_-	hypothetical protein	NA	NA	NA	NA
WP_087615013.1\|1326165_1326900_-	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	7.4e-43	54.5
WP_157664744.1\|1326930_1327428_-	toxin	A0A0A7RTX7	Clostridium_phage	7.8e-12	31.9
WP_087615015.1\|1327443_1327878_-	helix-turn-helix transcriptional regulator	Q6J1W4	Lactobacillus_phage	2.7e-29	65.0
WP_087615016.1\|1328040_1328289_+	helix-turn-helix transcriptional regulator	A0A0P0IX93	Lactobacillus_phage	7.3e-19	65.7
WP_087615017.1\|1328289_1329075_+	phage antirepressor KilAC domain-containing protein	E9LUT0	Lactobacillus_phage	3.0e-58	97.3
WP_087615018.1\|1329180_1329534_-	hypothetical protein	NA	NA	NA	NA
WP_157664745.1\|1329601_1329805_+	hypothetical protein	NA	NA	NA	NA
WP_087615019.1\|1329770_1330214_-	hypothetical protein	NA	NA	NA	NA
WP_087615020.1\|1330624_1330885_+	hypothetical protein	NA	NA	NA	NA
WP_087615021.1\|1331027_1331282_+	hypothetical protein	NA	NA	NA	NA
WP_171785845.1\|1331284_1331449_+	hypothetical protein	E9LUT8	Lactobacillus_phage	1.9e-15	80.8
WP_187330256.1\|1331451_1331598_+	hypothetical protein	E9LUT9	Lactobacillus_phage	1.2e-16	93.8
WP_033614714.1\|1331597_1332131_+	host-nuclease inhibitor Gam family protein	E9LUU0	Lactobacillus_phage	1.1e-91	98.3
WP_087615022.1\|1332139_1332802_+	AAA family ATPase	E9LUU1	Lactobacillus_phage	4.4e-119	97.7
WP_087615023.1\|1332803_1333463_+	DUF669 domain-containing protein	O03912	Lactobacillus_phage	2.6e-95	80.8
WP_087615024.1\|1333509_1334202_+	hypothetical protein	E9LUU3	Lactobacillus_phage	2.0e-130	97.8
WP_157664746.1\|1334243_1335080_+	helix-turn-helix domain-containing protein	U5U793	Lactobacillus_phage	2.5e-39	42.6
WP_003644539.1\|1335083_1335392_+	hypothetical protein	E9LUN7	Lactobacillus_phage	2.7e-47	92.2
WP_087615026.1\|1335666_1336098_+	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.3e-71	90.2
WP_087615027.1\|1336408_1337383_+	hypothetical protein	NA	NA	NA	NA
WP_087615028.1\|1337394_1337961_+	hypothetical protein	NA	NA	NA	NA
WP_087615029.1\|1338135_1338882_+	hypothetical protein	NA	NA	NA	NA
WP_087615030.1\|1339174_1339354_+	hypothetical protein	E9LUP6	Lactobacillus_phage	1.6e-15	72.9
WP_087615031.1\|1339364_1339835_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.4e-87	98.7
WP_085776089.1\|1340053_1340509_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	6.1e-80	97.4
WP_087615032.1\|1340518_1342417_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	93.7
WP_065124208.1\|1342406_1342601_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	6.3e-26	93.8
WP_087615033.1\|1345792_1346125_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	4.2e-46	86.4
WP_087615034.1\|1346114_1346462_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	2.0e-43	72.2
WP_087615035.1\|1346464_1346872_+	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	3.2e-64	91.5
WP_087615036.1\|1346871_1347252_+	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.0e-59	90.5
WP_085764053.1\|1347268_1347922_+\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	5.4e-114	95.4
WP_087615037.1\|1347994_1348369_+\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	3.2e-58	96.0
WP_003644519.1\|1348407_1348599_+	hypothetical protein	NA	NA	NA	NA
WP_087615038.1\|1348630_1353379_+	C40 family peptidase	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	62.3
WP_087615039.1\|1353453_1355223_+\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	0.0e+00	94.0
WP_087615040.1\|1355292_1357662_+\|tail	phage tail protein	E9LUR3	Lactobacillus_phage	0.0e+00	96.8
WP_087615041.1\|1357678_1360468_+\|tail	phage tail protein	E9LUR4	Lactobacillus_phage	0.0e+00	98.8
WP_087615042.1\|1360460_1360712_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	2.1e-29	95.8
WP_187338226.1\|1360715_1360877_+	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	1.5e-17	90.6
WP_187338227.1\|1361372_1361879_+	hypothetical protein	Q597U5	Lactobacillus_virus	3.5e-52	67.1
WP_087615043.1\|1361890_1363063_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	6.4e-198	92.1
WP_087615044.1\|1363062_1363326_+	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	7.4e-38	97.7
WP_187338228.1\|1363337_1363718_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	4.9e-14	61.2
WP_003644508.1\|1364457_1365669_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_087615045.1\|1366147_1367890_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003645638.1\|1367908_1368700_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_003644505.1\|1368680_1369865_+	LCP family protein	NA	NA	NA	NA
WP_063722578.1\|1370016_1370589_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644504.1\|1371340_1372282_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_003644503.1\|1372726_1373119_-	hypothetical protein	NA	NA	NA	NA
WP_003640750.1\|1373282_1373675_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1373710_1374880_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003644502.1\|1374929_1375559_-	hypothetical protein	NA	NA	NA	NA
WP_157262971.1\|1375932_1376025_+	DNA alkylation repair protein	NA	NA	NA	NA
WP_003640747.1\|1376113_1376746_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644501.1\|1376897_1377137_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640745.1\|1377234_1377471_+	YneF family protein	NA	NA	NA	NA
WP_003645630.1\|1377527_1378163_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003644499.1\|1378274_1379033_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003640742.1\|1379016_1379322_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003640741.1\|1379406_1380405_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640740.1\|1380693_1381416_-	HAD family hydrolase	NA	NA	NA	NA
WP_003640739.1\|1381640_1382444_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_063487838.1\|1382546_1383425_+	elongation factor Ts	NA	NA	NA	NA
1382646:1382663	attR	NA	NA	NA	NA
WP_003640737.1\|1383624_1384347_+	UMP kinase	NA	NA	NA	NA
WP_003640736.1\|1384348_1384912_+	ribosome recycling factor	NA	NA	NA	NA
WP_003640735.1\|1385031_1385811_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
WP_003640734.1\|1385826_1386612_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003640733.1\|1386649_1387927_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640732.1\|1387966_1389676_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_003640729.1\|1390169_1394483_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640728.1\|1394778_1395255_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640727.1\|1395275_1396493_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640726.1\|1396537_1396837_+	YlxR family protein	NA	NA	NA	NA
WP_003640725.1\|1396826_1397132_+	ribosomal L7Ae/L30e/S12e/Gadd45 family protein	NA	NA	NA	NA
WP_046947639.1\|1397146_1399711_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_003640723.1\|1399733_1400087_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_021356198.1\|1400735_1402190_+	MFS transporter	NA	NA	NA	NA
WP_003644493.1\|1402182_1403352_+	chorismate synthase	NA	NA	NA	NA
WP_003644492.1\|1403360_1403888_+	amino acid biosynthesis protein	NA	NA	NA	NA
WP_024521658.1\|1403901_1405200_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_025015627.1\|1405202_1406300_+	prephenate dehydrogenase	NA	NA	NA	NA
WP_003640717.1\|1406302_1406824_+	shikimate kinase	NA	NA	NA	NA
WP_003640716.1\|1407308_1408232_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_3

1926482 : 1935500

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087615111.1\|1926482_1926722_-	hypothetical protein	A0A2P0ZL95	Lactobacillus_phage	5.3e-35	98.6
WP_052098033.1\|1926696_1927164_-	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	6.1e-83	99.4
WP_003643094.1\|1927508_1927949_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643095.1\|1928019_1928580_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_063720948.1\|1928667_1931106_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_003643097.1\|1931108_1931723_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_027822909.1\|1932066_1933014_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
WP_033608586.1\|1933199_1934171_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	5.9e-181	98.5
WP_033608585.1\|1934261_1935500_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	99.0

DBSCAN-SWA_4

2614073 : 2622709

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643943.1\|2614073_2615069_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.2
WP_003640969.1\|2615207_2615993_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_087615183.1\|2615996_2616893_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.7e-81	55.7
WP_003640967.1\|2616991_2617339_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|2617363_2618383_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|2618399_2618729_-	cyclic-di-AMP receptor	NA	NA	NA	NA
WP_011101140.1\|2618725_2619391_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|2619788_2620040_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|2620054_2620654_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|2620669_2620978_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_065080432.1\|2620999_2622709_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	4.0e-55	37.0

DBSCAN-SWA_5

2756260 : 2876457

112

uncultured_Mediterranean_phage(18.18%)

protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053566451.1\|2756260_2757532_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-96	43.7
WP_003642042.1\|2757999_2759613_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|2759785_2760394_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|2760438_2760879_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_074161854.1\|2761241_2762174_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_187338230.1\|2762182_2763541_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|2763560_2764370_+	sugar-phosphatase	NA	NA	NA	NA
WP_053267165.1\|2764539_2765526_-	hypothetical protein	NA	NA	NA	NA
WP_003642034.1\|2765608_2766631_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|2766919_2767900_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_063204071.1\|2768265_2769090_-	serine hydrolase	NA	NA	NA	NA
WP_063204070.1\|2769325_2770708_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|2770776_2771613_-	pur operon repressor	NA	NA	NA	NA
WP_003646500.1\|2771969_2772767_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|2772759_2773458_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_087615192.1\|2773726_2774671_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|2774980_2775847_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|2775979_2776231_-	Veg family protein	NA	NA	NA	NA
WP_087615193.1\|2776335_2777226_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|2777222_2777786_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|2777772_2778549_-	TatD family hydrolase	NA	NA	NA	NA
WP_063722869.1\|2778800_2779289_-	hypothetical protein	NA	NA	NA	NA
WP_087615194.1\|2779309_2779942_-	hypothetical protein	NA	NA	NA	NA
WP_087615195.1\|2779925_2783606_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_087615196.1\|2783808_2784699_+	transcriptional regulator	NA	NA	NA	NA
WP_087615197.1\|2784732_2785917_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_087615198.1\|2786148_2788200_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	3.5e-90	35.8
WP_011101012.1\|2788521_2788911_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|2789507_2790350_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|2790349_2791054_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|2791075_2792035_-	hypothetical protein	NA	NA	NA	NA
WP_085764312.1\|2792027_2793302_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|2793347_2794265_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_060684284.1\|2794433_2795228_-	hypothetical protein	NA	NA	NA	NA
WP_047672680.1\|2795232_2796366_-	hypothetical protein	NA	NA	NA	NA
WP_085764311.1\|2796820_2797834_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|2797946_2798693_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_080333740.1\|2798842_2799739_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|2799859_2801296_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_045352050.1\|2801313_2802666_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|2802888_2803311_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|2803300_2803489_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|2803495_2804857_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|2804929_2805640_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_087615199.1\|2806045_2807062_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_065080246.1\|2807501_2808278_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_065080247.1\|2808536_2810846_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_065080248.1\|2810940_2811144_-	hypothetical protein	NA	NA	NA	NA
WP_087615200.1\|2811281_2811968_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_053566440.1\|2812061_2812742_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|2812828_2813497_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_062688864.1\|2813563_2814253_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_087615201.1\|2814342_2815719_-	HlyD family secretion protein	NA	NA	NA	NA
WP_063721087.1\|2815734_2817885_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|2818151_2818322_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_021356667.1\|2818346_2818505_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_021356666.1\|2818603_2819377_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063204018.1\|2819670_2820414_-	response regulator transcription factor	NA	NA	NA	NA
WP_021356665.1\|2820532_2821276_-	response regulator transcription factor	NA	NA	NA	NA
WP_021356664.1\|2821276_2822605_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_003641979.1\|2822795_2822942_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641977.1\|2823819_2824566_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_061871501.1\|2824596_2825796_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641975.1\|2825913_2826081_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641974.1\|2826208_2826409_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_087615202.1\|2827270_2827438_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|2827468_2827642_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641971.1\|2827638_2828307_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641969.1\|2828718_2828922_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|2829306_2830491_-	cation:proton antiporter	NA	NA	NA	NA
WP_011100994.1\|2830535_2831912_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_087615203.1\|2832437_2833253_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641965.1\|2833412_2834285_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011100993.1\|2834355_2835147_+	HAD family hydrolase	NA	NA	NA	NA
WP_003641963.1\|2835150_2836305_+	MFS transporter	NA	NA	NA	NA
WP_015379760.1\|2836308_2836926_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_076655680.1\|2837204_2837678_-	hypothetical protein	NA	NA	NA	NA
WP_003643792.1\|2837959_2838379_-	hypothetical protein	NA	NA	NA	NA
WP_053566430.1\|2838507_2838741_-	hypothetical protein	NA	NA	NA	NA
WP_050495849.1\|2838998_2839199_-	hypothetical protein	NA	NA	NA	NA
WP_033608294.1\|2839580_2839853_-	hypothetical protein	NA	NA	NA	NA
WP_087615204.1\|2841536_2841929_-	hypothetical protein	NA	NA	NA	NA
WP_087615205.1\|2842931_2843186_-	hypothetical protein	NA	NA	NA	NA
WP_060599145.1\|2843388_2843661_-	hypothetical protein	NA	NA	NA	NA
WP_087615207.1\|2844191_2844467_-	hypothetical protein	NA	NA	NA	NA
WP_053267430.1\|2845738_2846146_-	immunity 63 family protein	NA	NA	NA	NA
WP_080373188.1\|2846156_2846309_-	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_087615208.1\|2846370_2846685_-	hypothetical protein	NA	NA	NA	NA
WP_072534268.1\|2847928_2848207_-	hypothetical protein	NA	NA	NA	NA
WP_047672638.1\|2848623_2848932_-	hypothetical protein	NA	NA	NA	NA
WP_157664749.1\|2850002_2850209_-	hypothetical protein	NA	NA	NA	NA
WP_087615209.1\|2850462_2850819_-	hypothetical protein	NA	NA	NA	NA
WP_087615210.1\|2850824_2852714_-	pre-toxin TG domain-containing protein	NA	NA	NA	NA
WP_087615211.1\|2852715_2856399_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_003641945.1\|2856985_2857708_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003641944.1\|2857722_2859552_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643773.1\|2859566_2861084_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_024971425.1\|2861549_2862881_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|2862958_2863930_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003641940.1\|2863930_2865457_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641939.1\|2865694_2866141_+	hypothetical protein	NA	NA	NA	NA
WP_024971424.1\|2867030_2867942_-	oxidoreductase	NA	NA	NA	NA
WP_025015650.1\|2868078_2868999_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003641936.1\|2869164_2869737_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003641935.1\|2869840_2870296_-	hypothetical protein	NA	NA	NA	NA
WP_003641934.1\|2870314_2870785_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_087615212.1\|2870894_2872091_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|2872121_2872631_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|2872743_2873112_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641930.1\|2873376_2874882_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_011100974.1\|2875031_2875700_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003643762.1\|2875893_2876457_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage