CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP020723	Bacillus thuringiensis strain BM-BT15426 chromosome, complete genome	1 crisprs	cas3,csa3,WYL,c2c9_V-U4,cas14k,DinG,Cas14u_CAS-V,DEDDh,cas14j	1	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP020723_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP020723_1

1168128-1168362

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP020723_1

>merge|NZ_CP020723|1|1168128-1168362|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAATAAGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTCGCTTTCGTTTTTGATCCTTCCGCATGAGAGAAAGAACCTTTTGCATGTGTAAGAAGCCCTTCTGCATGTGAA

>NZ_CP020723|1|1|1168128-1168362|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA	TAAGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTCGCTTT
CGTTTTTGATCCTTCCGCATGAGAG	AAAGAACCTTTTGCATG
TGTAAGAAGCCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP020723.1\|WP_001984995.1\|1162065_1162239_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020723.1\|WP_000651527.1\|1177744_1178425_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP020723.1\|WP_000191105.1\|1163940_1164519_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP020723.1\|WP_087931427.1\|1169009_1169750_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP020723.1\|WP_000654718.1\|1169824_1170985_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP020723.1\|WP_000360638.1\|1162468_1163362_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP020723.1\|WP_046947211.1\|1176357_1177047_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369778
NZ_CP020723.1\|WP_000444380.1\|1173010_1173856_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP020723.1\|WP_087931429.1\|1175049_1176147_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP020723.1\|WP_001292832.1\|1172043_1172796_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP020723.1\|WP_087931430.1\|1177043_1177730_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP020723.1\|WP_001081482.1\|1165067_1165706_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP020723.1\|WP_001994556.1\|1171103_1172030_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP020723.1\|WP_087931425.1\|1166537_1167431_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP020723.1\|WP_000673194.1\|1165724_1166522_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP020723.1\|WP_001180003.1\|1164665_1165037_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP020723.1\|WP_087931424.1\|1158824_1160069_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP020723.1\|WP_087931428.1\|1173978_1174884_-\|collagen-like-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP020723.1\|WP_000003393.1\|1160119_1161946_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP020723.1\|WP_000043381.1\|1163361_1163760_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281

Protein	Function_ID	Function_description	E-value
NZ_CP020723.1\|WP_000651527.1\|1177744_1178425_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.1131e-109
NZ_CP020723.1\|WP_000191105.1\|1163940_1164519_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.94434e-83
NZ_CP020723.1\|WP_001994556.1\|1171103_1172030_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2498e-25
NZ_CP020723.1\|WP_000654718.1\|1169824_1170985_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	7.06417e-100
NZ_CP020723.1\|WP_000360638.1\|1162468_1163362_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	5.36453e-93
NZ_CP020723.1\|WP_046947211.1\|1176357_1177047_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369778	pfam08242, Methyltransf_12, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	3.52871e-18
NZ_CP020723.1\|WP_000444380.1\|1173010_1173856_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	1.59865e-154
NZ_CP020723.1\|WP_087931429.1\|1175049_1176147_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	2.45949e-54
NZ_CP020723.1\|WP_001292832.1\|1172043_1172796_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.79414e-19
NZ_CP020723.1\|WP_000673194.1\|1165724_1166522_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP020723.1\|WP_087931430.1\|1177043_1177730_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	3.29257e-108
NZ_CP020723.1\|WP_001081482.1\|1165067_1165706_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP020723.1\|WP_087931428.1\|1173978_1174884_-\|collagen-like-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.5802e-17
NZ_CP020723.1\|WP_087931425.1\|1166537_1167431_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	2.47912e-100
NZ_CP020723.1\|WP_087931427.1\|1169009_1169750_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP020723.1\|WP_087931424.1\|1158824_1160069_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	1.33316e-58
NZ_CP020723.1\|WP_000003393.1\|1160119_1161946_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP020723.1\|WP_000043381.1\|1163361_1163760_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	1.17037e-69

>NZ_CP020723.1|WP_087931425.1|1166537_1167431_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIQSAEEGTLVREFLKTKGISKAALTDIKFHGGAIEVNGQHASVRHQLQVGEELRIFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPSGSVANALLSHYDKQYLASTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGMIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSANHKTHVSLELDTGRTHQIRVHMAHIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTAMIPSDMQEVLRKT
>NZ_CP020723.1|WP_000673194.1|1165724_1166522_+|NAD-kinase
MKFTIMSKGDQSSDTLASTMKEYLLDFGFIMDEQEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYMNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP020723.1|WP_001081482.1|1165067_1165706_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP020723.1|WP_001180003.1|1164665_1165037_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP020723.1|WP_000191105.1|1163940_1164519_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFHALCKSFSIEVFTKQVNHYFETPNFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVVTENEAKMMMETNVIISGAVMNQLCKLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEETGKAAFIHLLKQHNIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP020723.1|WP_000043381.1|1163361_1163760_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
>NZ_CP020723.1|WP_000360638.1|1162468_1163362_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLHGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSDIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP020723.1|WP_001984995.1|1162065_1162239_-|hypothetical-protein
MKKTYIFLIILAVIVSFFLYILSLLQAFPKMIAFPLLFGVIVIALSYFNHKKRFKGF
>NZ_CP020723.1|WP_000003393.1|1160119_1161946_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDTEWEKEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLIESVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP020723.1|WP_087931424.1|1158824_1160069_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQNVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWQAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSIAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKRRKDYFRQNALPILNYNHKSLLRLLYQCKCNPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYAGVLYKVGMYTYRKIRDAVPLKTGGEIIKHDEICLAHALSLFEAKFNMRGGKGDIIKTDREGIT
>NZ_CP020723.1|WP_087931427.1|1169009_1169750_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWDLVIHKKVAYYAPGNHCNKLYRFFLGRNVTVAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTAWIVYGHTPVKEPRFVNHTVNIDTGAVFGGRLTALRYPEMETVSVPSSLPFVPEKFRPIS
>NZ_CP020723.1|WP_000654718.1|1169824_1170985_-|rod-shape-determining-protein-RodA
MKDPNSQYQIDYVLLFILFAIGTVSCFAIASAQVSLPPFLQNVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAITIKGATAWYRLPGIGNFQPSEIMKLFLIIVTGRIIANHNEKYFYRTIHDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLVSGIFATAVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIITLFFLLIFRMIHIALESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP020723.1|WP_001994556.1|1171103_1172030_-|glycosyltransferase-family-2-protein
MTSEKDLPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIIGDDSTNDETETLIHEQYLPHYKNVTYIRNTPPLGQFHNDLMLLEKSNGEYINFLMDDDVFYKHKIQKMMDYFEQDTNKALALVTSYRVRIDDHGDLIGDAHPTQRLYSEDTPLNGMFLGDWMLKEGHNIIGEPTTTLFRKELLTEPFGTLKERQYSCSVDMASWISLLSKGDAVYISEPLSQFRYHAGQQIHNKLLQGCEDFTHLVITAKEYGFLQNTTDYRTALLSAYKWCKSSLKYYLHQLDIFPDAHVRLSHCLVIIIKELNN
>NZ_CP020723.1|WP_001292832.1|1172043_1172796_-|class-I-SAM-dependent-methyltransferase
MSELNKEITLLPPPELVQYVGGDFKEVGKEFLTHFIQIGALKSNEKVLDVGCGVGRMAVPLMNYLTDDGAYYGFDLFKDGITWCQNNIATIRNNFHFEHVDIYNQFYNPEGKEDASQYRFPYEDETFDFIFLTSVFTHLLPKELEHYLSEIVRVLKKDGRCFITFFLINPESSYYLNAGLSTLGFYHQIENCYVVNKDIPNFAVAYPETNIYSLLNKYGLEAINKPYYGLWCGRHEYTSYQDIVITKKRV
>NZ_CP020723.1|WP_000444380.1|1173010_1173856_-|class-I-SAM-dependent-methyltransferase
MESKSAVQLYLELLKKTILFEIWLEYEAYLPASLHISKELEFEPVTVPLPLFIKQYAENHNLKIVKPNVSKSERHDGMDWPRAAHSMIGRERMNQLQEAMETVVRENIEGDFIETGVWRGGSCIFMNGFLQANNITDRNVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLEQVQENFKKYDLLNDQVKFLKGWFKDTLPTAPIEKIAIARLDGDMYESTMDGLVNLYDKVSKGGYIIIDDYGLPPCAEAVTDFRNHRNLKAPITKIDVFGVYWRKE
>NZ_CP020723.1|WP_087931428.1|1173978_1174884_-|collagen-like-protein
MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTVPTGPTGATGPTGPTGDTGTTGPTGPTGLTGDTGATGLTGPTGDTGATGPTGPTGDTGATGLTGPTGDTGATGLTGPTGPTGATGPTGPTGPSGLGLPAGLYAFNSGGISLDLGINDPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIANTATVSVLGGLTIQVNGLPVPGTGSSLISLGAPIVIQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKVA
>NZ_CP020723.1|WP_087931429.1|1175049_1176147_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEKTIARCLDSVEKIVDEIIVVDTGSIDRTKEIVEKYTSNIYDFQWIDDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKREINPKIDAVSMPYHLAMDSNGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGEVFSSNVAITHKKEKKVTDRNLKIFQNTVAAGEELSPRDLFYYANESTDNQKYDDAVLLYETFLNQDEGWYEEKIYACGKLGDCYAKLGMWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQEKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSRLGEQDKAYYYNELAASYVPNNAAIEYNRKYFRGVFDKPYKV
>NZ_CP020723.1|WP_046947211.1|1176357_1177047_+|class-I-SAM-dependent-methyltransferase
MNREKSSLYEEKSEHYYNAANPNLLKHIKKEWKEILDIGCSGGALGAAIKENGTRVSGIEAFPEAAEKAKERLDHVILGDIEKIDLPYEEGQFDCVIFGDVLEHLFDPWAVIEKVKPYIKQNGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYVISKVDRVYVDHKMYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP020723.1|WP_087931430.1|1177043_1177730_+|streptomycin-biosynthesis-protein-StrF
MSAADKTILFVTCINDRKLYANCVRHILQLLVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYLHQDVFIINRAFLYGLLQLFEEHKHLGMIGMVGAQYVPPTGVWNEGRGIVGKVIGYMNDLFYMASLEQPYHESKTFIPVECIDGLLMATQYDVPWREDLFDGFDFYDVSQSFEFKKAGYTVGVPVQRDAWCIHYHFDVNMTNYEKYRKIFVEHYMSDVNKEE
>NZ_CP020723.1|WP_000651527.1|1177744_1178425_+|streptomycin-biosynthesis-protein-StrF
MKDHTILVVVCVNNEELFKQCESQIRNIFVPPGYVVQIFPIRDAQSMASAYNRALSYPAKYKVYIHQDTYLINRDMFSTLISLFKENEKLGLIGVAGAQFLPNNGIWWEGKNLVGKVIEYRRRNYQLLNLDQVFYGNQPFLSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQANLWCIHYNGDEFDADTYEKYRKVFVEHYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP020723_1	1.3\|1168321\|17\|NZ_CP020723\|CRISPRCasFinder	1168321-1168337	17	NZ_CP020723.1	2060613-2060629	0	1.0

1. spacer 1.3|1168321|17|NZ_CP020723|CRISPRCasFinder matches to position: 2060613-2060629, mismatch: 0, identity: 1.0

aaagaaccttttgcatg	CRISPR spacer
aaagaaccttttgcatg	Protospacer
*****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

268750 : 276700

uncultured_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|268750_269035_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029999.1\|269073_270708_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_162837124.1\|271112_272654_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	3.4e-21	31.2
WP_087931189.1\|273038_274364_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.1e-44	29.5
WP_000929883.1\|274509_275211_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-40	36.9
WP_070172022.1\|275194_276700_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	2.7e-31	29.1

DBSCAN-SWA_2

321730 : 330107

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625683.1\|321730_323038_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.4e-21	25.3
WP_001170540.1\|323126_323846_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.0e-48	43.9
WP_000278820.1\|323838_324093_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|324089_324773_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055577.1\|324756_326976_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.7e-162	41.2
WP_000879029.1\|326960_328376_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-55	35.4
WP_001262436.1\|328482_329523_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	9.4e-68	46.4
WP_000088592.1\|329519_330107_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	37.1

DBSCAN-SWA_3

1846452 : 1854606

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755513.1\|1846452_1847739_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5
WP_001194306.1\|1847838_1848603_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453867.1\|1848843_1850604_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.4e-273	98.2
WP_000612414.1\|1850689_1851367_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-122	99.1
WP_001231622.1\|1851363_1852437_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-186	97.8
WP_000818985.1\|1852726_1853446_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_001258503.1\|1853733_1854606_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	5.6e-66	45.5

DBSCAN-SWA_4

1907076 : 1957151

Bacillus_phage(20.0%)

portal,coat,capsid,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061536216.1\|1907076_1907619_+\|terminase	P27 family phage terminase small subunit	NA	NA	NA	NA
WP_061536215.1\|1907620_1907878_+	hypothetical protein	NA	NA	NA	NA
WP_061536214.1\|1907901_1909203_+\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	3.8e-82	40.0
WP_087931642.1\|1909180_1910872_+\|capsid	phage major capsid protein	A0A1I9KK60	Lactobacillus_phage	5.5e-57	27.7
WP_061536213.1\|1911035_1911344_-	hypothetical protein	NA	NA	NA	NA
WP_061536212.1\|1911572_1911794_+	hypothetical protein	NA	NA	NA	NA
WP_061536211.1\|1911887_1913393_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	4.6e-47	29.7
WP_061536210.1\|1913521_1914829_+	hypothetical protein	NA	NA	NA	NA
WP_001990338.1\|1915065_1916946_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_000648331.1\|1917062_1917350_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.2e-11	54.1
WP_001089035.1\|1917624_1918575_+\|protease	serine protease	A0A127AWU5	Bacillus_phage	1.5e-96	58.1
WP_001259894.1\|1918615_1918924_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_087931643.1\|1919031_1919967_+	aldo/keto reductase	NA	NA	NA	NA
WP_087931644.1\|1920015_1921191_+	MFS transporter	NA	NA	NA	NA
WP_000162601.1\|1921379_1921604_-	hypothetical protein	NA	NA	NA	NA
WP_000426313.1\|1921688_1922036_-	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_001018097.1\|1922232_1922760_+	DinB family protein	NA	NA	NA	NA
WP_001073056.1\|1922939_1923989_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_000533104.1\|1924193_1926176_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.0e-27	32.6
WP_000539566.1\|1926373_1926679_+	hypothetical protein	NA	NA	NA	NA
WP_000965075.1\|1926930_1927299_+	DUF3979 family protein	NA	NA	NA	NA
WP_001990330.1\|1927333_1928374_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_000105198.1\|1928615_1929059_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	3.6e-45	62.1
WP_000488190.1\|1929165_1929621_+	DUF3939 domain-containing protein	NA	NA	NA	NA
WP_000798304.1\|1929845_1930790_+	hypothetical protein	NA	NA	NA	NA
WP_000594069.1\|1930835_1931837_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_000805513.1\|1931942_1932134_-	DUF3896 domain-containing protein	NA	NA	NA	NA
WP_139871799.1\|1932311_1933775_+	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	1.5e-15	21.3
WP_001068756.1\|1933859_1934444_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000442794.1\|1934468_1935371_-	aldo/keto reductase	NA	NA	NA	NA
WP_000613449.1\|1935535_1936486_+	GTP-binding protein	NA	NA	NA	NA
WP_000172428.1\|1936582_1937053_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_113711484.1\|1937439_1937832_-	hypothetical protein	NA	NA	NA	NA
WP_087931645.1\|1938297_1939248_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001997329.1\|1939527_1939665_+	hypothetical protein	NA	NA	NA	NA
WP_001042754.1\|1939780_1940440_+	oxidoreductase	NA	NA	NA	NA
WP_087931646.1\|1940469_1941507_-	NADPH dehydrogenase NamA	NA	NA	NA	NA
WP_000283894.1\|1941640_1942093_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	7.0e-28	41.7
WP_087931647.1\|1942100_1943114_+	DUF2628 domain-containing protein	NA	NA	NA	NA
WP_087931648.1\|1943190_1944852_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000911694.1\|1944910_1945327_+	FosB/FosD family fosfomycin resistance bacillithiol transferase	Q2LI91	Bacillus_phage	2.1e-39	64.0
WP_087931649.1\|1945339_1945885_+	short-chain dehydrogenase	NA	NA	NA	NA
WP_087931650.1\|1945897_1946509_+	phosphoserine phosphatase 1	NA	NA	NA	NA
WP_000817501.1\|1946564_1947143_-	exosporium protein ExsB	NA	NA	NA	NA
WP_087931651.1\|1947324_1948401_+\|coat	spore coat protein CotH	NA	NA	NA	NA
WP_071730029.1\|1948506_1949124_+	NUDIX hydrolase	NA	NA	NA	NA
WP_000881208.1\|1949228_1949831_+	DedA family protein	NA	NA	NA	NA
WP_000678838.1\|1949928_1951308_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_000932393.1\|1951492_1952434_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_000418724.1\|1952632_1953529_+	permease	NA	NA	NA	NA
WP_000488047.1\|1953532_1954402_+	TIGR03943 family protein	NA	NA	NA	NA
WP_151909238.1\|1954597_1955104_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_000505094.1\|1955230_1955317_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_151909240.1\|1955477_1956662_+	cardiolipin synthase	NA	NA	NA	NA
WP_000340551.1\|1956692_1957151_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_5

2638081 : 2694265

Bacillus_phage(25.0%)

coat,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000125195.1\|2638081_2638948_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001004301.1\|2638967_2639711_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_000546561.1\|2639895_2640279_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_087931915.1\|2640304_2642422_-	DNA helicase RecQ	A0A1V0SDA9	Indivirus	2.8e-82	32.1
WP_000606465.1\|2643035_2643437_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.8e-51	72.0
WP_087931916.1\|2643442_2644522_+\|transposase	transposase	A0A0H3V0V2	Geobacillus_virus	1.9e-15	32.3
WP_000287713.1\|2645260_2645884_+	hypothetical protein	NA	NA	NA	NA
WP_000606238.1\|2646012_2646369_+	hypothetical protein	NA	NA	NA	NA
WP_087931917.1\|2646502_2646955_+	hypothetical protein	NA	NA	NA	NA
WP_001253252.1\|2647454_2647904_-	hypothetical protein	NA	NA	NA	NA
WP_000790449.1\|2648200_2648398_+	DUF4017 family protein	NA	NA	NA	NA
WP_087931918.1\|2648416_2650063_-	M3 family oligoendopeptidase	NA	NA	NA	NA
WP_000416849.1\|2650168_2651098_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
WP_000850061.1\|2651259_2651925_-	lytic polysaccharide monooxygenase	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.1e-28	42.4
WP_001180581.1\|2652149_2652653_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_086415183.1\|2652758_2653400_+	HD domain-containing protein	NA	NA	NA	NA
WP_170314132.1\|2653466_2653907_-	carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_000436999.1\|2653937_2655428_-	alanine:cation symporter family protein	NA	NA	NA	NA
WP_000958324.1\|2655535_2657020_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_000691465.1\|2657038_2657935_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_001025549.1\|2657957_2658899_-	proline racemase family protein	NA	NA	NA	NA
WP_001260276.1\|2658895_2659933_-	proline racemase family protein	NA	NA	NA	NA
WP_087931919.1\|2659929_2661105_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_087931920.1\|2661285_2662947_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_000182234.1\|2663021_2663294_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_000087058.1\|2663290_2663623_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_001000586.1\|2663619_2664855_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000447750.1\|2664879_2665188_-	YxcD family protein	NA	NA	NA	NA
WP_000914472.1\|2665175_2665625_-	hypothetical protein	NA	NA	NA	NA
WP_000447236.1\|2665882_2666647_+	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_000254812.1\|2666881_2667487_+	DedA family protein	NA	NA	NA	NA
WP_087931921.1\|2667524_2668013_-	DinB family protein	NA	NA	NA	NA
WP_000558700.1\|2668152_2668377_+	hypothetical protein	NA	NA	NA	NA
WP_000782322.1\|2668416_2669598_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_087931922.1\|2669864_2670392_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714965.1\|2670509_2672132_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000755450.1\|2672152_2673154_-	C40 family peptidase	A0A0A8WF62	Clostridium_phage	4.3e-25	46.0
WP_149885347.1\|2673193_2674255_-	dipeptide epimerase	NA	NA	NA	NA
WP_000271324.1\|2674398_2674725_-	DUF3870 domain-containing protein	NA	NA	NA	NA
WP_001228716.1\|2674984_2675341_-	septum formation initiator family protein	NA	NA	NA	NA
WP_087931924.1\|2675730_2675895_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_000942267.1\|2676008_2676440_+	cytidine deaminase	NA	NA	NA	NA
WP_000789033.1\|2676697_2676928_-	hypothetical protein	NA	NA	NA	NA
WP_001262612.1\|2677240_2677504_-	hypothetical protein	NA	NA	NA	NA
WP_000490888.1\|2677691_2678456_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_087931925.1\|2679001_2680795_-	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
WP_087931926.1\|2681010_2682387_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.2e-15	27.3
WP_087931927.1\|2682379_2683027_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.2e-34	36.5
WP_087931928.1\|2683148_2683565_+	hypothetical protein	NA	NA	NA	NA
WP_087931929.1\|2683711_2684158_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000910329.1\|2684426_2685131_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_001079708.1\|2685183_2686563_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_087931930.1\|2686580_2687330_-	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_087931931.1\|2687342_2688926_-	oligoendopeptidase F	NA	NA	NA	NA
WP_000402336.1\|2689261_2690533_-	helix-turn-helix domain-containing protein	A0A1W6JPB6	Staphylococcus_phage	8.1e-05	31.6
WP_000498065.1\|2690961_2691165_+	hypothetical protein	NA	NA	NA	NA
WP_000538286.1\|2691365_2692226_-	DegV family protein	NA	NA	NA	NA
WP_000361679.1\|2692688_2693141_-\|coat	spore coat protein	NA	NA	NA	NA
WP_000342253.1\|2693155_2693356_-\|coat	spore coat protein W	NA	NA	NA	NA
WP_087931932.1\|2693716_2694265_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_6

3331768 : 3342674

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000966324.1\|3331768_3332326_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	4.4e-40	50.7
WP_000570190.1\|3333685_3333925_-	hypothetical protein	A0A0A7AR38	Bacillus_phage	2.2e-25	73.4
WP_087932197.1\|3333924_3334161_-	hemolysin XhlA family protein	A0A2H4J382	uncultured_Caudovirales_phage	1.5e-10	79.5
WP_000185566.1\|3334239_3334536_-	hypothetical protein	NA	NA	NA	NA
WP_001051362.1\|3334919_3335882_-	M23 family metallopeptidase	A0A2D0WXW0	Clostridium_phage	4.4e-11	39.3
WP_000025238.1\|3335988_3337107_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.9e-34	44.3
WP_087932198.1\|3337505_3338558_-	glycoside hydrolase family 25	A7KV11	Bacillus_phage	5.2e-66	47.9
WP_000525559.1\|3338690_3339707_-	lysozyme family protein	A0A1B1PAK0	Bacillus_phage	9.0e-31	36.4
WP_087932199.1\|3339944_3340331_-	hypothetical protein	A0A288WG73	Bacillus_phage	9.8e-47	71.0
WP_087932200.1\|3340431_3341334_-	DnaD domain protein	A0A1C8E9B4	Bacillus_phage	5.1e-70	61.3
WP_000527104.1\|3341420_3341657_-	helix-turn-helix transcriptional regulator	W8CYU0	Bacillus_phage	2.4e-11	56.9
WP_000579786.1\|3341794_3342223_+	helix-turn-helix transcriptional regulator	Q786F1	Bacillus_phage	2.1e-29	50.7
WP_000673786.1\|3342245_3342674_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	1.6e-34	55.1

DBSCAN-SWA_7

3654972 : 3665598

Bacillus_phage(81.82%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053446401.1\|3654972_3655164_-	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	4.6e-21	79.0
WP_087932279.1\|3655240_3655603_-	cell division protein SepF	D2XR47	Bacillus_phage	4.1e-55	89.2
WP_087932280.1\|3655577_3655766_-	hypothetical protein	D2XR45	Bacillus_phage	2.2e-15	83.6
WP_087932281.1\|3655768_3657091_-	replicative DNA helicase	D2XR44	Bacillus_phage	3.8e-231	93.0
WP_087932282.1\|3657087_3658011_-	DnaD domain protein	D2XR43	Bacillus_phage	2.5e-144	84.6
WP_087932283.1\|3658290_3658575_-	hypothetical protein	D2XR42	Bacillus_phage	2.8e-22	53.2
WP_087932284.1\|3658757_3658979_-	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_087932285.1\|3658992_3659580_-	sporulation sigma factor-processing peptidase	D2XR41	Bacillus_phage	3.8e-74	69.7
WP_087932286.1\|3659670_3659919_-	hypothetical protein	NA	NA	NA	NA
WP_087932287.1\|3659952_3660144_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_087932288.1\|3660316_3660754_+	helix-turn-helix domain-containing protein	A0A2P1JU09	Anoxybacillus_phage	8.3e-34	54.5
WP_087932289.1\|3660767_3661208_+	ImmA/IrrE family metallo-endopeptidase	D2XR38	Bacillus_phage	1.1e-62	82.4
WP_087932290.1\|3661219_3662107_+	hypothetical protein	A0A1C8E993	Bacillus_phage	2.8e-52	66.2
WP_087932291.1\|3662180_3662993_+	hypothetical protein	NA	NA	NA	NA
WP_087932292.1\|3663113_3663755_+	hypothetical protein	NA	NA	NA	NA
WP_087932293.1\|3664050_3665598_+	recombinase family protein	I3VYZ3	Thermoanaerobacterium_phage	3.5e-143	53.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage