CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016175	Streptococcus suis strain LSM102, complete genome	2 crisprs	PrimPol,DinG,csa3,cas3,DEDDh	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016175_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016175_1

1702477-1702621

Orphan

Consensus_repeat	Method
GTCCACTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016175_1

>merge|NZ_CP016175|1|1702477-1702621|CRISPRCasFinder
GTCCACTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAGCTAAAAAGACCCGTCGGGGTCTCAATTCGCTTTCTTATTTTCATGCTCATGAAAAAACAGTCCATTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG

>NZ_CP016175|1|1|1702477-1702621|CRISPRCasFinder
GTCCACTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG	CTAAAAAGACCCGTCGGGGTCTCAATTCGCTTTCTTATTTTCATGCTCATGAAAAAACA
GTCCATTCTCGCCGTTGCGCCTTTCCAGTTTCTTGGGCGCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016175.1\|WP_002942409.1\|1702919_1703414_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|180915
NZ_CP016175.1\|WP_012027739.1\|1707798_1709559_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|273568
NZ_CP016175.1\|WP_002942403.1\|1703425_1703716_-\|30S-ribosomal-protein-S6	unknown	unknown	gnl\|CDD\|179034
NZ_CP016175.1\|WP_012027737.1\|1705437_1706427_-\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920
NZ_CP016175.1\|WP_012027738.1\|1706556_1707747_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016175.1\|WP_012027732.1\|1697312_1700138_-\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|234734
NZ_CP016175.1\|WP_002942393.1\|1711561_1712557_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP016175.1\|WP_002942446.1\|1695111_1695504_-\|Asp23/Gls24-family-envelope-stress-response-protein	unknown	unknown	gnl\|CDD\|377129
NZ_CP016175.1\|WP_011922710.1\|1703955_1705119_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP016175.1\|WP_002939250.1\|1702647_1702887_-\|30S-ribosomal-protein-S18	unknown	unknown	gnl\|CDD\|178997
NZ_CP016175.1\|WP_012027724.1\|1693657_1694623_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NZ_CP016175.1\|WP_087892732.1\|1709832_1711221_-\|dihydrolipoamide-acetyltransferase	unknown	unknown	gnl\|CDD\|237001
NZ_CP016175.1\|WP_012027735.1\|1701601_1702258_+\|DUF1129-domain-containing-protein	unknown	unknown	gnl\|CDD\|368981
NZ_CP016175.1\|WP_012775324.1\|1696152_1697214_-\|aminopeptidase-P-family-protein	unknown	unknown	gnl\|CDD\|223085
NZ_CP016175.1\|WP_012775325.1\|1712843_1713812_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NZ_CP016175.1\|WP_012027722.1\|1690139_1692017_-\|PTS-sugar-transporter-subunit-IIBCA	unknown	unknown	gnl\|CDD\|131051
NZ_CP016175.1\|WP_002938276.1\|1694702_1695122_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
NZ_CP016175.1\|WP_012775323.1\|1695531_1696089_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NZ_CP016175.1\|WP_087892731.1\|1692222_1693677_+\|sucrose-6-phosphate-hydrolase	unknown	unknown	gnl\|CDD\|273554
NZ_CP016175.1\|WP_002939248.1\|1700641_1701586_+\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361

Protein	Function_ID	Function_description	E-value
NZ_CP016175.1\|WP_002942409.1\|1702919_1703414_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|180915	PRK07275, PRK07275, single-stranded DNA-binding protein; Provisional.	1.03536e-102
NZ_CP016175.1\|WP_012027739.1\|1707798_1709559_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|273568	TIGR01350, Dihydrolipoyl_dehydrogenase, dihydrolipoamide dehydrogenase. This model describes dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways. It is the E3 component of dehydrogenase complexes for pyruvate, 2-oxoglutarate, 2-oxoisovalerate, and acetoin. It can also serve as the L protein of the glycine cleavage system. This family includes a few members known to have distinct functions (ferric leghemoglobin reductase and NADH:ferredoxin oxidoreductase) but that may be predicted by homology to act as dihydrolipoamide dehydrogenase as well. The motif GGXCXXXGCXP near the N-terminus contains a redox-active disulfide.	0
NZ_CP016175.1\|WP_002942403.1\|1703425_1703716_-\|30S-ribosomal-protein-S6	gnl\|CDD\|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	1.41522e-37
NZ_CP016175.1\|WP_012027737.1\|1705437_1706427_-\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	1.69881e-103
NZ_CP016175.1\|WP_012027732.1\|1697312_1700138_-\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|234734	PRK00349, uvrA, excinuclease ABC subunit UvrA.	0
NZ_CP016175.1\|WP_002942393.1\|1711561_1712557_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	1.50604e-179
NZ_CP016175.1\|WP_002942446.1\|1695111_1695504_-\|Asp23/Gls24-family-envelope-stress-response-protein	gnl\|CDD\|377129	pfam03780, Asp23, Asp23 family, cell envelope-related function. The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.	1.25433e-34
NZ_CP016175.1\|WP_011922710.1\|1703955_1705119_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.6445e-28
NZ_CP016175.1\|WP_002939250.1\|1702647_1702887_-\|30S-ribosomal-protein-S18	gnl\|CDD\|178997	PRK00391, rpsR, 30S ribosomal protein S18; Reviewed.	6.68341e-38
NZ_CP016175.1\|WP_012027724.1\|1693657_1694623_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	1.99878e-103
NZ_CP016175.1\|WP_087892732.1\|1709832_1711221_-\|dihydrolipoamide-acetyltransferase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	7.75345e-162
NZ_CP016175.1\|WP_012027735.1\|1701601_1702258_+\|DUF1129-domain-containing-protein	gnl\|CDD\|368981	pfam06570, DUF1129, Protein of unknown function (DUF1129). This family consists of several hypothetical bacterial proteins of unknown function.	2.99466e-85
NZ_CP016175.1\|WP_012775324.1\|1696152_1697214_-\|aminopeptidase-P-family-protein	gnl\|CDD\|223085	COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism].	5.90797e-112
NZ_CP016175.1\|WP_012775325.1\|1712843_1713812_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	7.20442e-147
NZ_CP016175.1\|WP_012027722.1\|1690139_1692017_-\|PTS-sugar-transporter-subunit-IIBCA	gnl\|CDD\|131051	TIGR01996, Includes:_Phosphotransferase_enzyme_IIB_component, PTS system, sucrose-specific IIBC component. This model represents the fused enzyme II B and C components of the sucrose-specific PTS sugar transporter system. Sucrose is converted to sucrose-6-phosphate in the process of translocation into the cell. Some of these transporters lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). The exceptions to this rule are Staphylococci, Streptococci, Lactococci, Lactobacilli, etc. which contain their own A domain as a C-terminal fusion. This family is closely related to the trehalose transporting PTS IIBC enzymes and the B and C domains of each are described by subfamily-domain level TIGRFAMs models (TIGR00826 and TIGR00852, respectively).	0
NZ_CP016175.1\|WP_002938276.1\|1694702_1695122_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	6.30967e-49
NZ_CP016175.1\|WP_012775323.1\|1695531_1696089_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	1.37279e-91
NZ_CP016175.1\|WP_087892731.1\|1692222_1693677_+\|sucrose-6-phosphate-hydrolase	gnl\|CDD\|273554	TIGR01322, Sucrose-6-phosphate_hydrolase, sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP016175.1\|WP_002939248.1\|1700641_1701586_+\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.46201e-115

>NZ_CP016175.1|WP_012027735.1|1701601_1702258_+|DUF1129-domain-containing-protein
MSFTEINGLTKKNQEFIHIATNQLIKDGKSDSEIKELLEEILPTIIEKQKTGVTARNLYGAPSEWAASKTISEQEKKDQVEYNENPWLMWLDSSLFMLAIIAGINGLMNLFGQGAQYGLLTLFVIGFGVGAGMYLMYHFVYREQIKTGQRPKLLKAIAFLGLATLAWSVVFILAALIPAAFNPVLPPLVTILIGAAAFGARYLLKKKYNIRNAMSPVQ
>NZ_CP016175.1|WP_002939248.1|1700641_1701586_+|magnesium-transporter-CorA-family-protein
MKQIFLSTMTDLEEIQTFEPGAWINLVNPSQSESMEVAEHYKIDIADLRAPLDAEESSRITVEDDYTLILVDVPILEERNNKTYYITIPLGIILTDDAIITTCLEPLPLFEQFIHRRLRNFFTFMKSRFVFQILYRNAQLYLSALRTIDRKSEEIEKQLHEATRNEELIVLMELEKTIVYFKASLKTNERLVKKLASSSRLLRKYEEDEDLLEDTLVETQQAIEMADIYGSILNSMTHAFASIISNNQNTIMKTLALVTIVLSIPTMVFSAYGMNFKDNIIPFNDIPYAFWWIILFAFAISLSLTFYFIRKRWF
>NZ_CP016175.1|WP_012027732.1|1697312_1700138_-|excinuclease-ABC-subunit-UvrA
MQENIVIHGARAHNLKNIDVTIPREKLVVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLGNMDKPDVDSIEGLSPAISIDQKTTSRNPRSTVGTATEINDYLRLLYARVGVPYCINGHGAIAASSVEQIVDEVLELPERQRLQILAPIVRKKKGQHKTIFEKIQKDGYVRVRVNGGVYDVSEVPELSKSKAHNIEVVVDRIVIKDGIRSRLFDSIEAALRIADGYVIIDTMDEKEMLFSEYYACPVCGFTVPELEPRLFSFNAPFGSCSDCDGLGMKLEVDTDLIVPDASKTLREGALAPWNPISSNYYPQMLEQAMNHFGVDMDKPFEELTEEEKNLIFNGSDGKEFHFHYENEFGGVRDIDIPFEGLITNINRRYRETNSDYTRTVMKTYMNELTCGTCHGYRLNDQALSVKVGGEQGLHIGQLSDLSVADHLQVIEHLTLSENEATIATPIVKEIKDRLSFLNNVGLNYLTLSRAAGTLSGGESQRIRLATQIGSNLSGVLYILDEPSIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADWLIDIGPGAGVFGGEIVASGTPAQVAKNKKSITGQYLSGKREIPVPLERRVGNGRFLEVTGAKENNLQDVTVRFPLGKFVAVTGVSGSGKSTLVNSILKKAIAQKLNRNSDKPGKFKSISGIEHLDRLIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEMHFLPDVFVPCEVCHGHRYNSETLEVHYKEKNIAQVLDMTVNDAVEFFKHIPKIERKLRTIQDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSLYILDEPTTGLHTEDIAQLLKVLARFVDDGNTVLVIEHNLDVIKTADHIIDMGPEGGVGGGTVVATGTPEEVAENPASFTGQYLKMKLK
>NZ_CP016175.1|WP_012775324.1|1696152_1697214_-|aminopeptidase-P-family-protein
MQKRLEKFEAKLAQSTVDGILVTGQNNIYYLTGFWGTEATVFISGKRRLFVTDSRYTLIAKASVKGFDIIESRFALEEIAKVIKEDGLEKIGFDSEVTYGFYQSLTSIFEGYQLVAMSNFIEDLRMIKDEKEIATIRRACQISDQAFIDVLDFIKPGQTTEMDVNHFLDHRMRQLGAEGASFEFIVASGYRSAMPHGRASEKVIQSGETLTLDFGCYYQHYVSDMTRTIHIGHVTDQEREIYDVVLRANKALIEQAKEGVTYREFDAIPREIISAAGYGANFTHGIGHGIGLDIHEYPYFGKSDETIKAGMVLTDEPGIYLDDKYGVRIEDDLLITENGCEVLTLAPKELIVI
>NZ_CP016175.1|WP_012775323.1|1695531_1696089_-|elongation-factor-P
MIEASKLRAGMTFEAEGKLIKVLDASHHKPGKGNTIMRMKLRDVRTGSTFDTTYRPDEKFEQAIIETVPAQYLYQMDDTAYFMNTETYDQYEIPVATIKEELLYILENSEVKIQFYGTEVIGVTVPTTVELVVAETQPSIKGATVTGSGKPATMETGLVVNVPDFIEAGQKLVINTAEGTYVSRA
>NZ_CP016175.1|WP_002942446.1|1695111_1695504_-|Asp23/Gls24-family-envelope-stress-response-protein
MTTEYQGEIVIAPRVLEVITGIAAAKVDGVHSLQNKRVADSWSKTSLNKGVYLETDEEGRVTADIYVYLEYGVNVPAVSMDIQRAVKTAVYNYAEVQVAAVNIHVSGIVPDKTPKPALKDLFGEDFLDEE
>NZ_CP016175.1|WP_002938276.1|1694702_1695122_-|transcription-antitermination-factor-NusB
MKNNRHALRKCALQAIVSLEFGQEPVQAAQFSYLYDREEEQEGVEIPLFLLNLVNGVADYRDDLDKELSSRLKAGWTLDRLTLIDKNIMRLGLFEILHFEETPDRVAVNEAIELAKEFSDESSAKFVNGVLSQFIKEEA
>NZ_CP016175.1|WP_012027724.1|1693657_1694623_+|LacI-family-transcriptional-regulator
MVAKLTDVAQLAGVSPTTVSRVINKKGYLSEKTIRNVEEAMRELGYKPNNLARSLQGKSAKLVGLIFPTINNIFYSELISHLEKELFDRGYKTIICNSQHESDKEREYLEMLAANQVDGIISGSHNLGIQDYDRVVAPIIAFDRNLSPSIPIVSSDNFAGGVLAAQTLQKAGCHNPLMITGNDDSNSPTGLRQVGFTSILNKAEVFHISSDFSPVRKEMEIRAILEKQKPNGIFVSGDATAMLVWNVIRSMKLSIPEDIKLIGYDGTSFIENYYPQLTTIKQPLTEIARLLVELLVDKIEGKKLTKTDYILPISLLAGASI
>NZ_CP016175.1|WP_087892731.1|1692222_1693677_+|sucrose-6-phosphate-hydrolase
MAFTTGERYRAYADWTPEYIEKIKKNTESSPWRTNFHIETPHGLLNDPNGFSYFNGKWTLFYQYFPFGAAHGLKSWVHTESTDLVHFEETGTVMYPDTPLDSHGAYSGSAMEFGDKLFLFYTGNVRDENWVRHPYQIGALMDKDGKIEKIDKVLIEQPEDTTDHFRDPQIFNYKGQYYAIVGGQNLDKKGIVKLYKAENNDYLNWSYVGDLDFANDMTAYMMECPNIAFVGEQPILLYCPQGLDKEVLDYGNIYPNMYKIGQSFVPETASIVEPSELINLDYGFECYATQPFNAPDGRTLSVSWLALPDVEYPTDAYDYQGCLSLVKELTIKDGKLYQYPVDAITSLRKEAQPFSAQKETNNVYELELDFSASTKHEIVLFANEAEKGLVLSVDTEQGQITLDRGNCGQPFALDFGTSRSCEISPGALTANIFIDKSVFEIFINKGEKVFSGRVFPDADQSGIVITTGNPTGTYYHLDYGRKTN
>NZ_CP016175.1|WP_012027722.1|1690139_1692017_-|PTS-sugar-transporter-subunit-IIBCA
MNNTEIAKKVIDALGGRENVRSVAHCATRLRVMVVDEGKIDKDTVEDIEKVQGAFFNSGQYQIIFGTGTVNKIYDEVVALGLPTATTGEQKAEAAKQGNAFQRAIRTFGDVFVPIIPAIVATGLFMGLRGLLGALGYTLPEDLNVYSQILTDTAFIVLPALVVWSTFRVFGGNQTIGIVLGMMLIAGQLPNAWVVASGGDVKPTIFFGFIPVVGLQGSVLPAFIIGLVGAKFEKAVRKVVPEVLDLLVTPFVTLFVMSILGLFVIGPVFHVVENYILAGTQAILNLPMGLGGLLIGGVHQVIVVSGVHHIFNFLEAQLVANTGANPFNAIITAAMTAQGAATVAVGVKTKNPKLKALAFPAALSAFLGITEPAIFGVNLRFRKPFLLSLIAGAIGGAVASLLGLAGKGMGVTIIPGATLYVGNGQLFQYILMVAVSFALGFALTYLFGFEDEVEAAPKAAAAPVATPATPAVELNEETLVSPLSGDVVALENVNDPVFSSGAMGKGLAVKPSEGVVYAPADAEVTIAFETGHAYGLKTASGAELLIHIGIDTVSMNGNGFEKLVAAGDKVKAGTPLAKFDAAKIAEAGLDDTTMIIVTNTADFAEVSPLAEGTIAHGVEFLKVAK
>NZ_CP016175.1|WP_002939250.1|1702647_1702887_-|30S-ribosomal-protein-S18
MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFISERGKILPRRVTGTSAKNQRKVTTAIKRARVMALLPFVNED
>NZ_CP016175.1|WP_002942409.1|1702919_1703414_-|single-stranded-DNA-binding-protein
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQNGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTRSYDNQQGQRVYVTEVVAESFQLLESRTAREGQGGGYSAGNSFAGGNDYNSPYQAPAQSTPNFAREESPFGASNPMDISDDDLPF
>NZ_CP016175.1|WP_002942403.1|1703425_1703716_-|30S-ribosomal-protein-S6
MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATIVESKAWEKRRLAYEIKDFREGLYHIVNVEANNDEALKEFDRLSKINGDILRHMIVKLDA
>NZ_CP016175.1|WP_011922710.1|1703955_1705119_+|IS30-family-transposase
MKNKHLTLSDRNDIQIGIEQLKPFSAIAAKLGKDPSTISKEVRRNRVIKENSSTSNCEACPLLKKTPYVCNACPKKRSNCGYQKQFYYAKRAQLDYEVKLSDSRTGVALNKEEFYRMDEIVSAAIQKGQHLNHIIASNEMSASRASIYRYLEKGYLSTKPIDFPRVVKFRKRRIRNLQPIPKIAKEGRSYEDFQRFLTEKGISYWLEMDTVTGRIGGKVLLTFNLSFCNFIFAQLLDNKTANEVAKHLYAIKNDLHQKEMDFCEIFPVILTDNGGEFARVDDIEMDVRGESKLFFCDPNRSDQKGRIEKNHTLIRDILPKRSSFDNLTQEDINLVCSHINSVKRASFNGKSAYELFTFTYGEELATLLGISKIDPENVIQSPRLLDK
>NZ_CP016175.1|WP_012027737.1|1705437_1706427_-|lipoate--protein-ligase
MKYIVNNSNDPAYNIALEAYAFKELTDIDEIFILWINEPAIIIGKHQNAIEEINKEFTDEKGIHVVRRLSGGGAVYHDLNNLNYTIISNKADEGAFDFKTFSKPVIDTLATLGVEANFTGRNDLEIDGKKICGNAQAYAKGRMMHHGCLLFDVDMSVLASALKVSKDKIESKGVKSVRARVTNINNELPDKMTVLEFKDAILNQMKQEYPEMDEYVLTEDDLARIQEIRDSQFATWDWTYGQTPEYTVERSVRYPAGKITTYIKAEKSVIESIKIYGDFFGIGDVADVEDLLVGTRYEYADVLAKLQEIDTTHYFSRMTTEEVAKAIVA
>NZ_CP016175.1|WP_012027738.1|1706556_1707747_+|hypothetical-protein
MSKHLKSFLIFYLAASIFLPFMWFINAPLICFVLPLYLTWKNIRHFWDLLKKQLKEYSFWINDGLIFFLGTGLSWLALEMAQVVYVDWPETLVNNQIHSPMQTEAWSGQFFLLLLGVLAYLVLNIFQTKLLPPLLTVLLISCLYPSFVFAVLWTIQLSSLIETDFFTYCYLCLVPFNICLIYSRTILQTIQLWQAELAKQSNPRFPRLSALLQKSLSLPIWLLFFSLPYLAVLGSYLILFGQKPDQLLQMWTETSDWALSEKISPPNAFYDEHYLCTVGAAGHRKLVKPIRMGERHGHRVVVNRQLQIANAFEQILEERCPRLHRCVRSNYDRYGYPISKHIRKAWQADLIYLIMKPAEWLFLIVIYLHDRQPENRIAVQYLPLSKNLLPQENTSN
>NZ_CP016175.1|WP_012027739.1|1707798_1709559_-|dihydrolipoyl-dehydrogenase
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIVHGNGATVPVTEVIAYLGAEGESVEVGAALAPAEVAQATADLKAAGLEVPATPAAAPQAPKAELAADEYDMVVVGGGPAGYYAAIRGAQLGGKIAIVEKSEFGGTCLNKGCIPTKTYLKNAEILDGLKIAAERGINLASTNYTVDMDKTVDFKNKVVKTLTGGVQGLLKANKVTIFNGLGQVNPDKTVVIGDKVIKGRSIILATGSKVSRINIPGIDSKLVLTSDDILDLREIPKSLTVMGGGVVGVELGLVYASYGTEVTVVEMADRIIPGMDREVSVELQKVLSKKGMKFLTSVGVSEIVEANNQLTIKLNDGSEIVSEKALLSIGRVPQLAGLENLNLELDRGRIKVNEYQETSIPGIYAPGDVNGTKMLAHAAYRMGEVAAENAIHGNHHKAKLDFTPAAVYTHPEIAMVGLTEDQAIEKYGKENILIGRNSFTGNGRAIASNEAHGFVKVIADKKYHEILGVHIIGPVAAEMINEAATIMESELTVDDVAASIHGHPTFSEVMYEAFLDVLGVAIHNPPKRK
>NZ_CP016175.1|WP_087892732.1|1709832_1711221_-|dihydrolipoamide-acetyltransferase
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIVHGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQGSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQGVDLSTLTGSGVNGKIVKNDVLAVLAPVAVATAAPVPKAEEKPAKELPEGVEIIKMSPMRKAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRTLMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKDVIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGEIKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
>NZ_CP016175.1|WP_002942393.1|1711561_1712557_-|alpha-ketoacid-dehydrogenase-subunit-beta
MAETKVMALREAINLAQSEEMRKDEKVFLMGEDVGIYGGDFGTSVGMLDEFGPKRVRDTPISEAAIAGSAVGAAQTGLRPIVDLTFMDFITIALDAIVNQAAKTNYMFGGGLKTPVTFRVASGSGIGSAAQHSQSLEAWLTHIPGIKVVAPGTANDAKGLLKSSILDNNPVIFLEPKALYGKKEEVNLDPDFYIPLGKGEIKREGTDVTIISYGRMLERALKAAEEVAAEGISVEVVDPRTLIPLDKELIIESVKKTGKVILVNDAYKTGGFIGEIASIITESEAFDYLDAPIIRIASDDVPVPYANILENAVLPNVEKIKAAIYKQVNKG
>NZ_CP016175.1|WP_012775325.1|1712843_1713812_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MVSITKEQHLDMFLKMQQIRDVDMKLNKLVRRGFVQGMTHFSVGEEAAAVGPIAGLTDEDIIFSHHRGHGHVIAKGIDINGMMAELAGKATGTSKGRGGSMHLANVEKGNFGSNGIVGGGYALAVGAALTQQYLGTDNIVIAFSGDSATNEGSFHESMNLAAVWNLPVIFFITNNRYGISTDISYSTKIPHLYQRAAAYGIPGHYVEDGNDVIAVYEKMQEVIEYVRAGKGPAMVEVESYRWFGHSTADAGVYRTKEEVNEWKAKDPLKKYRKYLTENKIATDEELDAIEAQVAEQVEASVKFAQESPDPDISVAYEDVFVD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016175_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016175_2

1746799-1746922

Orphan

Consensus_repeat	Method
CCAATCAACCACTACTGCGCTAAGATGTTGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016175_2

>merge|NZ_CP016175|2|1746799-1746922|CRISPRCasFinder
CCAATCAACCACTACTGCGCTAAGATGTTGACACTAACGTTGAGAAGCGGTACAGGGCTTGAGCCCAGCTTCACTCCACTGGACTGTTAAACCCAATCAACCACTACTGCGCTGAGATGTTGAC

>NZ_CP016175|2|2|1746799-1746922|CRISPRCasFinder
CCAATCAACCACTACTGCGCTAAGATGTTGAC	ACTAACGTTGAGAAGCGGTACAGGGCTTGAGCCCAGCTTCACTCCACTGGACTGTTAAAC
CCAATCAACCACTACTGCGCTGAGATGTTGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016175.1\|WP_012027774.1\|1752799_1753702_-\|SPFH-domain-containing-protein	unknown	unknown	gnl\|CDD\|259805
NZ_CP016175.1\|WP_012775335.1\|1751635_1752379_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP016175.1\|WP_002937416.1\|1753711_1754962_-\|threonine-ammonia-lyase-IlvA	unknown	unknown	gnl\|CDD\|236318
NZ_CP016175.1\|WP_009910803.1\|1755244_1756267_-\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
NZ_CP016175.1\|WP_009910800.1\|1752504_1752714_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016175.1\|WP_012027765.1\|1742836_1743277_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
NZ_CP016175.1\|WP_012027769.1\|1747095_1748268_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP016175.1\|WP_002938143.1\|1734297_1735254_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP016175.1\|WP_012775332.1\|1739577_1740819_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP016175.1\|WP_012775334.1\|1748264_1748987_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NZ_CP016175.1\|WP_002938165.1\|1745769_1746543_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
NZ_CP016175.1\|WP_002942324.1\|1736199_1737198_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP016175.1\|WP_012027759.1\|1735255_1736197_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NZ_CP016175.1\|WP_009910805.1\|1756407_1756884_-\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
NZ_CP016175.1\|WP_012028491.1\|1750077_1751643_+\|ABC-transporter-substrate-binding-protein/permease	unknown	unknown	gnl\|CDD\|270345
NZ_CP016175.1\|WP_012775331.1\|1737574_1739365_-\|oligopeptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173875
NZ_CP016175.1\|WP_012027770.1\|1749114_1749951_-\|undecaprenyl-diphosphate-phosphatase	unknown	unknown	gnl\|CDD\|234712
NZ_CP016175.1\|WP_012775333.1\|1744490_1745753_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
NZ_CP016175.1\|WP_002938151.1\|1741071_1742487_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
NZ_CP016175.1\|WP_012027766.1\|1743263_1744487_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034

Protein	Function_ID	Function_description	E-value
NZ_CP016175.1\|WP_012027774.1\|1752799_1753702_-\|SPFH-domain-containing-protein	gnl\|CDD\|259805	cd03407, SPFH_like_u4, Uncharacterized family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. This model summarizes an uncharacterized family of proteins similar to stomatin, prohibitin, flotillin, HflK/C (SPFH) and podocin. The conserved domain common to the SPFH superfamily has also been referred to as the Band 7 domain. Many superfamily members are associated with lipid rafts. Individual proteins of the SPFH superfamily may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podocin gene give rise to autosomal recessive steroid resistant nephritic syndrome.	3.71678e-128
NZ_CP016175.1\|WP_012775335.1\|1751635_1752379_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.30548e-147
NZ_CP016175.1\|WP_002937416.1\|1753711_1754962_-\|threonine-ammonia-lyase-IlvA	gnl\|CDD\|236318	PRK08639, PRK08639, threonine dehydratase; Validated.	0
NZ_CP016175.1\|WP_009910803.1\|1755244_1756267_-\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
NZ_CP016175.1\|WP_012027765.1\|1742836_1743277_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	8.16406e-68
NZ_CP016175.1\|WP_012027769.1\|1747095_1748268_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	9.66017e-81
NZ_CP016175.1\|WP_002938143.1\|1734297_1735254_-\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.06681e-112
NZ_CP016175.1\|WP_012775332.1\|1739577_1740819_+\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	5.36323e-91
NZ_CP016175.1\|WP_012775334.1\|1748264_1748987_-\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	2.58092e-83
NZ_CP016175.1\|WP_002938165.1\|1745769_1746543_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.74827e-148
NZ_CP016175.1\|WP_002942324.1\|1736199_1737198_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.71068e-159
NZ_CP016175.1\|WP_012027759.1\|1735255_1736197_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	2.10004e-119
NZ_CP016175.1\|WP_009910805.1\|1756407_1756884_-\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	1.6123e-73
NZ_CP016175.1\|WP_012028491.1\|1750077_1751643_+\|ABC-transporter-substrate-binding-protein/permease	gnl\|CDD\|270345	cd13627, PBP2_AA_binding_like_2, Substrate-binding domain of putative amino acid-binding protein; the type 2 periplasmic-binding protein fold. This putative amino acid-binding protein belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.18368e-91
NZ_CP016175.1\|WP_012775331.1\|1737574_1739365_-\|oligopeptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173875	cd08510, PBP2_Lactococcal_OppA_like, The substrate binding component of an ABC-type lactococcal OppA-like transport system contains. This family represents the substrate binding domain of an ATP-binding cassette (ABC)-type oligopeptide import system from Lactococcus lactis and other gram-positive bacteria, as well as its closet homologs from gram-negative bacteria. Oligopeptide-binding protein (OppA) from Lactococcus lactis can bind peptides of length from 4 to at least 35 residues without sequence preference. The oligopeptide import system OppABCDEF is consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP016175.1\|WP_012027770.1\|1749114_1749951_-\|undecaprenyl-diphosphate-phosphatase	gnl\|CDD\|234712	PRK00281, PRK00281, undecaprenyl-diphosphate phosphatase.	1.49616e-101
NZ_CP016175.1\|WP_012775333.1\|1744490_1745753_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	4.97321e-124
NZ_CP016175.1\|WP_002938151.1\|1741071_1742487_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
NZ_CP016175.1\|WP_012027766.1\|1743263_1744487_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>NZ_CP016175.1|WP_002938165.1|1745769_1746543_-|Fe-S-cluster-assembly-ATPase-SufC
MSVLEIKDLHVEIEGKEILKGVNLTLKTGEIAAIMGPNGTGKSTLSAAIMGNPSYEVTQGEILFDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFLRAAMNAGKEDEDKISVRDFITKLDEKMELLNMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFALLDEIDSGLDIDALKVVSKGINAMRGEGFGAMIITHYQRLLNYITPDVVHVMMEGRVVLSGGPELAQRLEKEGYVQVAAELGIDYKEDDI
>NZ_CP016175.1|WP_012775333.1|1744490_1745753_-|Fe-S-cluster-assembly-protein-SufD
MTKEKIQEFSALQAEPTWLTDLRLKAFDKIAELDLPVIERVKFHRWNLGDGSLATNDEIGAVPDFTAIGDNPMLVQVGSQTILEQLPVALVEKGVVFTDFASAMDVIPDVLEKYLGAAVAYDEHKLAAYNTAYFNATAVLYVPDNVEIDQPVEALFYQDSTSPVAFNKRVLIIAGKNAKLNYLERFESLGDGAATTSANIVVEVIALAGSQIKFAAIDRLGKHLDTYLNRRGYLGNDATIDWAIGLLNEGNVVADLDSELKGNGSHANLKVVGLSSGRQVQGVDTRVTNYGHNSVGHILQHGVILESGTLTFNGIGHIVRGAKGADAQQESRVLMLSDKARSDANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDRATAERLVVRGFLGSVITEIPVKEVRDQLIAVIEEKLTKR
>NZ_CP016175.1|WP_012027766.1|1743263_1744487_-|cysteine-desulfurase
MDLERIRKEFSILDQVVNDEPLVYLDNAATTQKPQQVLDVLADYYQKDNANVHRGVHTLSERATTRYEAARQKVADFIQAKSSKEILFTRGTTTSLNWVAQFAKEILQPDQEVIISVQEHHSNIIPWQQACQQTGAKLRYVTLKDGELDMDHLRSLLSSKTKFVSLAHVSNVLGGVVPIGEIAELVHQVGAYLVVDGAQSVPHMGVNVQELDVDFYAFSGHKMLGPTGIGILYGKEELLNLMSPVEFGGEMIDFVYEQSATWKELPWKFEAGTPNIAGAIGLGAAIDYLTEIGMDAIQAHEAELVDYVFPKLQAIPGLTIYGSQDLSKRTGVIAFNLDDLHPHDVATALDYEGVAVRAGHHCAQPLLRYLQVPATVRASFYIYNTKADCDKLVEAIIKTKEFFNGPI
>NZ_CP016175.1|WP_012027765.1|1742836_1743277_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSRLDSLYMAVVSEHSKSPRHRGSLDGVEKLELHNPTCGDVIELSVKIEKDVITDIAFDGVGCTISTASASMMTEAVLGKEISQIQELAEIFSQMVRGQEDPRQKELGDASLLAGVAKFPQRIKCATLPWNALKKALSLRSSAE
>NZ_CP016175.1|WP_002938151.1|1741071_1742487_-|Fe-S-cluster-assembly-protein-SufB
MSEERIEPTPIDLGEYKFGFHDENVELVASTGKGLNEEVIREMSRIKGEPEWMLEFRLKSYETFKKMPMQTWGADLSELDFDDIVYYQKPSDKPARSWDDVPDKIKETFERIGIPEAERAYLAGASAQYESEVVYHNMKEEYDKHGIIFTDTDTALKEHPELFKKYFGKLVPPSDNKLAALNSAVWSGGTFIYVPKGVKLDIPLQTYFRINNEGTGQFERTLIIVDEGASVHYVEGCTAPTYSTASLHAAIVEIIAHEGAYMRYTTIQNWSDNVYNLVTKRARAEKNATVEWIDGNLGAKTTMKYPAVYLEGEGARGTMLSIAFANKGQVQDTGAKMIHNAPRTSSSIVSKSIARGGGEVNYRGQVTFAKNSAKSISHIECDTIIMDDISKSDTIPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVELNRLIAYEMEGSVG
>NZ_CP016175.1|WP_012775332.1|1739577_1740819_+|D-alanyl-D-alanine-carboxypeptidase
MRKLLLTLTTILAVFLTSTPILAEDFSVAAKHAIAVEVSSGKILYEQDAETKASIASISKTLSIYLVYEALAKGEITLDTMVDISDYPYSLTSNTELSNVNLDERSYSVRDLLNASLITSSNSAIIALAEKIAGSEAAFVDRMKAKVQEWGITDTKIVNVSGLDNTDLGENIYPGSSPEDVNMFSALDVAIIARRLILDYPQVLDITSLNAYDFGGYTYYSTNQMLSDGTHARGGVDGLKTGTSNSAGSSFLATTQQAGMRIITVVLNANDGLTSPENRFVATNDLMNYVYSNFSLVTLVKKSEAFGDSKIKVFNGEKETSPVVAAADLTVVQRNQTDNVPTATFTTDIKEIDAPLKAGTLVSKLQLKDQDLIGKGYISEQTGVDMIIPSDMKEASWPFSWWNQFVRYVNEKL
>NZ_CP016175.1|WP_012775331.1|1737574_1739365_-|oligopeptide-ABC-transporter-substrate-binding-protein
MKKTTKLFALAGVTLLSASVLAACGSKQSGAAKQELSFPAEVKQDGTAVADAQLKYAWVSPTTSSGLLIDELTENTTDSTFGGMVDISMFGYDGERKLDDSGLAKAEFDVKGKKITVSLTGKDYKWSDGESFTINDYIFTIKSMASKDYTGIRFDDKFLNIEGMQEFVDGKASDISGIKKVDDYTVELTVKEMSPSMMYAGGDVPAYIQPEHIYKDIPVADWEKSEYSRTAKLVGMGPWKIKEIVNGESITYVPNEYFFKGTKPKTSSLKIDIVSPDTIVSEMKAGNYDIAEMPVDQLDSYKDASNLNIVGQLESSYEYISFNFGKYDEAAGKNVMDENAKMNDVKLRQAIAYAIDTKTAGKSLYNGLYHPAKSLIISFFGDIHDSELEGYSYNPEKAKKLLDEAGYKDVDGDGIREGKDGKAFKITFAARKRTEANEALVQQYIAWWKEVGLNVELYTGRTVEGKSFYNSVQANDAAIDMYAGGWSTGYDPNPSGLWGPIAAFNMSRFVSDENTKLLEAISSAESFDDKKNVENYKAWQKYAHEQAFAIPTFESEKITAVNKRVKSYDTKYGSASGTGLAYEGIELTADKGVVAE
>NZ_CP016175.1|WP_002942324.1|1736199_1737198_-|ABC-transporter-ATP-binding-protein
MATEKPLLDIKDLHVGFRIGDDYFDAVDGVDISLQKNEILAIVGESGCGKSTLATTIMGLHNPLNTKITGSIQYNDMELIGMDEAKYNTVRGNDIGMIFQDPLASLNPLMTIGAQIDEALFYHTDLDANARTERVLELLAQVGIPNPKRTFKQYPHELSGGMRQRIIIAMALSCKPPIIIADEPTTALDVTIQAQILDLLNDIQAETGSGIILITHDLGVVAETADRVAVMYGGQFVEVAPVEELFTNPKHPYTRSLLKSNPQSGSEGGDLHVIEGIVPPITKMVRKGCRFAPRIPWIGAEAHEENPSMHEVGPNHFVRCTCHETFYFEGEA
>NZ_CP016175.1|WP_012027759.1|1735255_1736197_-|ABC-transporter-ATP-binding-protein
MGFIEVKDLKVHYPIRSGFFNRVTDHVYAVDGVNIEFEEGKTYGLVGESGSGKSTIGKAIIGLERATSGQIIYEGQDVTNKSRGKKGNFNRDVQMIFQDSLSSFNPKKRILDIIAEPIRNFDRLSPDEEKKKVLQLLDTIGLNEEALIKYPHEFSGGQRQRIGVARALASNPRLIIADEPVSALDLSVQAQVLNYMKRIQDEFKLSYLFISHDLGVVQHMCDELFIMYRGRFVETGNKNDIYNNPQHIYTKRLLSAIPTIDPLNRLKNKEKRLAAEKEYQEMQGQYYDENGRVYDLRSFSETHQVALPEGGQN
>NZ_CP016175.1|WP_002938143.1|1734297_1735254_-|ABC-transporter-permease
MWKTVLRRLLMMIPQIIILSVIAFFVAKMMPGDPFTGLIDPNIDPAIIEQKRIAAGYYDPIPVQYFRWVGNLLQGDFGQSVIFKQPVVDVIMQRLNNTIGLSLLTMVLTYLIALPLGMIAGRYQNSLADKIIGVYNFLTFSTPTFVFAILMLWMFGFSLGWFPTRGSISGGVEGFAATLSRLHHMILPAITMAILSTTVTIQYLRTGIIDAKSQDYVRTARAKGVPERVVYNRHIFRNSILPIASFLGYELTGLIGGSIFIENIFTYPGIGQLFFNSISSRDYSVILALLLVFGMGTLLGTLISDIIMSIVDPRIRVK
>NZ_CP016175.1|WP_012027769.1|1747095_1748268_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MIPFALKYIMVIITTMVISAIATPLVRFMSLRVGAVDNPNARRINKVPMPSAGGLAIFVAFTISVLWFLPGIVTRVNYHGTYLHYIWPLVLASSIIVLTGFIDDVKELKPAPKMFGILAAATIIWIFTEFRFDSFKIPFGGPFLQFPVWLSFLLTVLWIVSITNAVNLIDGLDGLVSGVSIISLTTMGIVSYFFLHDSNIFLTLTIFVLVAAIVGFLPYNYNPAIIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPMIILGVPITDTVVAIIRRKLSGQKIYEADKMHLHHRLLSLGLTHRGTVLVIYAISFLFSLTSLLLNVSSRIGGILLLVTMGLGIEILCELIGIFGINRTPLLNLLRFIGNSSYRQEKIAKYKKCCEEKKRK
>NZ_CP016175.1|WP_012775334.1|1748264_1748987_-|adaptor-protein-MecA
MKVKQISDSTLKITIKLDDLEERGMELSDFLIPQEKTEEFFYTVLDELDLPMTFRESGMLSFRVTPKPDRVDIFVTKSDLDQNLNFDEFTDLSELGDVASMTPDEFFKSLEQTVREKSAPDATAVRHLEEVEQEEEADEEEQERYIYYILEFPTIEDLFTFVGTVDYPVEESELYKMDGHYYLTVLINVENRSKQYPGYILSRMLEFTNDTKLTRPALQEHGTLMLPLAAIEELRKVPTV
>NZ_CP016175.1|WP_012027770.1|1749114_1749951_-|undecaprenyl-diphosphate-phosphatase
MLLELLKAIFLGIIEGVTEWLPVSSTGHLILVQEFVKLNQSKNFLEMFNIVIQLGAILAVMTIYFKKLNPFQPGKTKRDIQLTWQLWAKVVIACIPSILIAVPLDNWFEAHFNFMVPIAIALIVYGIAFIWIENRNRGIEPQVTDLAKMSYKTALLIGCFQVLSIVPGTSRSGATILGAIILGTSRSVAADFTFFLGIPTMFGYSGLKAVKYFLDGNSLNMEQVWILLVASVTAYLVSLVVIRFLTDFVKKHDFTVFGYYRIILGAILLVYAFITFLF
>NZ_CP016175.1|WP_012028491.1|1750077_1751643_+|ABC-transporter-substrate-binding-protein/permease
MKRKLSIFLLTLIAVFSVTTGVRADEYLRVGMEAAYAPFNWTQEDDSNSAVPIEGTNQFANGYDVQVAKKIAASMDKELLVVKTKWEGLVPALTSGKIDMIIAGMSPTEERKKEIAFSDSYYTSIPTLVVRSDSQYANATSLEDFAGAKITAQQGVYLYDLIDQIEGANKQTAMGDFSQIRQALESGIIDAYVSERPEGRTAEAANKAFKMVELADSFETNAEDVTIAVGMRKDDERIAQVNEVLATISEEEQIALMDDMIENQPVEEASEGETPSFFAQVWNIVVNNWQQLLRGTGMTLLISILGTIIGTAIGLLIGVFRTAPKAANKALAIGQKVLGWIINIYIEIFRGTPMIVQSMVIYYGTAQAFGLNLDRTLAAIFIVSINTGAYMSEIVRGGIFAVDKGQFEAATALGFTHNQTMRKIVLPQVIRNILPATGNEFVINIKDTSVLNVISVVELYFSGNTVATQTYQYFQTFTVIAIIYFILTFTVTRILRAVEKYFDTDTYTTGANQMQVEVPHD
>NZ_CP016175.1|WP_012775335.1|1751635_1752379_+|amino-acid-ABC-transporter-ATP-binding-protein
MTKNVILEIKNLKKSYGQNQVLKDISISVEKGEVISIIGSSGSGKSTFLRSINLLETPTEGQILYHGQDVLAKGYDLTTYREKLGMVFQSFNLFNNLNVLENAIVAQTTVLKRDRAEAEKIAKENLNKVGMTEQYWQAKPSQLSGGQKQRVAIARALSVDPEVILFDEPTSALDPEMVGEVLKTMQDLAKSGLTMLIVTHEMEFARDVSDRVIFMDKGVIAEEGSPQQIFENPQEERTREFLQRFLG
>NZ_CP016175.1|WP_009910800.1|1752504_1752714_-|hypothetical-protein
MTSYEKVAAVVGWVREKKITGYRISKETNAREMSVIALAQGRAKIDNISFATALGLIDFYDKNHKKFEN
>NZ_CP016175.1|WP_012027774.1|1752799_1753702_-|SPFH-domain-containing-protein
MVFGPIVFIGSFLFFVLIALILIASGLYVVKQQTVAIIERFGKYQKTSTSGINFKIPFGVDVIAARIQLRMLQSEIVVETKTQDNVFVTMNVATQYRVNENNVTDAYYKLMHPEAQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQKQVAEEMSTYGYVIVKTLITKVEPDAEVKQSMNEINAAQRKRVAAQELAEADKIKIVTAAEAEAEKDRLHGVGIAQQRKAIVDGLADSIRELKESNVSLSEEQIMSILLTNQYLDTLNNFAQGGNQTIFLPGNPEGVEDIRTQILSSLRAK
>NZ_CP016175.1|WP_002937416.1|1753711_1754962_-|threonine-ammonia-lyase-IlvA
MITAKNVEQAYSVLKRVVVRTPLDYSRYLSEKYGATIYLKRENEQRVRSFKIRGAYYAISQLTDDEKSRGVVCASAGNHAQGVAYTCQEMQIPATIFMPITTPQQKIGQVKFFGGDYVEIRLVGDTFDESAKAAQDYTQESGKTFIDPFDDENVQAGQGTVAYEILEEAEEQTISFDQILVPIGGGGLVAGVSAYLKEHAPEIKIVGVEASGARSMKAAFDKGRPVKLDQIDKFADGIAVQKVGKSTYEVARKYVDRLIGVDEGWISGTILDLYSKLGIVAEPAGAATIAALEVVKDQIKGQTICCIISGGNNDINRMPEMEERALIYEGIKHYFVVNFPQRPGALREFVNDILGPNDDITRFEYIKRANKGTGPVLIGIALGDKTDYTQFISRLEEFDPQYINLHENDSLYKMLV
>NZ_CP016175.1|WP_009910803.1|1755244_1756267_-|ketol-acid-reductoisomerase
MTVTMQYEKDVTVAALDGKRIAVIGYGSQGHAHAQNLRDTGHDVIIGVRAGKSFDKAKEDGFETFEVAEAAKQADVIMILAPDEIQADLYNEEIAPNLEAGNALGFAHGFNVHFEFIKVPADVDVFMCAPKGPGHLVRRTFEEGFGVPALYAVYQDATGNAKHIAMDWAKGVGSARVGLLETTFKEETEEDLFGEQAVLCGGLTALMQAGFEVLTEAGYAPELAYFEVLHEMKLIVDLVYEGGFKKMRQSISNTAEFGDYVSGPRVITDQVKENMKAVLADIQSGKFANDFVNDYKAGRPRMEAYRKEAENLEIEKVGAELRKAMPFVGRNDDDAFKIYN
>NZ_CP016175.1|WP_009910805.1|1756407_1756884_-|acetolactate-synthase-small-subunit
MRRMLTAKLRNSSGVLNRFTGVLSRRQINIESISVGPTEVDGISRVTVIVDVVSHDEVEQIIKQLNRLIDVVRVRDLTDIPHLEREVILVKISAPPTKRAEILAIIQPFRANVVDVAPHSITIQMTGDGDKIDALLRVIQPYGIKNIARTGATGFSRD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

31438 : 41700

Microbacterium_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012774881.1\|31438_35158_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	8.6e-39	26.9
WP_011921648.1\|35160_36615_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.2e-58	35.4
WP_012774882.1\|36670_37693_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A127KMF9	Cyanophage	1.3e-58	42.7
WP_011922533.1\|37689_38241_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.6e-26	38.5
WP_011921652.1\|38250_39798_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.6e-74	47.6
WP_011921653.1\|39923_41186_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_011921654.1\|41211_41700_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.7e-17	45.0

DBSCAN-SWA_2

542569 : 555682

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011922101.1\|542569_543208_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	1.0e-125	99.5
WP_012775018.1\|543315_545784_+	bifunctional DnaQ family exonuclease/ATP-dependent helicase	A0A1X9I5C8	Streptococcus_phage	0.0e+00	98.5
WP_011922103.1\|545943_547020_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.5e-193	99.2
WP_011922104.1\|547084_548323_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.0e-217	96.8
WP_011922105.1\|548332_549118_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.0e-130	95.4
WP_011922106.1\|549140_549545_-	TetR/AcrR family transcriptional regulator	A0A1X9I6A2	Streptococcus_phage	3.2e-64	99.3
WP_002938910.1\|549671_550523_+	DegV family protein	A0A1X9I5J4	Streptococcus_phage	1.3e-152	98.6
WP_011922108.1\|550621_551881_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.2e-239	98.8
WP_012775019.1\|552003_552738_+	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	1.5e-120	99.5
WP_012775020.1\|552842_554288_+	LCP family protein	A0A1X9I5X1	Streptococcus_phage	2.4e-226	99.5
WP_011922111.1\|554305_554995_+	capsular polysaccharide biosynthesis protein CpsC	A0A1X9I5E1	Streptococcus_phage	1.3e-110	96.1
WP_012775429.1\|555004_555682_+	tyrosine-protein kinase	A0A1X9I5D6	Streptococcus_phage	8.1e-121	99.1

DBSCAN-SWA_3

636599 : 651944

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775040.1\|636599_638837_+	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	1.2e-99	96.7
WP_002935351.1\|638838_638982_+\|transposase	transposase	NA	NA	NA	NA
WP_011922763.1\|639161_639818_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	2.7e-113	98.6
WP_011922194.1\|639911_640739_+	hypothetical protein	M1PFV6	Streptococcus_phage	1.0e-133	98.5
WP_011922195.1\|640744_642016_+	hypothetical protein	M1PLC8	Streptococcus_phage	1.3e-207	98.1
WP_002935357.1\|642052_642919_-	YitT family protein	M1Q1P6	Streptococcus_phage	4.6e-153	99.7
WP_012775041.1\|643093_643732_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.0e-112	98.1
WP_011922767.1\|643728_644613_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.6e-154	98.6
WP_002935361.1\|644632_644950_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	3.1e-54	100.0
WP_002935362.1\|644951_645815_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-158	99.7
WP_011922200.1\|646284_647376_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.4e-207	100.0
WP_011922201.1\|647375_647933_+	GNAT family acetyltransferase	M1PSC3	Streptococcus_phage	5.9e-93	94.6
WP_011922202.1\|647986_649168_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	7.8e-220	99.7
WP_011922203.1\|649170_649677_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.0e-93	97.0
WP_002935368.1\|649660_650014_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.9e-60	100.0
WP_011922204.1\|650030_650930_-	cation transporter	M1Q1N9	Streptococcus_phage	5.1e-163	99.7
WP_012775042.1\|651116_651944_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.9e-152	100.0

DBSCAN-SWA_4

812262 : 819292

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011922359.1\|812262_813102_+	thymidylate synthase	U5J9N5	Bacillus_phage	1.7e-88	55.7
WP_011922360.1\|813387_813900_+	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	1.6e-20	36.6
WP_002934972.1\|813902_814076_+	hypothetical protein	NA	NA	NA	NA
WP_002934974.1\|814097_815324_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.2e-133	59.2
WP_012775089.1\|815379_815967_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_012028095.1\|815989_816403_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	4.3e-24	42.5
WP_011922364.1\|816506_817178_+	membrane protein	A0A1S5SAM6	Streptococcus_phage	3.0e-06	35.2
WP_002943192.1\|817459_819292_+	elongation factor 4	A0A2K9L2P9	Tupanvirus	2.2e-19	38.8

DBSCAN-SWA_5

873295 : 890819

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001291561.1\|873295_874513_-\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
WP_000814511.1\|874594_874798_-	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_001845478.1\|874781_875033_+	hypothetical protein	NA	NA	NA	NA
WP_000857133.1\|875258_875489_-	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_000804885.1\|875485_875908_-	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_013670292.1\|876136_876208_-	hypothetical protein	NA	NA	NA	NA
WP_001227347.1\|876412_876766_+	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_011058338.1\|876825_877011_-	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_000691736.1\|877111_879031_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_012386611.1\|879046_879133_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224318.1\|879407_880340_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
WP_000769868.1\|880336_881338_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_000804748.1\|881334_883512_-	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|885946_886453_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_001009056.1\|887041_887263_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_000398284.1\|887305_888511_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_000879507.1\|888533_888686_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|888688_890074_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|890102_890489_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|890504_890819_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0

DBSCAN-SWA_6

1270486 : 1276271

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012775217.1\|1270486_1271233_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	3.4e-27	32.9
WP_012027299.1\|1271398_1271941_-	ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	5.9e-21	35.1
WP_012027300.1\|1272459_1273263_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	2.8e-35	35.6
WP_012027301.1\|1273269_1274619_-	cell wall metabolism sensor histidine kinase VicK	W8CYF6	Bacillus_phage	2.1e-35	34.5
WP_004298854.1\|1274611_1275316_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-38	39.8
WP_012027304.1\|1275509_1276271_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-34	38.4

DBSCAN-SWA_7

1426068 : 1436110

Streptococcus_phage(90.0%)

integrase

attL 1412768:1412781|attR 1436336:1436349

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1412768:1412781	attL	NA	NA	NA	NA
WP_012775260.1\|1426068_1426611_-\|integrase	site-specific integrase	A0A1S5SCL7	Streptococcus_phage	1.1e-80	78.9
WP_012775261.1\|1426597_1426792_-	hypothetical protein	NA	NA	NA	NA
WP_012027449.1\|1427080_1428613_-	primase	A0A1X9I717	Streptococcus_phage	4.9e-105	42.3
WP_012027450.1\|1428627_1429200_-	hypothetical protein	NA	NA	NA	NA
WP_012027451.1\|1429192_1429393_-	hypothetical protein	NA	NA	NA	NA
WP_012775262.1\|1429404_1429608_-	membrane protein	A0A1X9I5T6	Streptococcus_phage	2.4e-20	73.1
WP_012027452.1\|1429628_1429946_-	hypothetical protein	A0A1X9I5Z6	Streptococcus_phage	1.3e-09	41.0
WP_012027454.1\|1430299_1430563_-	hypothetical protein	A0A1S5S7M1	Streptococcus_phage	1.0e-07	43.8
WP_012775263.1\|1430693_1431101_-	hypothetical protein	A0A1X9I5V7	Streptococcus_phage	1.8e-35	52.2
WP_012027456.1\|1431112_1431430_-	hypothetical protein	NA	NA	NA	NA
WP_012027457.1\|1431416_1431638_-	hypothetical protein	NA	NA	NA	NA
WP_012027458.1\|1431634_1431877_-	hypothetical protein	NA	NA	NA	NA
WP_012027459.1\|1431873_1432074_-	hypothetical protein	NA	NA	NA	NA
WP_012027460.1\|1432063_1432375_-	hypothetical protein	A0A1X9I5U4	Streptococcus_phage	2.5e-08	40.7
WP_012027461.1\|1432671_1432860_-	helix-turn-helix transcriptional regulator	R9QNG3	Lactococcus_phage	2.0e-05	42.4
WP_012027462.1\|1433011_1433533_+	helix-turn-helix transcriptional regulator	A0A1X9I723	Streptococcus_phage	8.7e-14	65.1
WP_012028388.1\|1433588_1434281_+	hypothetical protein	NA	NA	NA	NA
WP_012775264.1\|1434967_1436110_+\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	2.5e-69	39.7
1436336:1436349	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016175

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection