CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	0 crisprs	NA	0	1
NZ_CP021960	Klebsiella pneumoniae strain AR_0139	1 crisprs	csa3,cas3,DEDDh,WYL,RT,DinG	1	406
NZ_CP021961	Klebsiella pneumoniae strain AR_0139 plasmid tig00000006, complete sequence	0 crisprs	csa3	0	3
NZ_CP021959	Klebsiella pneumoniae strain AR_0139 plasmid tig00000003, complete sequence	0 crisprs	NA	0	1
NZ_CP021962	Klebsiella pneumoniae strain AR_0139 plasmid tig00000008, complete sequence	0 crisprs	DEDDh	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

404 : 68733

Escherichia_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|404_1109_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_012300772.1\|2907_4167_+	chloramphenicol efflux MFS transporter CmlA5	S4TR35	Salmonella_phage	1.7e-26	31.7
WP_000846390.1\|4431_5232_+	oxacillin-hydrolyzing class D beta-lactamase OXA-10	NA	NA	NA	NA
WP_001209508.1\|5248_6040_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000679427.1\|6163_6511_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|6504_7344_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|7748_9290_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000359986.1\|10688_11462_+	ArmA family 16S rRNA (guanine(1405)-N(7))-methyltransferase	NA	NA	NA	NA
WP_077252464.1\|11442_11724_-	hypothetical protein	NA	NA	NA	NA
WP_002026779.1\|11943_12129_-	hypothetical protein	NA	NA	NA	NA
WP_002001451.1\|12177_13362_+\|transposase	IS4-like element ISEc29 family transposase	A0A0F7LAS3	uncultured_marine_virus	4.5e-50	35.4
WP_014386408.1\|13760_15236_+	Msr family ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	6.7e-160	59.0
WP_000155092.1\|15291_16176_+	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001567368.1\|16417_17821_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_001567369.1\|17849_18482_-	hypothetical protein	NA	NA	NA	NA
WP_004896925.1\|18817_19360_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|20244_20949_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001247892.1\|21391_21682_+	nucleotidyltransferase	NA	NA	NA	NA
WP_001293886.1\|21678_22080_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000215515.1\|22069_22426_+	cupin domain-containing protein	NA	NA	NA	NA
WP_001067855.1\|22736_23441_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_014386535.1\|23727_24186_+	hypothetical protein	NA	NA	NA	NA
WP_004099053.1\|25219_26188_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	5.1e-185	98.8
WP_017901247.1\|26642_27854_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_032413259.1\|27940_28894_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.3e-10	24.3
WP_032436702.1\|29050_29899_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_032413262.1\|29922_30594_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032413263.1\|30590_31253_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032413265.1\|31257_32076_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-28	37.8
WP_032413267.1\|32072_33038_+	DMT family transporter	NA	NA	NA	NA
WP_162921933.1\|33457_34156_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_032413414.1\|35722_36559_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_008813494.1\|36624_37023_-	VOC family protein	NA	NA	NA	NA
WP_032414187.1\|37064_38174_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.3e-30	28.8
WP_032413273.1\|38204_38480_-	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_077253746.1\|39733_39844_-	hypothetical protein	Q71TE9	Escherichia_phage	9.0e-06	68.8
WP_157671192.1\|39895_40012_-	hypothetical protein	Q71TE9	Escherichia_phage	4.6e-08	67.6
WP_004118901.1\|40637_41630_-	DsbA family protein	NA	NA	NA	NA
WP_032413277.1\|41626_43216_-	AMP-binding protein	Q75ZG1	Hepacivirus	4.7e-34	25.0
WP_032413280.1\|43252_44659_-	cytosine permease	NA	NA	NA	NA
WP_032436710.1\|47717_49085_-	formimidoylglutamate deiminase	NA	NA	NA	NA
WP_032413289.1\|49183_49945_+	histidine utilization repressor	NA	NA	NA	NA
WP_004118884.1\|49941_50499_+	HutD family protein	NA	NA	NA	NA
WP_162924008.1\|54016_54925_+	urocanate hydratase	NA	NA	NA	NA
WP_004118873.1\|54977_56369_+	cytosine permease	NA	NA	NA	NA
WP_032413295.1\|56380_57589_+	imidazolonepropionase	NA	NA	NA	NA
WP_032413296.1\|57581_58391_+	N-formylglutamate deformylase	NA	NA	NA	NA
WP_077253748.1\|60663_62262_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	6.6e-20	33.0
WP_077253754.1\|62353_62467_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.7e-10	81.1
WP_088295922.1\|65810_66972_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	8.1e-52	42.3
WP_001067855.1\|68028_68733_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021960

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021960_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021960_1

2858228-2858323

Orphan

Consensus_repeat	Method
TTGTGCCAACAGAATGCCAACAGAGTGCCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021960_1

>merge|NZ_CP021960|1|2858228-2858323|CRISPRCasFinder
TTGTGCCAACAGAATGCCAACAGAGTGCCAACGCAAACCCAGTAACCACGCTGCGTACAAGTGAGGTTGTGCCAACAGAATGCCAACAGAGTGCCA

>NZ_CP021960|1|1|2858228-2858323|CRISPRCasFinder
TTGTGCCAACAGAATGCCAACAGAGTGCCA	ACGCAAACCCAGTAACCACGCTGCGTACAAGTGAGG
TTGTGCCAACAGAATGCCAACAGAGTGCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021960.1\|WP_032413853.1\|2863947_2864118_+\|NinE-family-protein	unknown	unknown	gnl\|CDD\|182029
NZ_CP021960.1\|WP_071570777.1\|2855527_2855863_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570685.1\|2864110_2864749_+\|recombination-protein-NinG	unknown	unknown	gnl\|CDD\|368603
NZ_CP021960.1\|WP_071570675.1\|2861864_2862059_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_172825052.1\|2858737_2860153_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274672
NZ_CP021960.1\|WP_071570666.1\|2857694_2857841_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570681.1\|2862940_2863180_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570679.1\|2862606_2862948_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570671.1\|2860442_2861021_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_048986758.1\|2855126_2855330_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570673.1\|2861017_2861248_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570664.1\|2857387_2857609_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|336083
NZ_CP021960.1\|WP_025987689.1\|2856309_2857008_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225484
NZ_CP021960.1\|WP_071570683.1\|2863345_2863942_+\|DUF1367-family-protein	unknown	unknown	gnl\|CDD\|369209
NZ_CP021960.1\|WP_071570660.1\|2853941_2854226_-\|host-nuclease-inhibitor-GamL	unknown	unknown	unknown
NZ_CP021960.1\|WP_071570669.1\|2860152_2860446_+\|protein-ren	unknown	unknown	gnl\|CDD\|238042
NZ_CP021960.1\|WP_004201115.1\|2857119_2857347_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|374243
NZ_CP021960.1\|WP_014342891.1\|2853426_2853762_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_073970525.1\|2854502_2854628_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021960.1\|WP_032717012.1\|2854315_2854510_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021960.1\|WP_172825052.1\|2858737_2860153_+\|AAA-family-ATPase	gnl\|CDD\|274672	TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model. [Mobile and extrachromosomal element functions, Prophage functions].	4.51587e-159
NZ_CP021960.1\|WP_071570664.1\|2857387_2857609_+\|transcriptional-regulator	gnl\|CDD\|336083	pfam05269, Phage_CII, Bacteriophage CII protein. This family consists of several phage CII regulatory proteins. CII plays a key role in the lysis-lysogeny decision in bacteriophage lambda and related phages.	1.33277e-10
NZ_CP021960.1\|WP_071570669.1\|2860152_2860446_+\|protein-ren	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	0.000715769
NZ_CP021960.1\|WP_071570683.1\|2863345_2863942_+\|DUF1367-family-protein	gnl\|CDD\|369209	pfam07105, DUF1367, Protein of unknown function (DUF1367). This family consists of several highly conserved, hypothetical phage proteins of around 200 residues in length. The function of this family is unknown. Some proteins are annotated as IrsA (intracellular response to stress).	1.19988e-79
NZ_CP021960.1\|WP_032413853.1\|2863947_2864118_+\|NinE-family-protein	gnl\|CDD\|182029	PRK09689, PRK09689, prophage protein NinE; Provisional.	2.51328e-20
NZ_CP021960.1\|WP_004201115.1\|2857119_2857347_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|374243	pfam15943, YdaS_antitoxin, Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254.	1.58772e-22
NZ_CP021960.1\|WP_071570685.1\|2864110_2864749_+\|recombination-protein-NinG	gnl\|CDD\|368603	pfam05766, NinG, Bacteriophage Lambda NinG protein. NinG or Rap is involved in recombination. Rap (recombination adept with plasmid) increases lambda-by-plasmid recombination catalyzed by Escherichia coli's RecBCD pathway.	2.49174e-56
NZ_CP021960.1\|WP_025987689.1\|2856309_2857008_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225484	COG2932, COG2932, Predicted transcriptional regulator [Transcription].	3.26539e-27

>NZ_CP021960.1|WP_071570666.1|2857694_2857841_+|hypothetical-protein
MPKSNRFYQAQTHKNVTRDRFVRSVNPMVAEKMRAILEELKRKGEGRE
>NZ_CP021960.1|WP_071570664.1|2857387_2857609_+|transcriptional-regulator
MESSTTRNKLEAQRIESWLHSQISELGTTNIAKVAGVNKSTVSRWRENLLPNMSMLLAILISNRPGEKGDFEA
>NZ_CP021960.1|WP_004201115.1|2857119_2857347_+|helix-turn-helix-domain-containing-protein
MTNKTIQKAIDIAGSQKKLADLCGVAQPTVWRWLHGGGIDARYVMKIVSATNGKIKAAEIRPDLAQLLSAHSPAA
>NZ_CP021960.1|WP_025987689.1|2856309_2857008_-|helix-turn-helix-transcriptional-regulator
MKKETLADRLNEAMASAGMSQGALAKASGIAQPTIWRLVSGNARGSTKIVEIANALGVRSEWLSTGNGPMRDDGQLPRAAQVKSQDTDAFRIDVLDLMVSAGPGIVNQEFVEILRSVEYEPAEARHMFDGRKAESIRIINVRGDSMSGTIEPGDLLFVDISVKSFDGDGIYAFLYDDTAHVKRLQKMKDKLLVISDNKSYAAWDPIEKDEMNRVLVFGKVIGSMPQTYRKHG
>NZ_CP021960.1|WP_071570777.1|2855527_2855863_-|hypothetical-protein
MKLVVVNNQDLGSSADEIKLNSVKIAVINLIAFVIRSFDQHGMDMLSKIVDPSLEELEEIITELEKEAQQHDDINLKQALLLSQMLINDIRQKNPELCAQSSTMLSNLQIF
>NZ_CP021960.1|WP_048986758.1|2855126_2855330_+|hypothetical-protein
MSNEDEFFAEMHPQIAQVIGIAVMQLLVERREPSREALIEMIQVLWQGDQVDLAVELALDVLMLREE
>NZ_CP021960.1|WP_073970525.1|2854502_2854628_-|hypothetical-protein
MLGCRMSKQGIRSLIYCLLICGVIWTALIIKILHVTGVFNG
>NZ_CP021960.1|WP_032717012.1|2854315_2854510_-|hypothetical-protein
MANSIPNSGRAVMMRNRRTGAAWLVSFDYRDGSYWHEPQGNLRHIRRPYASRSIEPNLVPAGTH
>NZ_CP021960.1|WP_071570660.1|2853941_2854226_-|host-nuclease-inhibitor-GamL
MNAYRAYDVIEERKWAEQTLSEEKEKWIDDRAKEVFDSLPEDPYAALRQSASSRAFPYEGLRSDKAGEVYNDLRTAIAYAQAEYDWDHRTGCPF
>NZ_CP021960.1|WP_014342891.1|2853426_2853762_-|hypothetical-protein
MRPGEKLKPMILNATNSKMLKSITGSPFLEDWVGVKVTVYVDKNVRFGKESVEGLRLSPARVSKPVLSPEKTQAWNNAKAAFKRDGNLDAVLARMDISPEHRRQLEQECSA
>NZ_CP021960.1|WP_172825052.1|2858737_2860153_+|AAA-family-ATPase
MTPPHSIEAEQSVLGGLLLDDDSSERTQKVLSILKPESFYSRQHQVIFAEMRQMYRDHKPVDLLTLFDALESKGLTETVGGFAYLAEMSKNTPSAANIVAYAMRVRETAMERYGIEKTTKAIELLYARNGMTAEQKFDAIQGLFTEITEHVKTGRRTGLRTFYDAVNDWSNEFDDRMKPDGRSRGLSTGIRSLDELLGVKRIVRGSLFVIGARPKMGKTTLYTQMGVNCATVENEPALMFSLEMPEGQMVEKITAQKGRISPNLFYPDMTKDDYGYRGDWNGDLKKATGVMGALIDTNNLLIDDTPGISLAHVMAESRRIKRERGKVGMILVDYLTLMTADKAERNDLAYGLITKGLKTLAKELDCVVVLLTQLNRELEKRTNKRPLPSDSRDTGQIEQDCDYWLAIYREGAYDENANQSDTELLLRLNRHGETGVVYCEQRHGAIYDCDQEAASQRRREKEQKPTKRGGF
>NZ_CP021960.1|WP_071570669.1|2860152_2860446_+|protein-ren
MTGKDAILNYLKTHKTCSSPDVAAASGMTHTCINQAANILAKHGVLVAEARVWRTVYYRLATEEEIAGRKSTNQIFNECRQSPAMKRVLAVYGRTSA
>NZ_CP021960.1|WP_071570671.1|2860442_2861021_+|hypothetical-protein
MTITLQAVNELIQSLESAGELSIREQKFLKLAKAYQQLAAENARYSMSAGHADQRMAESRAVRSALGFNPDADDVSPSDLVEAINQTVAELCVIRTAHPQPLGSAMDAAIDAFNAEEMPETGMLNAYFILRDSIRIPTPATDRIVAGIKADGVEEFVSNTVHKIFDESDAVSALAYLSLANSHVKQLREGAK
>NZ_CP021960.1|WP_071570673.1|2861017_2861248_+|hypothetical-protein
MSNEQMKMAIAKQLNIALQSLNAPVELLCIVGSYGDTQTDSDVLEALEQHNERGTCMEEIIAPAFTWSSKEARHDN
>NZ_CP021960.1|WP_071570675.1|2861864_2862059_+|hypothetical-protein
MAEKSSLERLQEINADNQRRVTVNVGVLKAARREIQAHVKLNGKGIMTDMVLNSLNAIIEGANQ
>NZ_CP021960.1|WP_071570679.1|2862606_2862948_+|hypothetical-protein
MKAKLLLIRNQLRMGNRLSFAEAMLLQRVIDVFVYQAGNSPAHSGLCPEQSGVSPAQDGNSPVIPDGYVMVPKEPTKEMIDAGWLYFMGTKNPSSKGAYKAMLAAATQEVKGE
>NZ_CP021960.1|WP_071570681.1|2862940_2863180_+|hypothetical-protein
MSKAELFQNLQALTTDFHTLACELDIGDERTEVFEMYEVLRRIQRRGAASEMLAATNPLLCPGIADDEDWVDFDDEDDD
>NZ_CP021960.1|WP_071570683.1|2863345_2863942_+|DUF1367-family-protein
MAQTLQFEKSYQNVLIPAEPGTSEYLQLIPVGQLLCGEFRKPRNYAFHKKFFKLLTLGYHYWTPSGGLIEPAERTLISGFIDFLSSDFDQRAALQNAAEEYLSSVGISRSRDMALLKHFESFREWATIQAGFYDEYQMPDGSRRRVAKSISFASMDDSQFNGVYKSVLNVLWNYILRRKFHSPAEAENAASQLLSFAG
>NZ_CP021960.1|WP_032413853.1|2863947_2864118_+|NinE-family-protein
MQCLLAKVMERGIFRVPARRKRKVEVKPSDIPTLKDYTARLVDKKWLRLRARRPHA
>NZ_CP021960.1|WP_071570685.1|2864110_2864749_+|recombination-protein-NinG
MRKPARRKCAHCREWFHPAREGQVVCSFECASAIGKKQTAKAREAAKARAVKRQRESEKEGRQRRRAKRESFKTKAQWDKEAQSAFNRYIRIRDEGKPCVSCGNPLIGKSNYLTGSAIDASHYRSRGAASHLKFNVFNVHSACTRCNRQLSGNAVEYRIHLIERIGLARVERLEADNEPRRFDIPYLQRIKSIFTRRARALEKRRAHHQEVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP021960_1	1.1\|2858258\|36\|NZ_CP021960\|CRISPRCasFinder	2858258-2858293	36	NZ_CP026278	Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence	8602-8637	0	1.0

1. spacer 1.1|2858258|36|NZ_CP021960|CRISPRCasFinder matches to NZ_CP026278 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-0e8e, complete sequence) position: , mismatch: 0, identity: 1.0

acgcaaacccagtaaccacgctgcgtacaagtgagg	CRISPR spacer
acgcaaacccagtaaccacgctgcgtacaagtgagg	Protospacer
************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 77072

100

Escherichia_phage(18.31%)

capsid,tRNA,portal,terminase,protease,tail,integrase,head

attL 32117:32133|attR 61993:62009

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188930.1\|614_1592_+	flagella biosynthesis regulator Flk	NA	NA	NA	NA
WP_004149211.1\|1678_2854_-	MFS transporter	NA	NA	NA	NA
WP_002913291.1\|3063_4284_-	beta-ketoacyl-ACP synthase I	NA	NA	NA	NA
WP_004151101.1\|4442_6431_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_002913338.1\|6492_6774_-	YfcL family protein	NA	NA	NA	NA
WP_002913339.1\|6805_7354_-	elongation factor P hydroxylase	NA	NA	NA	NA
WP_002913340.1\|7353_8163_-	TSUP family transporter	NA	NA	NA	NA
WP_002913341.1\|8162_8984_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
WP_002913342.1\|8986_10072_-	chorismate synthase	A0A291AU41	Pandoravirus	4.5e-89	46.6
WP_002913346.1\|10113_11046_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_002913348.1\|11213_11765_+	endonuclease SmrB	NA	NA	NA	NA
WP_002913355.1\|11785_12271_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
WP_023278783.1\|12480_14625_-	fatty acid oxidation complex subunit alpha FadJ	NA	NA	NA	NA
WP_002913358.1\|14624_15935_-	acetyl-CoA C-acyltransferase FadI	NA	NA	NA	NA
WP_002913359.1\|16094_16379_-	YfcZ/YiiS family protein	NA	NA	NA	NA
WP_002913360.1\|16752_18075_+	long-chain fatty acid transporter FadL	NA	NA	NA	NA
WP_002913362.1\|18136_18898_-	phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
WP_002913363.1\|19187_20117_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	4.4e-133	81.1
WP_135651627.1\|20744_21980_-	hypothetical protein	NA	NA	NA	NA
WP_031280381.1\|23279_23726_+	hypothetical protein	NA	NA	NA	NA
WP_004184721.1\|23631_23889_-	hypothetical protein	A0A286N2Q3	Klebsiella_phage	1.3e-42	100.0
WP_004899672.1\|24201_24780_-	DUF1133 family protein	A0A0U2S606	Escherichia_phage	7.6e-51	57.2
WP_065808870.1\|24793_25774_-	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.1e-134	66.9
WP_071570941.1\|25786_26164_-	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	6.7e-48	72.8
WP_071570942.1\|26173_26983_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	5.3e-111	70.0
WP_071570943.1\|26979_27894_-	conserved phage C-terminal domain-containing protein	H2DE83	Erwinia_phage	2.4e-30	57.3
WP_071557781.1\|27850_28063_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	6.4e-16	70.9
WP_004213338.1\|28300_28762_-	hypothetical protein	K7PJS5	Enterobacterial_phage	1.7e-69	88.2
WP_016530206.1\|28787_28985_-	Cro/Cl family transcriptional regulator	H9C161	Pectobacterium_phage	2.7e-16	66.1
WP_016530207.1\|29077_29737_+	helix-turn-helix domain-containing protein	H9C160	Pectobacterium_phage	7.3e-74	62.7
WP_065954001.1\|30284_30584_+	hypothetical protein	K7PJS4	Enterobacterial_phage	5.5e-13	46.7
WP_071570944.1\|30583_31369_+	hypothetical protein	A4JX52	Burkholderia_virus	9.9e-62	50.6
WP_019705292.1\|31365_31569_+	hypothetical protein	A0A2R2Z313	Escherichia_phage	2.6e-30	92.5
WP_071033563.1\|31561_31801_+	hypothetical protein	A0A2R2Z309	Escherichia_phage	3.2e-32	86.1
WP_046878918.1\|31797_31998_+	hypothetical protein	A0A1U8QWK2	Salmonella_phage	7.9e-08	52.5
WP_071570945.1\|31990_32512_+	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	1.6e-44	84.7
32117:32133	attL	NA	NA	NA	NA
WP_071570946.1\|33123_33987_+	hypothetical protein	I6PD67	Cronobacter_phage	1.1e-34	35.4
WP_071570947.1\|34012_35182_-\|integrase	site-specific integrase	A0A2R2Z2Y0	Escherichia_phage	1.4e-200	85.0
WP_071570948.1\|35613_36774_+\|integrase	tyrosine-type recombinase/integrase	Q716F9	Shigella_phage	6.1e-193	85.6
WP_071570949.1\|36821_37088_-	hypothetical protein	NA	NA	NA	NA
WP_071570951.1\|39251_42335_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	71.8
WP_071570952.1\|42331_42712_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	4.6e-57	79.4
WP_021313618.1\|42721_43207_-	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	3.0e-53	66.2
WP_023301979.1\|43193_43667_-	hypothetical protein	A0A286S298	Klebsiella_phage	4.6e-54	60.8
WP_071570953.1\|43687_47071_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	7.8e-305	58.2
WP_016530182.1\|47131_47365_-	hypothetical protein	K7PH16	Enterobacteria_phage	1.9e-08	47.2
WP_032409576.1\|47438_47735_-	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	2.5e-26	63.9
WP_021313622.1\|47746_48151_-\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	8.5e-33	57.7
WP_071570954.1\|48181_48886_-	immunoglobulin domain-containing protein	K7PHL2	Enterobacterial_phage	2.1e-79	66.5
WP_016530186.1\|48942_49290_-	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	2.8e-32	63.7
WP_019705270.1\|49286_49736_-	HK97 gp10 family phage protein	Q9MCS9	Enterobacteria_phage	6.7e-63	82.6
WP_032408655.1\|49732_50071_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	1.4e-41	74.1
WP_021313626.1\|50079_50400_-\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	4.8e-15	43.1
WP_021313627.1\|50396_50600_-	hypothetical protein	M1FN89	Enterobacteria_phage	1.4e-07	42.4
WP_071570955.1\|50638_51847_-\|capsid	phage major capsid protein	A0A192Y5T6	Salmonella_phage	2.2e-193	84.2
WP_004884313.1\|51861_52515_-\|head,protease	HK97 family phage prohead protease	Q8W628	Enterobacteria_phage	2.1e-105	87.4
WP_071570956.1\|52501_53731_-\|portal	phage portal protein	U5P411	Shigella_phage	6.5e-201	81.2
WP_032418747.1\|53925_55656_-\|terminase	terminase large subunit	Q8HAD6	Salmonella_phage	9.2e-302	83.4
WP_004884285.1\|55652_56147_-\|terminase	phage terminase small subunit P27 family	Q8HAD7	Salmonella_phage	1.2e-81	92.0
WP_023302592.1\|56277_56628_-	HNH endonuclease	K7PHK9	Enterobacteria_phage	7.1e-52	80.2
WP_157671193.1\|56642_56945_+	hypothetical protein	NA	NA	NA	NA
WP_071570957.1\|57015_57405_-	DUF2570 domain-containing protein	S5FKR3	Shigella_phage	1.2e-23	48.4
WP_032428584.1\|57401_57926_-	lysozyme	I6PBN2	Cronobacter_phage	4.2e-48	61.7
WP_048964767.1\|57909_58230_-	hypothetical protein	O64361	Escherichia_phage	3.1e-22	51.1
WP_071570958.1\|58719_59409_-	antiterminator	I6PDF8	Cronobacter_phage	1.2e-63	55.8
WP_162879749.1\|59405_59543_-	hypothetical protein	NA	NA	NA	NA
WP_071570686.1\|59535_59736_-	hypothetical protein	NA	NA	NA	NA
WP_071570685.1\|59732_60371_-	recombination protein NinG	H6WRY9	Salmonella_phage	1.2e-73	68.4
WP_032413853.1\|60363_60534_-	NinE family protein	G8C7V4	Escherichia_phage	2.8e-14	71.4
WP_071570859.1\|60539_61136_-	DUF1367 family protein	A0A0U2RT94	Escherichia_phage	3.6e-56	54.3
WP_172825048.1\|61299_61470_-	hypothetical protein	NA	NA	NA	NA
WP_088295931.1\|61469_62024_-	DUF551 domain-containing protein	R9TQX3	Aeromonas_phage	2.7e-37	50.0
61993:62009	attR	NA	NA	NA	NA
WP_023301661.1\|62122_62302_-	hypothetical protein	NA	NA	NA	NA
WP_071570861.1\|62298_62751_-	ead/Ea22-like family protein	A0A077SLK5	Escherichia_phage	3.9e-10	37.9
WP_141770835.1\|62747_62963_-	hypothetical protein	NA	NA	NA	NA
WP_071570959.1\|62959_63418_-	hypothetical protein	K7P858	Enterobacteria_phage	8.7e-18	40.7
WP_071570960.1\|63414_63708_-	protein ren	O48423	Enterobacteria_phage	2.5e-26	65.6
WP_023283974.1\|63707_64298_-	hypothetical protein	I3PUZ9	Vibrio_phage	9.2e-36	40.5
WP_071570961.1\|64297_65317_-	replication protein	S4TNJ9	Salmonella_phage	4.4e-62	79.5
WP_032700425.1\|65392_65647_-	hypothetical protein	NA	NA	NA	NA
WP_032693607.1\|65646_65868_-	bacteriophage CII family protein	G8EYH8	Enterobacteria_phage	9.1e-05	41.7
WP_071570962.1\|65907_66153_-	hypothetical protein	A0A088CE43	Shigella_phage	7.7e-29	82.2
WP_071570963.1\|66237_66999_+	helix-turn-helix transcriptional regulator	A0A088CBP2	Shigella_phage	1.5e-99	66.5
WP_065799714.1\|67114_68038_+	hypothetical protein	A0A1R3Y6Z6	Salmonella_virus	6.0e-175	95.1
WP_071570964.1\|68074_68278_-	hypothetical protein	A0A192Y6Q5	Salmonella_phage	6.6e-18	68.7
WP_009652632.1\|68603_68729_+	hypothetical protein	NA	NA	NA	NA
WP_004151303.1\|68721_68916_+	hypothetical protein	NA	NA	NA	NA
WP_071570965.1\|69003_69975_+	hypothetical protein	A0A077KCC0	Edwardsiella_phage	1.7e-39	77.7
WP_071570966.1\|69982_70267_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.5e-39	78.7
WP_074182335.1\|70473_70782_+	hypothetical protein	A0A0F7L7F5	uncultured_marine_virus	3.8e-09	33.3
WP_071570968.1\|70778_71402_+	YqaJ viral recombinase family protein	S0A2A9	Cellulophaga_phage	7.9e-46	48.6
WP_016529279.1\|71398_71557_+	DUF1317 family protein	A0A0N7CHV0	Escherichia_phage	6.7e-10	58.8
WP_042935507.1\|71553_72081_+	phage N-6-adenine-methyltransferase	Q9ZWX6	Enterobacteria_phage	8.4e-57	61.0
WP_071570969.1\|72077_72848_+	dcm methylase	D5LH17	Escherichia_phage	2.1e-64	51.6
WP_004151314.1\|72844_73063_+	hypothetical protein	A0A1I9LJM7	Stx_converting_phage	1.2e-09	47.2
WP_023301637.1\|73294_73495_+	transcriptional regulator	K7P7V0	Enterobacteria_phage	3.7e-29	86.4
WP_002913367.1\|73831_74314_+	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
WP_023158760.1\|74681_75563_+	hypothetical protein	A0A2H4JEC4	uncultured_Caudovirales_phage	1.5e-05	56.8
WP_002913369.1\|75572_76481_-	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	7.8e-10	24.2
WP_002913370.1\|76613_77072_+	nucleoside deaminase	A0A0B5J096	Pandoravirus	1.2e-11	32.3

DBSCAN-SWA_2

80342 : 82789

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004149230.1\|80342_82040_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-47	28.5
WP_002913374.1\|82051_82789_+	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	1.5e-14	26.3

DBSCAN-SWA_3

97279 : 107206

Lactobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913438.1\|97279_98206_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	4.1e-06	23.3
WP_002913439.1\|98294_99293_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_002913440.1\|99289_99508_-	DUF3820 family protein	NA	NA	NA	NA
WP_002913442.1\|99509_101525_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	2.8e-145	42.5
WP_004151995.1\|101594_102656_-	cell division protein ZipA	NA	NA	NA	NA
WP_071570971.1\|102886_103648_+	sulfate transporter CysZ	NA	NA	NA	NA
WP_002913498.1\|103824_104796_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	3.3e-75	51.3
WP_002913505.1\|105176_105434_+	phosphocarrier protein Hpr	NA	NA	NA	NA
WP_002913506.1\|105478_107206_+	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	3.3e-17	31.6

DBSCAN-SWA_4

110814 : 112939

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145610.1\|110814_111726_-	cysteine synthase CysM	A0A1W6JHY1	Lactococcus_phage	2.2e-52	40.3
WP_002913623.1\|111844_112939_-	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	1.6e-30	39.4

DBSCAN-SWA_5

116292 : 119869

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145614.1\|116292_117192_-	Dyp-type peroxidase	S4VVJ7	Pandoravirus	3.8e-25	32.6
WP_002913630.1\|117286_117862_-	RpoE-regulated lipoprotein	NA	NA	NA	NA
WP_002913635.1\|117923_118373_-	DUF2919 domain-containing protein	NA	NA	NA	NA
WP_002913637.1\|118359_118785_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_002913639.1\|118996_119869_+	N-acetylmuramoyl-L-alanine amidase AmiA	A0A0N9SGH1	Paenibacillus_phage	2.2e-17	31.9

DBSCAN-SWA_6

154768 : 155482

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913801.1\|154768_155482_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	1.1e-38	35.7

DBSCAN-SWA_7

162126 : 165121

Sodalis_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913812.1\|162126_163038_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	3.5e-74	58.8
WP_020947395.1\|163034_163736_-	DnaA inactivator Hda	NA	NA	NA	NA
WP_002913824.1\|163834_165121_-	uracil permease	Q9KX94	Enterobacteria_phage	1.9e-65	38.1

DBSCAN-SWA_8

168660 : 170336

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913836.1\|168660_169698_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	8.2e-72	44.5
WP_004152007.1\|169694_170336_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.2e-28	41.1

DBSCAN-SWA_9

176765 : 176939

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004174861.1\|176765_176939_+	DUF2633 family protein	G9L6F2	Escherichia_phage	1.4e-16	78.8

DBSCAN-SWA_10

180708 : 207866

Morganella_phage(25.0%)

integrase

attL 188782:188802|attR 208084:208104

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152009.1\|180708_182577_+	sulfatase-like hydrolase/transferase	A0A2P0VMN7	Tetraselmis_virus	2.6e-07	22.6
WP_004151979.1\|182671_184249_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_004151980.1\|184316_185783_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-87	38.7
WP_071570975.1\|185941_187333_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	6.3e-35	33.0
WP_004144303.1\|187316_187535_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_004151982.1\|187584_188664_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
188782:188802	attL	NA	NA	NA	NA
WP_032410641.1\|189771_190020_+	AlpA family phage regulatory protein	T1SA17	Salmonella_phage	1.2e-26	72.8
WP_050543111.1\|190033_190408_+	hypothetical protein	A0A193GYJ9	Enterobacter_phage	7.4e-23	46.5
WP_009307977.1\|190601_191234_+	hypothetical protein	NA	NA	NA	NA
WP_032451338.1\|191524_191908_-	hypothetical protein	NA	NA	NA	NA
WP_044294525.1\|191910_194478_-	hypothetical protein	W6MWW8	Pseudomonas_phage	1.6e-180	41.7
WP_071570977.1\|194470_196198_-	hypothetical protein	NA	NA	NA	NA
WP_071570978.1\|196197_198894_-	transglycosylase SLT domain-containing protein	K4NWI2	Pseudomonas_phage	7.2e-35	28.4
WP_032451337.1\|198934_199231_-	hypothetical protein	NA	NA	NA	NA
WP_009307973.1\|199321_199486_-	hypothetical protein	NA	NA	NA	NA
WP_009307971.1\|200087_200531_-	single-stranded DNA-binding protein	NA	NA	NA	NA
WP_071570979.1\|200714_203477_-	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	8.9e-291	55.9
WP_032436819.1\|203473_203695_-	hypothetical protein	NA	NA	NA	NA
WP_032436820.1\|203687_204464_-	host cell division inhibitor Icd-like protein	A0A1C9IHV9	Salmonella_phage	2.3e-18	55.8
WP_032436821.1\|204460_204640_-	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_032436822.1\|204639_205236_-	antirepressor protein	A0A1W6JPH8	Morganella_phage	1.1e-55	58.7
WP_057072140.1\|205397_205616_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_032436823.1\|205702_206509_-	hypothetical protein	A0A2H4JEC4	uncultured_Caudovirales_phage	5.9e-09	40.0
WP_032436824.1\|206612_207866_-\|integrase	site-specific integrase	A0A1W6JPG6	Morganella_phage	1.8e-145	60.0
208084:208104	attR	NA	NA	NA	NA

DBSCAN-SWA_11

216955 : 217387

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004144312.1\|216955_217387_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.7e-18	38.6

DBSCAN-SWA_12

227899 : 234220

Mycoplasma_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913953.1\|227899_229186_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	9.9e-35	37.8
WP_002913954.1\|229256_229457_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_002913956.1\|229458_229794_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_004151987.1\|229795_231646_-	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	1.9e-103	39.5
WP_002913974.1\|231661_232177_-	co-chaperone HscB	NA	NA	NA	NA
WP_002913979.1\|232251_232575_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.6e-21	47.7
WP_002913991.1\|232592_232979_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.7e-52	77.3
WP_071570980.1\|233005_234220_-	cysteine desulfurase	A0A1X7C038	Faustovirus	7.2e-35	32.8

DBSCAN-SWA_13

249467 : 271535

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914027.1\|249467_250721_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.9e-99	53.1
WP_002914028.1\|251046_252237_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_002914032.1\|252310_252649_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_004149357.1\|252714_254052_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	1.0e-10	35.0
WP_002914033.1\|254038_254725_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_002914044.1\|254754_256176_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.1e-13	25.8
WP_004185139.1\|256766_260654_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	5.0e-130	58.9
WP_002914046.1\|260829_262446_+	membrane-bound lytic murein transglycosylase MltF	NA	NA	NA	NA
WP_002914049.1\|262442_262985_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	2.6e-05	33.8
WP_002914050.1\|263014_263650_-	acid phosphatase AphA	NA	NA	NA	NA
WP_002914052.1\|263863_264712_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002914053.1\|264768_265029_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	6.5e-18	52.3
WP_004144351.1\|265041_265422_-	holo-ACP synthase	NA	NA	NA	NA
WP_002914059.1\|265421_266153_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_002914062.1\|266164_266902_-	DNA repair protein RecO	NA	NA	NA	NA
WP_002914063.1\|266913_267819_-	GTPase Era	NA	NA	NA	NA
WP_002914065.1\|267815_268496_-	ribonuclease III	A0A0P0YM82	Yellowstone_lake_phycodnavirus	1.6e-20	29.7
WP_002914067.1\|268745_269720_-	signal peptidase I	NA	NA	NA	NA
WP_002914069.1\|269735_271535_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	5.5e-23	25.4

DBSCAN-SWA_14

277304 : 281840

Cafeteria_roenbergensis_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914082.1\|277304_278636_+	ATP-dependent RNA helicase SrmB	E3T5E1	Cafeteria_roenbergensis_virus	6.2e-48	31.9
WP_002914084.1\|278681_279065_-	autonomous glycyl radical cofactor GrcA	A0A193GZ98	Escherichia_phage	4.0e-32	79.3
WP_002914088.1\|279378_280068_+	uracil-DNA glycosylase	A0A077BCN4	Equid_alphaherpesvirus	1.3e-57	53.0
WP_002914089.1\|280125_281211_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_002914091.1\|281414_281840_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	6.0e-13	40.2

DBSCAN-SWA_15

287138 : 288437

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914097.1\|287138_288437_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.1e-44	31.5

DBSCAN-SWA_16

294410 : 296984

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004150973.1\|294410_296984_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	6.9e-128	35.4

DBSCAN-SWA_17

303774 : 304845

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914114.1\|303774_304845_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	1.8e-90	51.5

DBSCAN-SWA_18

320192 : 326346

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914164.1\|320192_320675_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.3e-29	47.4
WP_071570987.1\|322490_324449_+	NACHT domain-containing protein	X5JAK5	Clostridium_phage	2.7e-76	33.5
WP_071570988.1\|324496_325558_-	hypothetical protein	A0A2I7RNF6	Vibrio_phage	1.0e-53	38.5
WP_004899969.1\|325881_326346_-	phage polarity suppression protein	Q7M2A1	Enterobacteria_phage	3.7e-40	63.2

DBSCAN-SWA_19

343671 : 345192

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151026.1\|343671_345192_+	amino acid ABC transporter permease/ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-17	28.8

DBSCAN-SWA_20

367350 : 368253

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914281.1\|367350_368253_-	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	2.6e-37	40.2

DBSCAN-SWA_21

373434 : 378733

Lactobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914320.1\|373434_373680_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	5.5e-11	41.1
WP_002914321.1\|373676_374087_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_002914325.1\|374059_376201_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	2.5e-184	46.4
WP_002914327.1\|376211_377174_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	1.5e-131	72.2
WP_002914328.1\|377530_378733_+	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.2e-26	37.8

DBSCAN-SWA_22

393146 : 401384

Vibrio_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000906486.1\|393146_393332_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
WP_002914765.1\|393695_396323_-\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	4.9e-81	38.6
WP_002914767.1\|396573_397074_-	recombination regulator RecX	NA	NA	NA	NA
WP_002914769.1\|397141_398200_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	2.3e-114	63.4
WP_002914771.1\|398290_398788_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	8.3e-30	51.0
WP_002914773.1\|398927_399806_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002914775.1\|399813_400677_-	metal ABC transporter permease	NA	NA	NA	NA
WP_004217109.1\|400673_401384_-	ATP-binding cassette domain-containing protein	A0A2H4UU96	Bodo_saltans_virus	2.4e-06	29.3

DBSCAN-SWA_23

407136 : 408102

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914818.1\|407136_408102_+	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	1.6e-37	33.6

DBSCAN-SWA_24

435043 : 436444

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002914970.1\|435043_436444_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	5.2e-45	28.3

DBSCAN-SWA_25

446809 : 447631

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915033.1\|446809_447631_+	manganese/iron ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.1e-14	27.4

DBSCAN-SWA_26

459375 : 464539

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151058.1\|459375_460155_+	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.2e-11	29.4
WP_002915094.1\|460433_460916_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_004188736.1\|460927_461377_+	hypothetical protein	NA	NA	NA	NA
WP_002915096.1\|461361_461709_+	DUF1493 family protein	NA	NA	NA	NA
WP_004151059.1\|461977_464539_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.3e-30	20.9

DBSCAN-SWA_27

468008 : 474427

uncultured_Mediterranean_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151061.1\|468008_468896_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.5e-05	25.3
WP_004151062.1\|469004_470207_+	MFS transporter	NA	NA	NA	NA
WP_002915104.1\|470203_470581_+	hypothetical protein	NA	NA	NA	NA
WP_071570991.1\|470633_471626_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	4.6e-32	37.6
WP_002915107.1\|471783_472920_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	5.0e-06	35.6
WP_002915108.1\|473045_473672_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.3e-35	51.2
WP_071570992.1\|473665_474427_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	8.4e-58	48.0

DBSCAN-SWA_28

477497 : 479530

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915158.1\|477497_478103_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.1e-27	37.6
WP_002915159.1\|478102_479530_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	1.4e-34	26.9

DBSCAN-SWA_29

488296 : 493633

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915210.1\|488296_488968_-	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	2.5e-13	32.1
WP_002915212.1\|489442_490552_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_002915213.1\|490615_491914_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	7.5e-131	57.5
WP_002915214.1\|491995_493633_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.8e-153	50.7

DBSCAN-SWA_30

497175 : 502641

Erysipelothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188716.1\|497175_498480_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.9e-34	27.7
WP_004151066.1\|498593_501344_+	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	6.4e-47	28.9
WP_002915222.1\|501501_502641_-	glycerate kinase	W6LM47	Streptococcus_phage	3.4e-47	39.9

DBSCAN-SWA_31

510055 : 510901

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915255.1\|510055_510901_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.9e-42	37.4

DBSCAN-SWA_32

521156 : 522179

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151072.1\|521156_522179_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.3e-13	33.0

DBSCAN-SWA_33

528583 : 529339

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004142871.1\|528583_529339_+	flap endonuclease Xni	F8WQ40	Bacillus_phage	1.7e-10	33.6

DBSCAN-SWA_34

540884 : 543385

environmental_halophage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915551.1\|540884_542090_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	4.4e-69	36.5
WP_004151086.1\|542089_542521_+	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
WP_002915577.1\|542563_543385_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.6e-14	31.7

DBSCAN-SWA_35

548330 : 549155

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915614.1\|548330_549155_-	energy-coupling factor ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	4.3e-07	23.3

DBSCAN-SWA_36

581806 : 593486

Deep-sea_thermophilic_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915870.1\|581806_583060_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.5e-14	28.9
WP_004149616.1\|583287_584619_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_002915873.1\|584848_585169_+	hypothetical protein	NA	NA	NA	NA
WP_004188670.1\|585226_587071_-	exodeoxyribonuclease V subunit alpha	A0A0K2FLP8	Brevibacillus_phage	5.3e-21	24.8
WP_004151968.1\|587067_590604_-	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	2.2e-07	21.1
WP_002915886.1\|590600_593486_-	pitrilysin	A0A1V0SH69	Hokovirus	2.2e-45	22.1

DBSCAN-SWA_37

598999 : 610917

Cronobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915933.1\|598999_599794_-	thymidylate synthase	R4IFY1	Cronobacter_phage	2.4e-119	63.8
WP_002915934.1\|599800_600676_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002915935.1\|600921_603168_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	5.6e-09	23.3
WP_002915936.1\|603180_603711_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_004218186.1\|604164_604308_+	hypothetical protein	NA	NA	NA	NA
WP_004143967.1\|604393_605089_+	DNA mismatch repair endonuclease MutH	NA	NA	NA	NA
WP_002915973.1\|605152_605866_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	4.5e-45	46.8
WP_002915974.1\|605989_606208_+	YgdI/YgdR family lipoprotein	NA	NA	NA	NA
WP_002915975.1\|606428_607469_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_002915976.1\|607571_608765_-	lysophospholipid transporter LplT	NA	NA	NA	NA
WP_002915977.1\|608757_610917_-	bifunctional acyl-ACP--phospholipid O-acyltransferase/long-chain-fatty-acid--ACP ligase	A0A2H4PQU7	Staphylococcus_phage	6.4e-18	25.1

DBSCAN-SWA_38

616904 : 617906

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004229436.1\|616904_617906_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.9e-27	27.5

DBSCAN-SWA_39

623620 : 624748

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002915997.1\|623620_624748_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.7e-12	25.5

DBSCAN-SWA_40

630511 : 633982

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004149647.1\|630511_631507_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.8e-13	27.2
WP_002916001.1\|631503_632925_-	sugar porter family MFS transporter	O13311	Aichi_virus	1.1e-23	27.3
WP_002916003.1\|633220_633982_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-18	31.7

DBSCAN-SWA_41

650081 : 651062

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032216024.1\|650081_651062_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	3.0e-185	99.1

DBSCAN-SWA_42

655779 : 657459

Escherichia_phage(100.0%)

integrase

attL 653645:653659|attR 663434:663448

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
653645:653659	attL	NA	NA	NA	NA
WP_004151951.1\|655779_656385_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	6.1e-51	51.4
WP_002916189.1\|656850_657459_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	1.5e-49	51.0
663434:663448	attR	NA	NA	NA	NA

DBSCAN-SWA_43

671933 : 676065

uncultured_Caudovirales_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916277.1\|671933_673487_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	9.5e-157	57.1
WP_002916278.1\|673959_674382_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	4.5e-45	66.4
WP_071570998.1\|674391_675684_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	3.9e-164	71.0
WP_002916281.1\|675735_676065_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	2.9e-23	54.0

DBSCAN-SWA_44

679143 : 680163

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916289.1\|679143_680163_+	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	3.8e-05	31.8

DBSCAN-SWA_45

684131 : 692033

Clostridium_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004157874.1\|684131_684845_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	1.7e-12	35.8
WP_002916298.1\|685161_685716_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_002916299.1\|685950_687468_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.5e-85	37.2
WP_095858446.1\|687477_688576_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.1e-05	39.0
WP_004151783.1\|688661_690395_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	8.3e-61	29.2
WP_002916301.1\|690400_691114_-	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
WP_004144729.1\|691136_692033_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	7.9e-31	28.6

DBSCAN-SWA_46

696729 : 698163

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916322.1\|696729_698163_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	3.6e-33	26.1

DBSCAN-SWA_47

702738 : 705612

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916478.1\|702738_705612_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	5.7e-264	51.6

DBSCAN-SWA_48

713555 : 714788

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916493.1\|713555_714788_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	3.1e-102	48.6

DBSCAN-SWA_49

732041 : 732836

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916526.1\|732041_732836_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.4e-07	25.7

DBSCAN-SWA_50

746591 : 747746

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004149807.1\|746591_747746_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.4e-128	63.4

DBSCAN-SWA_51

762619 : 763702

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916629.1\|762619_763702_+	membrane-bound lytic murein transglycosylase MltC	A0A0H3V0Q1	Geobacillus_virus	9.9e-12	39.0

DBSCAN-SWA_52

772169 : 773546

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023307250.1\|772169_773546_+	pyridoxal-phosphate dependent enzyme	A0A1W6JIM2	Lactococcus_phage	1.1e-44	37.3

DBSCAN-SWA_53

793255 : 803158

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916796.1\|793255_794083_+	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	3.4e-60	42.9
WP_004150920.1\|794118_794646_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002916798.1\|794703_796887_-	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	1.0e-103	70.4
WP_004144547.1\|797010_798423_-	cell division protein FtsP	NA	NA	NA	NA
WP_002916826.1\|798506_799244_-	1-acylglycerol-3-phosphate O-acyltransferase	NA	NA	NA	NA
WP_002916828.1\|799435_801694_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.8e-84	36.1
WP_002916831.1\|801815_802685_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_002916833.1\|802762_803158_-	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	9.8e-18	42.5

DBSCAN-SWA_54

806469 : 808365

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916844.1\|806469_808365_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	5.9e-92	34.7

DBSCAN-SWA_55

812707 : 819588

Erwinia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916849.1\|812707_813379_+	DUF1190 family protein	A0A173GEW8	Erwinia_phage	9.7e-42	48.3
WP_002916850.1\|813384_814545_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	1.4e-88	43.9
WP_002916851.1\|814589_815381_-	4,5-DOPA dioxygenase extradiol	NA	NA	NA	NA
WP_002916852.1\|815567_816338_+	zinc transporter ZupT	NA	NA	NA	NA
WP_002916855.1\|816399_817053_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.8e-45	43.8
WP_002916856.1\|817430_817703_+	accessory factor UbiK family protein	NA	NA	NA	NA
WP_002916857.1\|817738_817936_-	cell surface composition regulator GlgS	NA	NA	NA	NA
WP_004144536.1\|817927_818077_+	hypothetical protein	NA	NA	NA	NA
WP_002916858.1\|818154_819588_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	2.0e-39	29.8

DBSCAN-SWA_56

824699 : 825941

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916864.1\|824699_825941_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	5.2e-89	50.1

DBSCAN-SWA_57

836561 : 850921

Moraxella_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002916879.1\|836561_837575_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.3e-109	59.2
WP_001144069.1\|837812_838028_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_002917631.1\|838139_839885_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.6e-75	38.7
WP_004174339.1\|840103_841945_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.3e-35	33.7
WP_002917636.1\|842044_842551_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
WP_002917638.1\|843286_843559_+	hypothetical protein	NA	NA	NA	NA
WP_004144804.1\|843627_843993_-	hypothetical protein	NA	NA	NA	NA
WP_002917647.1\|844294_844909_+	acid-sensing system DNA-binding response regulator EvgA	NA	NA	NA	NA
WP_004150925.1\|844913_848156_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	3.3e-34	33.6
WP_004188513.1\|848246_848918_-	YfdX family protein	NA	NA	NA	NA
WP_002917651.1\|849158_849734_+	HdeD family acid-resistance protein	NA	NA	NA	NA
WP_002917655.1\|849760_850066_+	acid-activated periplasmic chaperone HdeB	NA	NA	NA	NA
WP_002917658.1\|850117_850921_-	aquaporin	M1HJ75	Acanthocystis_turfacea_Chlorella_virus	1.2e-14	31.5

DBSCAN-SWA_58

868999 : 870379

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004174227.1\|868999_870379_+	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.5e-31	28.2

DBSCAN-SWA_59

874650 : 876138

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002917730.1\|874650_876138_-	autoinducer 2 ABC transporter ATP-binding protein LsrA	F2Y302	Organic_Lake_phycodnavirus	1.3e-09	28.7

DBSCAN-SWA_60

885701 : 886673

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188496.1\|885701_886673_+	TerC family protein	A0A291LBC5	Escherichia_phage	2.0e-35	32.4

DBSCAN-SWA_61

903776 : 904922

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188485.1\|903776_904922_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	5.7e-50	39.6

DBSCAN-SWA_62

921029 : 930718

Escherichia_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002918124.1\|921029_921803_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.2e-22	30.3
WP_004150941.1\|921837_922728_-	Fic family protein	NA	NA	NA	NA
WP_004144878.1\|922842_923706_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.1e-49	47.5
WP_014906877.1\|923769_925878_+	penicillin-binding protein activator	NA	NA	NA	NA
WP_002918206.1\|925835_926222_+	YraN family protein	NA	NA	NA	NA
WP_002918211.1\|926247_926838_+	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	5.4e-12	31.8
WP_002918214.1\|926847_927423_+	divisome-associated lipoprotein YraP	NA	NA	NA	NA
WP_004188467.1\|927544_928585_-	permease	NA	NA	NA	NA
WP_002918218.1\|928660_929308_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_023279299.1\|929436_929973_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	9.3e-11	27.0
WP_002918223.1\|929934_930378_-	YhbP family protein	NA	NA	NA	NA
WP_002918226.1\|930427_930718_+	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	3.1e-13	52.6

DBSCAN-SWA_63

936411 : 938343

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004150943.1\|936411_938343_-	ATP-dependent RNA helicase DeaD	A0A0N9Q9J4	Chrysochromulina_ericina_virus	2.1e-52	31.0

DBSCAN-SWA_64

943757 : 950376

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002918250.1\|943757_946448_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	5.1e-25	26.4
WP_002918252.1\|946472_947960_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_002918364.1\|947987_948440_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_004144895.1\|949032_950376_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	1.1e-63	92.9

DBSCAN-SWA_65

954640 : 957517

Pandoravirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002918371.1\|954640_955489_-	dihydropteroate synthase	S4VNV0	Pandoravirus	6.0e-20	30.7
WP_002918372.1\|955582_957517_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	4.1e-117	43.5

DBSCAN-SWA_66

964115 : 965556

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004144907.1\|964115_965087_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	1.0e-07	25.0
WP_002918381.1\|965283_965556_+	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	3.1e-15	63.5

DBSCAN-SWA_67

969605 : 982536

Bacillus_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004150950.1\|969605_970418_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	1.6e-17	28.8
WP_002918397.1\|970627_971605_+	calcium/sodium antiporter	NA	NA	NA	NA
WP_002918399.1\|971619_972606_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	3.0e-39	31.8
WP_002918405.1\|972620_973187_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	5.3e-57	81.3
WP_002918413.1\|973183_973759_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_002918415.1\|973727_974273_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_002918417.1\|974279_975005_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.3e-22	26.9
WP_002918420.1\|975052_976486_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_002918423.1\|976508_976796_+	ribosome hibernation promoting factor	NA	NA	NA	NA
WP_004144926.1\|976866_977355_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_002918428.1\|977400_978255_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
WP_002918431.1\|978251_978524_+	PTS phosphocarrier protein NPr	NA	NA	NA	NA
WP_004188433.1\|978587_979313_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_004185856.1\|979309_979963_-	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_002918444.1\|980196_982536_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	9.3e-39	30.6

DBSCAN-SWA_68

986480 : 987413

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002918455.1\|986480_987413_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.4e-16	33.8

DBSCAN-SWA_69

994858 : 995353

Pseudomonas_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188423.1\|994858_995353_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.5e-26	54.8

DBSCAN-SWA_70

999298 : 1000666

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004174125.1\|999298_1000666_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	6.0e-22	25.3

DBSCAN-SWA_71

1007651 : 1008920

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004181428.1\|1007651_1008920_-	SLC13/DASS family transporter	Q6A201	Oenococcus_phage	1.8e-60	33.5

DBSCAN-SWA_72

1026970 : 1028014

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002918653.1\|1026970_1028014_-	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_73

1055641 : 1057113

Synechococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004174081.1\|1055641_1056151_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.5e-18	40.3
WP_004150007.1\|1056165_1057113_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.2e-07	37.2

DBSCAN-SWA_74

1077016 : 1080385

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004174069.1\|1077016_1078201_-	elongation factor Tu	A0A2K9L516	Tupanvirus	5.2e-14	27.2
WP_002920103.1\|1078270_1080385_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.8e-57	27.6

DBSCAN-SWA_75

1088230 : 1097874

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188360.1\|1088230_1090135_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.5e-74	33.6
WP_021468514.1\|1090362_1091361_+	hydrolase	NA	NA	NA	NA
WP_002920151.1\|1091357_1091576_+	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	4.0e-05	37.3
WP_002920153.1\|1091612_1092482_+	phosphoribulokinase	NA	NA	NA	NA
WP_002920158.1\|1092536_1092941_-	OsmC family protein	NA	NA	NA	NA
WP_000242758.1\|1093247_1093880_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
WP_004188352.1\|1093931_1096010_+	FUSC family protein	H9YQA8	environmental_Halophage	4.1e-62	84.8
WP_071571008.1\|1095999_1097220_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_002920229.1\|1097310_1097874_-	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	8.1e-58	58.4

DBSCAN-SWA_76

1109275 : 1110103

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002920260.1\|1109275_1110103_-	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	6.1e-70	50.0

DBSCAN-SWA_77

1124926 : 1128698

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002920331.1\|1124926_1126549_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	1.0e-140	51.3
WP_002920333.1\|1126626_1127982_-	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	1.6e-11	24.7
WP_001157751.1\|1127978_1128698_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	3.5e-29	34.7

DBSCAN-SWA_78

1141523 : 1143914

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151407.1\|1141523_1143914_-	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.1e-13	40.2

DBSCAN-SWA_79

1147259 : 1148018

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002920548.1\|1147259_1148018_-	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.3e-23	31.6

DBSCAN-SWA_80

1151875 : 1154323

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002920561.1\|1151875_1154323_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	2.7e-33	83.3

DBSCAN-SWA_81

1172066 : 1173874

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004174010.1\|1172066_1172807_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	6.4e-10	25.0
WP_004188298.1\|1172803_1173874_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.6e-20	34.7

DBSCAN-SWA_82

1177300 : 1179533

Anomala_cuprea_entomopoxvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002920800.1\|1177300_1177669_-	type II toxin-antitoxin system death-on-curing family toxin	E4ZFM2	Streptococcus_phage	3.5e-09	30.1
WP_004174006.1\|1177665_1177887_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_004145133.1\|1178050_1178764_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-12	27.2
WP_002920803.1\|1178765_1179533_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	W6JKT0	Anomala_cuprea_entomopoxvirus	5.8e-14	25.4

DBSCAN-SWA_83

1188676 : 1194477

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188289.1\|1188676_1189942_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	5.9e-24	27.9
WP_004181476.1\|1190060_1191584_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.4e-14	26.2
WP_002920815.1\|1191636_1192491_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	7.0e-45	41.7
WP_002920816.1\|1192760_1193816_-	cell division protein FtsX	NA	NA	NA	NA
WP_002920817.1\|1193808_1194477_-	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	5.0e-14	26.1

DBSCAN-SWA_84

1197561 : 1201698

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004173987.1\|1197561_1198188_+	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	2.1e-30	60.2
WP_004188281.1\|1198266_1200477_+	Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA	E4ZFI9	Streptococcus_phage	1.8e-113	36.0
WP_002920858.1\|1200580_1200826_-	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	4.7e-10	86.1
WP_002920860.1\|1201032_1201698_+	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	2.1e-57	55.8

DBSCAN-SWA_85

1207998 : 1212105

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188273.1\|1207998_1209984_-	bifunctional UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronic acid oxidase ArnA	A0A2K9KZK0	Tupanvirus	3.3e-21	25.7
WP_002921035.1\|1209980_1210964_-	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase ArnC	A8CG95	Salmonella_phage	9.6e-38	33.3
WP_002921037.1\|1210965_1212105_-	UDP-4-amino-4-deoxy-L-arabinose aminotransferase	A0A2K9L0G1	Tupanvirus	9.4e-29	27.3

DBSCAN-SWA_86

1218206 : 1218998

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188268.1\|1218206_1218998_+	nickel import ATP-binding protein NikE	G3M9Y6	Bacillus_virus	3.5e-14	28.7

DBSCAN-SWA_87

1222461 : 1224096

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015056407.1\|1222461_1224096_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.9e-103	41.4

DBSCAN-SWA_88

1227623 : 1233509

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015056403.1\|1227623_1230263_-	hypothetical protein	A0A1B1IUG5	uncultured_Mediterranean_phage	1.9e-19	20.5
WP_015056402.1\|1230262_1233232_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	8.5e-21	23.8
WP_015058217.1\|1233299_1233509_-	helix-turn-helix domain-containing protein	A0A1B1IUF9	uncultured_Mediterranean_phage	2.9e-13	50.9

DBSCAN-SWA_89

1246409 : 1248452

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151426.1\|1246409_1248452_-	oligopeptidase A	A0A1V0SD92	Indivirus	3.8e-44	22.8

DBSCAN-SWA_90

1292185 : 1298159

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004173941.1\|1292185_1294297_-	UDP-forming cellulose synthase catalytic subunit	M1I277	Paramecium_bursaria_Chlorella_virus	4.6e-37	34.2
WP_004173940.1\|1294316_1295120_-	cellulose synthase operon protein YhjQ	NA	NA	NA	NA
WP_023279323.1\|1295110_1295650_-	cellulose biosynthesis protein BcsO	NA	NA	NA	NA
WP_004145206.1\|1295967_1296147_-	hypothetical protein	NA	NA	NA	NA
WP_002921784.1\|1296165_1297179_-	dipeptide ABC transporter ATP binding subunit DppF	G3M9Y6	Bacillus_virus	7.4e-17	29.4
WP_002921785.1\|1297175_1298159_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-15	29.1

DBSCAN-SWA_91

1309217 : 1311957

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188207.1\|1309217_1309658_+	N-acetyltransferase	A0A1X9I6I8	Streptococcus_phage	5.1e-15	32.9
WP_004188204.1\|1309626_1311957_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	5.7e-65	29.3

DBSCAN-SWA_92

1317116 : 1318088

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188199.1\|1317116_1318088_+	glyoxylate/hydroxypyruvate reductase GhrB	M1HST2	Paramecium_bursaria_Chlorella_virus	9.8e-19	27.2

DBSCAN-SWA_93

1321490 : 1324993

Morganella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000014594.1\|1321490_1321703_+	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	2.7e-22	72.9
WP_004188188.1\|1321801_1323421_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	9.0e-25	25.8
WP_002922102.1\|1323722_1323875_-	type I toxin-antitoxin system toxin HokA	NA	NA	NA	NA
WP_023327762.1\|1323946_1324993_+\|transposase	IS481 family transposase	A0A0M3LR35	Mannheimia_phage	1.0e-05	22.9

DBSCAN-SWA_94

1328897 : 1329893

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004173929.1\|1328897_1329893_+	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	1.6e-08	24.6

DBSCAN-SWA_95

1335361 : 1336903

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071571014.1\|1335361_1336903_+	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-15	29.8

DBSCAN-SWA_96

1344877 : 1346719

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188155.1\|1344877_1346719_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	1.2e-12	24.7

DBSCAN-SWA_97

1362563 : 1371712

Rhizobium_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002922429.1\|1362563_1362815_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	9.9e-16	52.1
WP_002922436.1\|1362918_1363350_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_004188142.1\|1363595_1365140_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_002922458.1\|1365149_1366421_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	3.5e-08	30.3
WP_004188139.1\|1366424_1367372_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_004188137.1\|1367377_1368166_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_002922461.1\|1368334_1369360_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	3.6e-19	82.7
WP_023279329.1\|1369372_1370566_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	2.2e-36	28.2
WP_002922463.1\|1370779_1371712_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	2.2e-36	36.4

DBSCAN-SWA_98

1384480 : 1389222

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002922501.1\|1384480_1384960_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	2.8e-27	43.3
WP_004173907.1\|1385147_1385957_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	2.2e-24	32.1
WP_002922510.1\|1386092_1386260_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_000091955.1\|1386280_1386517_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_002922589.1\|1386733_1387399_-	DNA repair protein RadC	NA	NA	NA	NA
WP_004188117.1\|1387571_1388786_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.1e-43	34.7
WP_004145270.1\|1388763_1389222_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	4.7e-48	59.5

DBSCAN-SWA_99

1393861 : 1394779

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279331.1\|1393861_1394779_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-23	30.5

DBSCAN-SWA_100

1399821 : 1408112

Acanthamoeba_polyphaga_mimivirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151500.1\|1399821_1400880_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	6.3e-19	48.5
WP_004188107.1\|1400935_1402186_-	chloride channel protein	NA	NA	NA	NA
WP_002922654.1\|1402461_1403079_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_004188104.1\|1403084_1404761_-	NAD-dependent DNA ligase LigB	F8SJM3	Pseudomonas_phage	6.7e-23	24.1
WP_002922664.1\|1405019_1405643_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	1.7e-19	35.0
WP_000135058.1\|1405697_1405973_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_004150214.1\|1405991_1408112_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5

DBSCAN-SWA_101

1419093 : 1419945

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002922941.1\|1419093_1419945_+	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	2.2e-14	28.2

DBSCAN-SWA_102

1423079 : 1424471

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002922950.1\|1423079_1424471_+	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.4e-66	95.2

DBSCAN-SWA_103

1437728 : 1438778

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002922967.1\|1437728_1438778_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L339	Tupanvirus	3.4e-73	43.9

DBSCAN-SWA_104

1456029 : 1457193

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188053.1\|1456029_1457193_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	2.6e-26	26.9

DBSCAN-SWA_105

1475448 : 1476561

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004188029.1\|1475448_1476561_-	2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT	G3M9Y6	Bacillus_virus	1.5e-26	33.5

DBSCAN-SWA_106

1488736 : 1494176

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004198592.1\|1488736_1490425_-	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	1.7e-58	31.0
WP_002923286.1\|1490529_1490625_-	ilvB operon leader peptide IvbL	NA	NA	NA	NA
WP_004150272.1\|1490637_1490805_+	hypothetical protein	NA	NA	NA	NA
WP_004145059.1\|1491257_1491377_+	type I toxin-antitoxin system toxin TisB	NA	NA	NA	NA
WP_002923294.1\|1491467_1491914_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_071571019.1\|1491982_1492816_+	EamA family transporter	NA	NA	NA	NA
WP_004181587.1\|1492991_1494176_+	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	1.1e-11	25.2

DBSCAN-SWA_107

1506147 : 1507106

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145074.1\|1506147_1506576_-	heat shock chaperone IbpB	A0A2H4N7P1	Lake_Baikal_phage	2.6e-16	41.1
WP_004151523.1\|1506692_1507106_-	heat shock chaperone IbpA	A0A1D7SU06	Cyanophage	1.0e-17	36.2

DBSCAN-SWA_108

1510547 : 1511696

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004150286.1\|1510547_1511696_-	galactonate dehydratase	Q6A202	Oenococcus_phage	4.7e-52	33.7

DBSCAN-SWA_109

1517463 : 1524993

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004173845.1\|1517463_1519878_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	8.2e-115	34.3
WP_004187983.1\|1519906_1520980_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_004145090.1\|1521126_1522227_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.8e-53	35.2
WP_004151534.1\|1522231_1523635_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_000831330.1\|1524256_1524397_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_004151535.1\|1524412_1524772_+	ribonuclease P protein component	NA	NA	NA	NA
WP_004151536.1\|1524735_1524993_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	9.2e-17	55.2

DBSCAN-SWA_110

1532495 : 1533833

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145100.1\|1532495_1533833_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.1e-63	37.6

DBSCAN-SWA_111

1539609 : 1547169

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145006.1\|1539609_1540383_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	2.0e-14	31.2
WP_004151547.1\|1540430_1541321_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_004145004.1\|1541320_1542280_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_004150308.1\|1542408_1543449_-	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	3.4e-49	38.1
WP_004150309.1\|1543785_1545615_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1H1Z3	Paramecium_bursaria_Chlorella_virus	1.9e-124	41.4
WP_004187970.1\|1545798_1547169_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	2.8e-35	36.6

DBSCAN-SWA_112

1559520 : 1560513

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882514.1\|1559520_1560513_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	4.6e-48	37.0

DBSCAN-SWA_113

1563678 : 1569557

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882520.1\|1563678_1565547_+	low affinity potassium transporter Kup	M1I6H8	Paramecium_bursaria_Chlorella_virus	8.4e-67	30.6
WP_004187951.1\|1565732_1566152_+	D-ribose pyranase	NA	NA	NA	NA
WP_004187948.1\|1566162_1567668_+	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	5.2e-19	22.3
WP_002882531.1\|1567673_1568639_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_002882536.1\|1568666_1569557_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	3.3e-05	23.4

DBSCAN-SWA_114

1583851 : 1586644

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004187937.1\|1583851_1586644_+	DNA polymerase I	A0A218MKQ4	uncultured_virus	4.9e-71	32.5

DBSCAN-SWA_115

1590532 : 1593000

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882749.1\|1590532_1591942_-	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	4.8e-06	28.3
WP_004146229.1\|1591950_1593000_-	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	1.0e-08	26.1

DBSCAN-SWA_116

1599822 : 1600740

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004187929.1\|1599822_1600740_-	alpha/beta hydrolase	A0A2K9L5W3	Tupanvirus	1.8e-06	45.8

DBSCAN-SWA_117

1628080 : 1629592

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004187888.1\|1628080_1629592_-	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.3e-14	27.4

DBSCAN-SWA_118

1637930 : 1641434

Bacillus_thuringiensis_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882894.1\|1637930_1638551_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	3.5e-62	57.9
WP_004187877.1\|1638623_1639298_+	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
WP_002882898.1\|1639365_1640739_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.4e-10	24.0
WP_002882901.1\|1640735_1641434_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	4.0e-06	30.3

DBSCAN-SWA_119

1645936 : 1647271

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002882917.1\|1645936_1647271_-	HslU--HslV peptidase ATPase subunit	W6AS21	Erwinia_phage	2.1e-43	29.5

DBSCAN-SWA_120

1664663 : 1665326

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177977.1\|1664663_1665326_-	fructose-6-phosphate aldolase	M4SLG0	Cyanophage	4.6e-28	34.0

DBSCAN-SWA_121

1679956 : 1681795

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032415951.1\|1679956_1681795_+	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	2.3e-08	29.2

DBSCAN-SWA_122

1691859 : 1693506

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002883142.1\|1691859_1693506_+	acetolactate synthase 2 catalytic subunit	E4WLQ6	Ostreococcus_tauri_virus	3.1e-65	32.9

DBSCAN-SWA_123

1701609 : 1703631

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004181641.1\|1701609_1703631_+	DNA helicase Rep	A7KV33	Bacillus_phage	1.4e-112	37.0

DBSCAN-SWA_124

1708122 : 1710059

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002883222.1\|1708122_1709388_-	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	1.8e-41	31.3
WP_002883224.1\|1709729_1710059_+	thioredoxin TrxA	A0A1V0SD63	Indivirus	2.5e-14	39.6

DBSCAN-SWA_125

1714109 : 1720251

Catovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071571027.1\|1714109_1715240_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	9.7e-26	33.2
WP_002883302.1\|1715236_1716499_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	3.8e-23	25.9
WP_002883303.1\|1716495_1717563_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.4e-98	53.9
WP_002883307.1\|1717581_1718463_+	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	6.0e-108	67.4
WP_004146507.1\|1718440_1719115_+	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
WP_071571028.1\|1719120_1720251_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	1.3e-17	40.9

DBSCAN-SWA_126

1736618 : 1740463

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004187778.1\|1736618_1737521_+	tyrosine recombinase XerC	A0A1B1IQT7	uncultured_Mediterranean_phage	5.9e-18	29.4
WP_002883397.1\|1737520_1738237_+	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
WP_002883398.1\|1738300_1740463_+	DNA helicase II	A7KV33	Bacillus_phage	6.0e-117	37.3

DBSCAN-SWA_127

1744299 : 1747773

Catovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152055.1\|1744299_1746126_+	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	5.7e-84	37.8
WP_004152056.1\|1746187_1746808_+	threonine export protein RhtC	NA	NA	NA	NA
WP_004181650.1\|1746852_1747773_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	2.9e-68	53.4

DBSCAN-SWA_128

1759774 : 1763118

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177924.1\|1759774_1761415_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	2.2e-39	29.0
WP_002883425.1\|1761544_1761796_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_002883426.1\|1761799_1762336_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_002883427.1\|1762338_1763118_+	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	7.4e-25	31.7

DBSCAN-SWA_129

1771836 : 1772451

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002883449.1\|1771836_1772451_+	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	9.6e-20	32.5

DBSCAN-SWA_130

1782215 : 1785336

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002883524.1\|1782215_1783166_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	2.7e-29	32.0
WP_004174069.1\|1784151_1785336_+	elongation factor Tu	A0A2K9L516	Tupanvirus	5.2e-14	27.2

DBSCAN-SWA_131

1789497 : 1801941

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279361.1\|1789497_1793526_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.3e-21	28.6
WP_002884146.1\|1793602_1797826_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	9.1e-69	27.5
WP_004192681.1\|1798226_1799567_+	anaerobic C4-dicarboxylate transporter DcuB	NA	NA	NA	NA
WP_002884149.1\|1799609_1799927_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002884150.1\|1799930_1800236_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_004178221.1\|1800408_1801941_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.2e-12	32.1

DBSCAN-SWA_132

1810366 : 1812130

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152311.1\|1810366_1811038_+	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	2.6e-18	27.6
WP_002884331.1\|1811080_1811671_+	YjaG family protein	NA	NA	NA	NA
WP_002884342.1\|1811857_1812130_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	9.4e-20	56.7

DBSCAN-SWA_133

1817551 : 1819141

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002884359.1\|1817551_1819141_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.3e-70	49.0

DBSCAN-SWA_134

1832718 : 1836402

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151753.1\|1832718_1836402_+	methionine synthase	A0A140XBC7	Dickeya_phage	4.9e-26	90.2

DBSCAN-SWA_135

1854305 : 1855415

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002884743.1\|1854305_1855415_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	3.6e-17	47.2

DBSCAN-SWA_136

1862481 : 1863090

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002884822.1\|1862481_1863090_+	repressor LexA	Q9G0C2	Lactococcus_phage	4.6e-14	40.7

DBSCAN-SWA_137

1869085 : 1871612

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002884942.1\|1869085_1870501_+	replicative DNA helicase	O80281	Escherichia_phage	5.7e-201	78.8
WP_071571033.1\|1870532_1871612_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.4e-26	28.4

DBSCAN-SWA_138

1874794 : 1880101

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004146620.1\|1874794_1877620_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.6
WP_004151744.1\|1877871_1878396_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	5.1e-54	95.4
WP_004192628.1\|1878520_1880101_-	lytic transglycosylase F	K7RVN3	Vibrio_phage	6.3e-07	31.7

DBSCAN-SWA_139

1892081 : 1893113

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177837.1\|1892081_1893113_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.6e-19	51.5

DBSCAN-SWA_140

1900642 : 1901992

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885079.1\|1900642_1901992_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.5e-158	71.1

DBSCAN-SWA_141

1914266 : 1921051

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885145.1\|1914266_1916225_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.0e-91	41.3
WP_004226113.1\|1916325_1916526_+	hypothetical protein	NA	NA	NA	NA
WP_004146659.1\|1916637_1917951_+	glutamate/aspartate:proton symporter GltP	NA	NA	NA	NA
WP_004151733.1\|1917987_1918674_-	sel1 repeat family protein	NA	NA	NA	NA
WP_012737173.1\|1918903_1921051_-	formate dehydrogenase H subunit alpha, selenocysteine-containing	A0A077SK27	Escherichia_phage	2.0e-32	24.3

DBSCAN-SWA_142

1926992 : 1928513

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885173.1\|1926992_1928513_-	sugar ABC transporter ATP-binding protein	W5SAS9	Pithovirus	6.7e-06	22.9

DBSCAN-SWA_143

1933893 : 1935440

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885196.1\|1933893_1934574_-	phosphonate C-P lyase system protein PhnL	F2Y1V6	Organic_Lake_phycodnavirus	6.7e-06	26.0
WP_002885198.1\|1934681_1935440_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	2.6e-14	26.7

DBSCAN-SWA_144

1940800 : 1942303

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885227.1\|1940800_1942303_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	1.1e-56	32.7

DBSCAN-SWA_145

1946667 : 1950046

Escherichia_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004146678.1\|1946667_1947624_+	recombinase	A0A222YXF2	Escherichia_phage	1.3e-143	78.0
WP_004151723.1\|1947633_1948005_+	plasmid stabilization protein	A0A222YWJ6	Escherichia_phage	2.8e-22	53.7
WP_087529040.1\|1948683_1950046_+\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5

DBSCAN-SWA_146

1964010 : 1969658

Cronobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152420.1\|1964010_1964304_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	3.5e-12	42.3
WP_002885441.1\|1964341_1965988_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	9.0e-190	69.1
WP_004152419.1\|1966248_1966602_+	DUF4156 domain-containing protein	NA	NA	NA	NA
WP_071571037.1\|1966656_1967520_-	hypothetical protein	NA	NA	NA	NA
WP_004192519.1\|1967534_1969658_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	9.6e-27	25.3

DBSCAN-SWA_147

1980505 : 1985699

Morganella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885523.1\|1980505_1981039_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	5.0e-41	50.0
WP_002885526.1\|1981152_1981512_-	fumarate reductase subunit FrdD	NA	NA	NA	NA
WP_002885530.1\|1981522_1981918_-	fumarate reductase subunit FrdC	NA	NA	NA	NA
WP_004177729.1\|1981928_1982663_-	fumarate reductase iron-sulfur protein	NA	NA	NA	NA
WP_004177727.1\|1982655_1984446_-	fumarate reductase (quinol) flavoprotein subunit	A0A2P0ZL82	Lactobacillus_phage	3.8e-16	27.2
WP_004146714.1\|1984721_1985699_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	2.8e-29	29.7

DBSCAN-SWA_148

1993053 : 1993599

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885538.1\|1993053_1993599_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	1.2e-29	42.1

DBSCAN-SWA_149

1998441 : 2001661

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192488.1\|1998441_1999791_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	3.0e-18	30.1
WP_004192487.1\|1999801_2001661_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.7e-59	40.8

DBSCAN-SWA_150

2007591 : 2011935

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002885665.1\|2007591_2008890_+	adenylosuccinate synthase	W5S5V7	Pithovirus	1.7e-66	35.9
WP_002885667.1\|2009040_2009466_+	nitric oxide-sensing transcriptional repressor NsrR	NA	NA	NA	NA
WP_004192475.1\|2009502_2011935_+	ribonuclease R	Q0GXV6	Lactococcus_phage	1.9e-66	32.7

DBSCAN-SWA_151

2032832 : 2033657

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192440.1\|2032832_2033657_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.9e-07	42.0

DBSCAN-SWA_152

2054320 : 2060899

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002886766.1\|2054320_2054851_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	2.7e-55	62.7
WP_002886769.1\|2055254_2056211_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004177669.1\|2056334_2057837_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	7.6e-10	29.2
WP_004152011.1\|2057847_2058873_+	ABC transporter permease	NA	NA	NA	NA
WP_004178367.1\|2058859_2059858_+	sugar ABC transporter permease YjfF	NA	NA	NA	NA
WP_002886827.1\|2059900_2060899_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.3e-69	42.6

DBSCAN-SWA_153

2064848 : 2066212

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087529040.1\|2064848_2066212_-\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5

DBSCAN-SWA_154

2077866 : 2081297

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192397.1\|2077866_2078109_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	1.2e-13	47.5
WP_004192395.1\|2078098_2078383_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	5.4e-26	58.5
WP_004192393.1\|2078386_2078851_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	2.9e-53	60.1
WP_004186701.1\|2079158_2081297_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	5.3e-267	64.2

DBSCAN-SWA_155

2089054 : 2095112

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192384.1\|2089054_2090002_-	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	8.7e-12	23.6
WP_004152273.1\|2090381_2093090_+	magnesium-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	4.1e-46	26.5
WP_002886926.1\|2093162_2093549_-	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
WP_002886927.1\|2093701_2094163_-	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
WP_002886928.1\|2094176_2095112_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-52	39.9

DBSCAN-SWA_156

2105206 : 2114256

Klosneuvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192363.1\|2105206_2108062_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	6.0e-141	36.4
WP_002886953.1\|2108061_2108505_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_002886954.1\|2108624_2110136_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	9.2e-48	38.4
WP_002886955.1\|2110525_2111623_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_002886956.1\|2111622_2112705_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_002886957.1\|2112753_2114256_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.6e-84	45.1

DBSCAN-SWA_157

2128612 : 2133438

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192338.1\|2128612_2129686_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-22	32.7
WP_004192335.1\|2129691_2130516_-	phosphodiesterase	NA	NA	NA	NA
WP_004192333.1\|2130526_2131414_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_004192330.1\|2131403_2132288_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_004178400.1\|2132418_2133438_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	1.1e-44	31.7

DBSCAN-SWA_158

2136562 : 2144208

Liberibacter_phage(66.67%)

integrase

attL 2126524:2126538|attR 2150804:2150818

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2126524:2126538	attL	NA	NA	NA	NA
WP_001218317.1\|2136562_2137810_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	4.7e-82	43.2
WP_001003202.1\|2138072_2138261_+	hypothetical protein	NA	NA	NA	NA
WP_000549027.1\|2138277_2138880_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_065803884.1\|2138872_2140354_+	type I restriction-modification system subunit M	A0A220A2U4	Liberibacter_phage	1.5e-58	30.2
WP_065803885.1\|2140399_2141113_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_071571040.1\|2141112_2144208_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	8.5e-56	28.9
2150804:2150818	attR	NA	NA	NA	NA

DBSCAN-SWA_159

2148871 : 2151328

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071571043.1\|2148871_2151328_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.7e-73	35.9

DBSCAN-SWA_160

2158922 : 2160215

Yersinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065803897.1\|2158922_2159744_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	2.0e-44	36.9
WP_039567646.1\|2159774_2160215_+	antirestriction protein	A9J566	Pseudomonas_phage	1.3e-15	30.1

DBSCAN-SWA_161

2190063 : 2195021

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192228.1\|2190063_2190792_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.4e-46	47.4
WP_002887259.1\|2190908_2191442_+	lipocalin family protein	A0A1W6JNX6	Morganella_phage	8.2e-52	59.6
WP_004222358.1\|2191451_2191799_-	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_004192224.1\|2191871_2195021_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	4.4e-60	22.7

DBSCAN-SWA_162

2198258 : 2200365

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002887273.1\|2198258_2198942_+	copper response regulator transcription factor CusR	W8CYM9	Bacillus_phage	7.9e-31	36.0
WP_004192214.1\|2198931_2200365_+	Cu(+)/Ag(+) sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.7e-12	27.6

DBSCAN-SWA_163

2210356 : 2213101

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071571048.1\|2210356_2213101_-	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	2.1e-21	30.7

DBSCAN-SWA_164

2217017 : 2218502

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177552.1\|2217017_2218502_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-13	27.9

DBSCAN-SWA_165

2234088 : 2234991

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071571050.1\|2234088_2234991_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.2e-71	45.3

DBSCAN-SWA_166

2269934 : 2273102

Paramecium_bursaria_Chlorella_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192126.1\|2269934_2270996_+	SIS domain-containing protein	M1I2B0	Paramecium_bursaria_Chlorella_virus	1.1e-07	24.3
WP_004178531.1\|2271013_2272024_+	SIS domain-containing protein	NA	NA	NA	NA
WP_029503562.1\|2272157_2273102_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.5e-69	53.7

DBSCAN-SWA_167

2276262 : 2277542

Shigella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002887623.1\|2276262_2277000_-	DNA replication protein DnaC	V5UQI5	Shigella_phage	1.2e-64	51.7
WP_002887624.1\|2277002_2277542_-	primosomal protein DnaT	T1SA92	Salmonella_phage	2.4e-27	62.8

DBSCAN-SWA_168

2290765 : 2293486

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002887711.1\|2290765_2292355_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	5.3e-30	25.9
WP_004146042.1\|2292574_2293195_+	molecular chaperone OsmY	NA	NA	NA	NA
WP_002887716.1\|2293324_2293486_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	1.2e-11	67.9

DBSCAN-SWA_169

2298221 : 2299544

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279412.1\|2298221_2299544_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	3.0e-79	40.9

DBSCAN-SWA_170

2305875 : 2311035

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002887802.1\|2305875_2307108_+	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	1.3e-87	44.3
WP_002887805.1\|2307201_2308869_-	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	2.9e-42	26.8
WP_002887806.1\|2309097_2311035_+	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	2.7e-12	35.5

DBSCAN-SWA_171

2325395 : 2329973

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|2325395_2326100_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_071570617.1\|2326158_2326467_+	hypothetical protein	NA	NA	NA	NA
WP_002887869.1\|2326535_2327309_-	peroxide stress protein YaaA	NA	NA	NA	NA
WP_002887871.1\|2327386_2328817_-	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_002887897.1\|2329019_2329973_+	transaldolase	A0A127KNC6	Cyanophage	1.3e-10	32.1

DBSCAN-SWA_172

2334368 : 2344321

Chrysochromulina_ericina_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004146997.1\|2334368_2336285_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	6.4e-147	50.6
WP_002887955.1\|2336372_2337506_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.2e-28	35.5
WP_004192071.1\|2337683_2338859_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	4.9e-89	51.4
WP_002887961.1\|2338913_2339810_+	transcriptional activator NhaR	NA	NA	NA	NA
WP_002887965.1\|2339929_2340193_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_002887969.1\|2340522_2341461_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_004192065.1\|2341504_2344321_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L260	Tupanvirus	2.1e-77	26.1

DBSCAN-SWA_173

2350887 : 2352036

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177433.1\|2350887_2352036_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	9.1e-48	32.1

DBSCAN-SWA_174

2358519 : 2360437

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002888320.1\|2358519_2358999_+	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	1.2e-28	46.4
WP_004192052.1\|2359588_2360437_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A0A0YWI7	Pseudomonas_phage	3.4e-07	48.4

DBSCAN-SWA_175

2372895 : 2378347

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192044.1\|2372895_2375802_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	4.9e-21	36.9
WP_004192041.1\|2375989_2378347_-	DNA polymerase II	X5FTI3	Fish_lymphocystis_disease_virus	8.8e-13	23.4

DBSCAN-SWA_176

2384643 : 2385345

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004192031.1\|2384643_2385345_-	thiamine ABC transporter ATP-binding protein ThiQ	G3M9Y6	Bacillus_virus	2.8e-23	36.7

DBSCAN-SWA_177

2394044 : 2394800

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177420.1\|2394044_2394800_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	4.2e-25	36.5

DBSCAN-SWA_178

2406199 : 2407924

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002888534.1\|2406199_2407924_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	3.3e-33	25.8

DBSCAN-SWA_179

2434116 : 2435160

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191995.1\|2434116_2435160_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	4.1e-103	55.9

DBSCAN-SWA_180

2439427 : 2439991

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002888692.1\|2439427_2439991_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	4.1e-09	30.4

DBSCAN-SWA_181

2451331 : 2452756

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002888731.1\|2451331_2452756_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-41	26.9

DBSCAN-SWA_182

2464337 : 2470984

Mamastrovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279282.1\|2464337_2465936_+	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	7.5e-16	51.1
WP_004191972.1\|2466019_2468410_-	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
WP_071570631.1\|2468490_2468610_+	hypothetical protein	NA	NA	NA	NA
WP_002888819.1\|2468614_2469151_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.9e-17	31.8
WP_002888821.1\|2469210_2469873_-	carbonate dehydratase	NA	NA	NA	NA
WP_002888823.1\|2470057_2470984_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.8e-22	34.4

DBSCAN-SWA_183

2476388 : 2483159

unidentified_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071526609.1\|2476388_2477783_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	1.6e-25	36.9
WP_023279280.1\|2477845_2478727_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_002888845.1\|2478786_2479242_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_002888848.1\|2479404_2480121_-	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_004177389.1\|2480120_2480657_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_023300747.1\|2480729_2483159_+	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	5.1e-40	31.0

DBSCAN-SWA_184

2505293 : 2506091

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145876.1\|2505293_2506091_+	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	9.2e-15	27.4

DBSCAN-SWA_185

2512057 : 2512402

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002889275.1\|2512057_2512402_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	1.2e-27	53.2

DBSCAN-SWA_186

2516357 : 2517791

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177363.1\|2516357_2517791_+\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	3.0e-24	30.7

DBSCAN-SWA_187

2529370 : 2530129

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002889316.1\|2529370_2530129_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	6.1e-24	40.7

DBSCAN-SWA_188

2538960 : 2543060

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279267.1\|2538960_2539560_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.2e-27	39.6
WP_004177353.1\|2539577_2543060_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	3.1e-208	36.5

DBSCAN-SWA_189

2556044 : 2557076

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002889450.1\|2556044_2557076_-	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	9.4e-36	39.3

DBSCAN-SWA_190

2563757 : 2564561

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191899.1\|2563757_2564561_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.4e-39	37.0

DBSCAN-SWA_191

2568626 : 2572836

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002889632.1\|2568626_2569994_-	murein transglycosylase D	A0A0A7NU10	Lactobacillus_phage	4.0e-10	29.1
WP_004191891.1\|2570065_2570821_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_002889685.1\|2570853_2571576_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_002889686.1\|2571572_2572040_-	ribonuclease HI	J9Q745	Salmonella_phage	8.0e-51	56.6
WP_004145831.1\|2572095_2572836_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	7.2e-38	36.9

DBSCAN-SWA_192

2578344 : 2578926

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145825.1\|2578344_2578926_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	2.2e-13	29.8

DBSCAN-SWA_193

2596189 : 2597473

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191863.1\|2596189_2597473_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.9e-33	31.2

DBSCAN-SWA_194

2603655 : 2606206

Vibrio_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191854.1\|2603655_2604120_+	HNH endonuclease	A0A2I7S8D9	Vibrio_phage	6.1e-19	47.8
WP_087529040.1\|2604843_2606206_+\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5

DBSCAN-SWA_195

2627859 : 2633103

Enterobacteria_phage(50.0%)

integrase

attL 2627537:2627550|attR 2629807:2629820

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2627537:2627550	attL	NA	NA	NA	NA
WP_004213854.1\|2627859_2629041_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	1.4e-128	55.7
WP_004191830.1\|2629393_2630647_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.5e-88	44.9
2629807:2629820	attR	NA	NA	NA	NA
WP_004144574.1\|2630657_2631761_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.8e-62	40.5
WP_004144576.1\|2632050_2633103_+	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	1.4e-111	57.9

DBSCAN-SWA_196

2639399 : 2640242

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177295.1\|2639399_2640242_-	phosphonate ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.4e-13	26.2

DBSCAN-SWA_197

2651569 : 2653040

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002890126.1\|2651569_2652265_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-06	23.9
WP_004151354.1\|2652257_2653040_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.8e-10	24.8

DBSCAN-SWA_198

2664043 : 2664811

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004178719.1\|2664043_2664811_+	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	4.3e-25	38.6

DBSCAN-SWA_199

2685937 : 2694457

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002890285.1\|2685937_2686849_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	5.5e-104	63.6
WP_020802571.1\|2686940_2687855_+	fructokinase	NA	NA	NA	NA
WP_004191759.1\|2687928_2691066_-	exonuclease subunit SbcC	G3MAB6	Bacillus_virus	1.3e-08	24.9
WP_004191757.1\|2691062_2692268_-	exonuclease subunit SbcD	R4JGS2	Bacillus_phage	1.8e-06	35.5
WP_002890343.1\|2692450_2693140_+	phosphate response regulator transcription factor PhoB	W8CYM9	Bacillus_phage	3.7e-36	37.6
WP_002890344.1\|2693161_2694457_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.2e-26	30.0

DBSCAN-SWA_200

2711263 : 2715602

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002890395.1\|2711263_2712391_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-89	46.1
WP_002890398.1\|2712413_2712746_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	4.9e-10	33.0
WP_002890400.1\|2712772_2714620_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_002890403.1\|2714630_2715602_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.6e-45	39.1

DBSCAN-SWA_201

2719200 : 2723860

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191734.1\|2719200_2720304_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	6.5e-51	35.2
WP_001021161.1\|2720391_2720862_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.3e-29	47.4
WP_002891356.1\|2720881_2721301_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_004178737.1\|2721372_2722344_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_004191729.1\|2722336_2722840_+	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_004191727.1\|2722885_2723860_-	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	9.3e-09	21.2

DBSCAN-SWA_202

2736663 : 2738343

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004153830.1\|2736663_2738343_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	7.2e-17	25.5

DBSCAN-SWA_203

2752649 : 2757818

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002891804.1\|2752649_2753273_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.8e-64	63.9
WP_002891807.1\|2753523_2754798_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	7.3e-131	56.4
WP_004151336.1\|2754981_2757336_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.7e-224	52.2
WP_002444653.1\|2757545_2757818_+	DNA-binding protein HU-beta	A3E2K9	Sodalis_phage	8.5e-21	61.8

DBSCAN-SWA_204

2761048 : 2761750

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002891863.1\|2761048_2761750_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.1e-88	68.4

DBSCAN-SWA_205

2766177 : 2769721

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004147344.1\|2766177_2767950_+	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-47	28.7
WP_071570648.1\|2767942_2769721_+	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	8.6e-37	26.7

DBSCAN-SWA_206

2786753 : 2787863

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004177244.1\|2786753_2787863_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.1e-26	35.5

DBSCAN-SWA_207

2797037 : 2806428

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002892007.1\|2797037_2798108_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	6.1e-70	42.8
WP_002892011.1\|2798223_2798487_+	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_002892018.1\|2798486_2798627_+	50S ribosomal protein L36	NA	NA	NA	NA
WP_002892021.1\|2798623_2799322_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021313732.1\|2799422_2800874_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.6e-12	25.1
WP_002892026.1\|2800848_2801319_-	YlaC family protein	NA	NA	NA	NA
WP_004147370.1\|2801339_2801480_+	hypothetical protein	NA	NA	NA	NA
WP_002892030.1\|2801451_2802018_-	maltose O-acetyltransferase	NA	NA	NA	NA
WP_002892050.1\|2802176_2802395_-	hemolysin expression modulator Hha	NA	NA	NA	NA
WP_002892066.1\|2802421_2802796_-	Hha toxicity modulator TomB	NA	NA	NA	NA
WP_002892069.1\|2803281_2806428_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.1e-47	22.7

DBSCAN-SWA_208

2811949 : 2819760

Sodalis_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004183208.1\|2811949_2812849_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.2e-64	51.6
WP_002892136.1\|2812916_2813090_-	pleiotropic regulatory protein RsmS	NA	NA	NA	NA
WP_002892142.1\|2813102_2813630_-	primosomal replication protein N''	NA	NA	NA	NA
WP_002892144.1\|2813699_2814077_+	DUF454 family protein	NA	NA	NA	NA
WP_002892145.1\|2814227_2814779_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	3.9e-28	44.5
WP_004147381.1\|2814871_2816779_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	3.0e-43	38.2
WP_002892173.1\|2816836_2817169_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_002892177.1\|2817168_2817774_+	recombination protein RecR	NA	NA	NA	NA
WP_004177228.1\|2817885_2819760_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	4.9e-115	36.8

DBSCAN-SWA_209

2829879 : 2835085

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279233.1\|2829879_2832381_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	4.7e-113	38.0
WP_002892208.1\|2832487_2832898_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_071570652.1\|2832930_2833353_-	NfeD family protein	NA	NA	NA	NA
WP_002892258.1\|2833349_2834267_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_071570654.1\|2834407_2835085_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	2.7e-23	33.5

DBSCAN-SWA_210

2838267 : 2838954

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004146399.1\|2838267_2838954_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-31	35.7

DBSCAN-SWA_211

2847499 : 2890445

Salmonella_phage(28.57%)

tRNA,plate,terminase,holin,tail,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191607.1\|2847499_2848885_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-46	35.4
WP_004143016.1\|2848930_2849143_-	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_004143017.1\|2849144_2850011_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
WP_004223135.1\|2851481_2851817_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_019704094.1\|2851829_2852069_-	DUF4222 domain-containing protein	Q6H9Z8	Enterobacteria_phage	5.9e-10	43.6
WP_071570656.1\|2852127_2852655_-	phage N-6-adenine-methyltransferase	Q9ZWX6	Enterobacteria_phage	7.1e-56	59.8
WP_071570658.1\|2852651_2852810_-	DUF1317 family protein	A0A0N7CHV0	Escherichia_phage	5.1e-10	60.8
WP_014342890.1\|2852806_2853430_-	YqaJ viral recombinase family protein	S0A2A9	Cellulophaga_phage	1.3e-45	48.1
WP_014342891.1\|2853426_2853762_-	hypothetical protein	A0A0F7L7F5	uncultured_marine_virus	1.3e-10	34.3
WP_071570660.1\|2853941_2854226_-	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.0e-29	62.8
WP_032717012.1\|2854315_2854510_-	hypothetical protein	NA	NA	NA	NA
WP_073970525.1\|2854502_2854628_-	hypothetical protein	NA	NA	NA	NA
WP_048986758.1\|2855126_2855330_+	hypothetical protein	A0A192Y6Q5	Salmonella_phage	1.2e-19	73.1
WP_071570777.1\|2855527_2855863_-	hypothetical protein	NA	NA	NA	NA
WP_025987689.1\|2856309_2857008_-	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	3.4e-106	83.2
WP_004201115.1\|2857119_2857347_+	helix-turn-helix domain-containing protein	Q76H55	Enterobacteria_phage	1.4e-24	77.1
WP_071570664.1\|2857387_2857609_+	transcriptional regulator	NA	NA	NA	NA
WP_071570666.1\|2857694_2857841_+	hypothetical protein	NA	NA	NA	NA
WP_171820359.1\|2857881_2858733_+	DNA replication protein	F1C5C3	Cronobacter_phage	1.2e-84	56.3
WP_172825052.1\|2858737_2860153_+	AAA family ATPase	Q9MCT4	Escherichia_phage	4.1e-183	67.1
WP_071570669.1\|2860152_2860446_+	protein ren	O48423	Enterobacteria_phage	4.3e-26	65.6
WP_071570671.1\|2860442_2861021_+	hypothetical protein	R9TME7	Aeromonas_phage	1.1e-06	29.8
WP_071570673.1\|2861017_2861248_+	hypothetical protein	NA	NA	NA	NA
WP_071570675.1\|2861864_2862059_+	hypothetical protein	NA	NA	NA	NA
WP_071570679.1\|2862606_2862948_+	hypothetical protein	NA	NA	NA	NA
WP_071570681.1\|2862940_2863180_+	hypothetical protein	G8C7S3	Escherichia_phage	3.0e-14	58.1
WP_071570683.1\|2863345_2863942_+	DUF1367 family protein	A0A0U2RT94	Escherichia_phage	1.2e-56	54.3
WP_032413853.1\|2863947_2864118_+	NinE family protein	G8C7V4	Escherichia_phage	2.8e-14	71.4
WP_071570685.1\|2864110_2864749_+	recombination protein NinG	H6WRY9	Salmonella_phage	1.2e-73	68.4
WP_071570686.1\|2864745_2864946_+	hypothetical protein	NA	NA	NA	NA
WP_162879749.1\|2864938_2865076_+	hypothetical protein	NA	NA	NA	NA
WP_071570688.1\|2865072_2865762_+	antiterminator	I6PDF8	Cronobacter_phage	9.3e-64	56.7
WP_012542609.1\|2866246_2866516_+\|holin	holin	K7P6H9	Enterobacteria_phage	2.8e-32	78.3
WP_071570779.1\|2866493_2866991_+	lysozyme	K7P7Q3	Enterobacteria_phage	8.2e-78	83.0
WP_077268745.1\|2866987_2867452_+\|lysis	lysis protein	M9NYX9	Enterobacteria_phage	7.0e-39	56.5
WP_134905963.1\|2868209_2868461_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	2.2e-15	92.9
WP_049162787.1\|2868491_2868671_+	hypothetical protein	NA	NA	NA	NA
WP_071570691.1\|2868783_2869539_+	trypsin-like peptidase domain-containing protein	A0A2H4J9L7	uncultured_Caudovirales_phage	4.7e-77	57.3
WP_071570692.1\|2869636_2869957_-	hypothetical protein	NA	NA	NA	NA
WP_162377993.1\|2870296_2870785_+	hypothetical protein	NA	NA	NA	NA
WP_071570694.1\|2870735_2872136_+\|terminase	PBSX family phage terminase large subunit	A0A077KAW0	Edwardsiella_phage	1.2e-187	69.0
WP_071570695.1\|2872373_2873825_+	DUF1073 domain-containing protein	A0A0M4S6U1	Salmonella_phage	2.9e-192	68.8
WP_071570780.1\|2873880_2874429_+	hypothetical protein	A0A0M4REK0	Salmonella_phage	4.8e-47	56.3
WP_071570696.1\|2874480_2875683_+	DUF2213 domain-containing protein	A0A0M4R5A6	Salmonella_phage	6.1e-111	55.9
WP_071570697.1\|2875686_2876181_+	hypothetical protein	A0A2H4JHM9	uncultured_Caudovirales_phage	5.5e-50	62.7
WP_040217289.1\|2876192_2877134_+	DUF2184 domain-containing protein	A0A2H4J191	uncultured_Caudovirales_phage	1.0e-137	77.4
WP_071570698.1\|2877173_2877455_+	hypothetical protein	NA	NA	NA	NA
WP_071570699.1\|2877423_2877843_+	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	4.4e-40	60.7
WP_071570700.1\|2877839_2878346_+	hypothetical protein	NA	NA	NA	NA
WP_023312779.1\|2878345_2878732_+	hypothetical protein	A0A2H4J1A4	uncultured_Caudovirales_phage	2.8e-49	79.0
WP_071570701.1\|2878826_2879267_+	hypothetical protein	A0A2H4J1A0	uncultured_Caudovirales_phage	7.8e-40	51.0
WP_071570702.1\|2879270_2880416_+	DUF3383 domain-containing protein	A0A2H4J8G4	uncultured_Caudovirales_phage	1.4e-165	77.4
WP_023312781.1\|2880425_2880869_+	DUF3277 family protein	A0A0M5M1K6	Salmonella_phage	2.1e-61	80.0
WP_065802505.1\|2880872_2881292_+	hypothetical protein	A0A2H4J2V6	uncultured_Caudovirales_phage	3.0e-41	66.7
WP_049073657.1\|2881333_2881486_+	hypothetical protein	A0A2H4J1A2	uncultured_Caudovirales_phage	1.7e-18	86.0
WP_071570703.1\|2881475_2883392_+	hypothetical protein	A0A0M4REK7	Salmonella_phage	1.2e-198	58.2
WP_025269945.1\|2883391_2883967_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	5.0e-63	66.0
WP_077271900.1\|2884042_2884270_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	2.8e-17	50.7
WP_071570705.1\|2884272_2885340_+	hypothetical protein	A0A0M4QX01	Salmonella_phage	4.4e-137	68.2
WP_000734772.1\|2885336_2885669_+	hypothetical protein	A0A0M4RTY3	Salmonella_phage	3.4e-19	64.5
WP_000506882.1\|2885699_2886017_-	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_029498693.1\|2886104_2886758_+	hypothetical protein	A0A0M5M1K7	Salmonella_phage	5.2e-72	57.1
WP_071570706.1\|2886759_2887113_+	hypothetical protein	A0A2H4J629	uncultured_Caudovirales_phage	1.9e-49	79.5
WP_071570707.1\|2887112_2888312_+\|plate	baseplate J/gp47 family protein	A0A0M4RD32	Salmonella_phage	2.6e-162	75.4
WP_071570708.1\|2888308_2889082_+	DUF2612 domain-containing protein	A0A2H4J1A9	uncultured_Caudovirales_phage	3.8e-66	49.8
WP_071570709.1\|2889081_2889867_+\|tail	tail fiber protein	E5G6P0	Salmonella_phage	1.2e-30	53.5
WP_071570710.1\|2889866_2890445_+\|tail	tail fiber assembly protein	K7PMH7	Enterobacteria_phage	2.2e-50	51.8

DBSCAN-SWA_212

2894549 : 2895248

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004899029.1\|2894549_2895248_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	2.6e-05	27.2

DBSCAN-SWA_213

2913769 : 2917876

Microcystis_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189385.1\|2913769_2914663_+	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BSL8	Microcystis_phage	5.1e-14	27.3
WP_004217423.1\|2914708_2914825_+	hypothetical protein	NA	NA	NA	NA
WP_004184616.1\|2914846_2915740_+	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BSL8	Microcystis_phage	2.8e-12	27.4
WP_038435084.1\|2915765_2915894_+	hypothetical protein	NA	NA	NA	NA
WP_004189389.1\|2916985_2917876_+	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A7H6	Microcystis_virus	4.1e-11	29.8

DBSCAN-SWA_214

2934410 : 2937162

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189412.1\|2934410_2936090_-	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	1.0e-23	23.4
WP_002910407.1\|2936214_2937162_-	ribose-phosphate diphosphokinase	A0A2K9L2G2	Tupanvirus	2.3e-44	37.5

DBSCAN-SWA_215

2940374 : 2946088

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002910403.1\|2940374_2941457_+	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.9e-07	41.6
WP_004215201.1\|2941456_2942305_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_004145428.1\|2942304_2942697_+	SirB family protein	NA	NA	NA	NA
WP_002910395.1\|2942700_2943513_+	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_002910393.1\|2943552_2944407_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.3e-48	40.2
WP_002910392.1\|2944493_2945594_-	sodium-potassium/proton antiporter ChaA	NA	NA	NA	NA
WP_023278894.1\|2945857_2946088_+	putative cation transport regulator ChaB	A0A1S5YE01	Mythimna_unipuncta_granulovirus	1.8e-08	48.0

DBSCAN-SWA_216

2951599 : 2952388

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145418.1\|2951599_2952388_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-30	36.4

DBSCAN-SWA_217

2968882 : 2970418

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002910193.1\|2968882_2970418_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	2.8e-20	41.4

DBSCAN-SWA_218

2974430 : 2980700

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151854.1\|2974430_2975273_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	8.3e-14	43.1
WP_072200152.1\|2975315_2975786_-	YchJ family protein	NA	NA	NA	NA
WP_002910108.1\|2975886_2976789_+	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_004175574.1\|2976878_2977892_+	two-component system response regulator RssB	Q6XM27	Feldmannia_irregularis_virus	1.1e-07	29.4
WP_002910105.1\|2978089_2978992_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.8e-59	47.6
WP_002910103.1\|2979113_2979521_-	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
WP_032413675.1\|2979970_2980075_-	hypothetical protein	NA	NA	NA	NA
WP_029503819.1\|2980082_2980700_+	thymidine kinase	A0A0A0YP64	Citrobacter_phage	1.2e-54	53.6

DBSCAN-SWA_219

2988960 : 2991858

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151853.1\|2988960_2989974_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-13	30.7
WP_002910083.1\|2989970_2990975_+	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G3M9Y6	Bacillus_virus	2.6e-14	29.6
WP_002910080.1\|2991030_2991858_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	3.9e-08	40.0

DBSCAN-SWA_220

3001534 : 3008703

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002910026.1\|3001534_3003463_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	2.3e-128	36.9
WP_004189469.1\|3003466_3004009_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	6.3e-15	32.5
WP_001124225.1\|3004101_3004299_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_000124850.1\|3004349_3004706_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_001386830.1\|3004829_3004874_+	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_002909105.1\|3005012_3005996_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.9e-34	42.6
WP_071570846.1\|3006011_3008399_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_002909098.1\|3008403_3008703_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0

DBSCAN-SWA_221

3015771 : 3023740

Brazilian_cedratvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002909083.1\|3015771_3016521_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	6.4e-10	30.9
WP_002909082.1\|3016602_3017067_+	lipoprotein	NA	NA	NA	NA
WP_004189479.1\|3017180_3018623_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.5e-55	37.0
WP_002909070.1\|3018652_3018880_-	hemin uptake protein HemP	NA	NA	NA	NA
WP_004180369.1\|3018987_3020034_-	3-deoxy-7-phosphoheptulonate synthase AroH	A0A0B5IW14	Pandoravirus	1.4e-82	46.6
WP_071570855.1\|3020188_3021022_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_019705803.1\|3021166_3021286_-	hypothetical protein	NA	NA	NA	NA
WP_002909055.1\|3021361_3023740_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	1.4e-172	37.1

DBSCAN-SWA_222

3033739 : 3034501

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570845.1\|3033739_3034501_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.3e-15	30.2

DBSCAN-SWA_223

3049000 : 3052213

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002908876.1\|3049000_3049747_+	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	3.0e-07	24.5
WP_004189490.1\|3049721_3050996_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_002908867.1\|3050992_3052213_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	9.9e-93	42.0

DBSCAN-SWA_224

3062133 : 3062883

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004184407.1\|3062133_3062883_-	ABC transporter ATP-binding protein	A0A2I4R674	Erysipelothrix_phage	3.7e-05	29.4

DBSCAN-SWA_225

3070320 : 3072284

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189514.1\|3070320_3071271_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	9.6e-35	36.7
WP_004180340.1\|3071267_3072284_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	1.5e-41	31.7

DBSCAN-SWA_226

3082925 : 3087326

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189533.1\|3082925_3083699_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-31	35.2
WP_023278908.1\|3083926_3085999_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_004189535.1\|3086504_3087326_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.6e-16	30.5

DBSCAN-SWA_227

3106851 : 3107922

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002908292.1\|3106851_3107922_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.1e-26	32.4

DBSCAN-SWA_228

3112780 : 3113404

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009307655.1\|3112780_3113404_+	cytochrome c biogenesis heme-transporting ATPase CcmA	A0A2H4PQG7	Staphylococcus_phage	1.8e-05	23.4

DBSCAN-SWA_229

3126312 : 3131957

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151175.1\|3126312_3127017_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-26	36.4
WP_004184323.1\|3127299_3127689_+	transporter	NA	NA	NA	NA
WP_004151176.1\|3127918_3128803_+	membrane protein	NA	NA	NA	NA
WP_071570842.1\|3128840_3131957_+	multidrug efflux RND transporter permease subunit KexD	S5VTK5	Leptospira_phage	1.9e-55	22.3

DBSCAN-SWA_230

3150819 : 3155337

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189596.1\|3150819_3152187_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	6.6e-29	64.0
WP_009486384.1\|3152241_3153663_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_002908134.1\|3153689_3154505_-	ABC transporter permease	NA	NA	NA	NA
WP_004189603.1\|3154506_3155337_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-26	34.6

DBSCAN-SWA_231

3172320 : 3174269

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189644.1\|3172320_3173292_-	ATP-binding cassette domain-containing protein	A0A1V0SJ29	Klosneuvirus	1.1e-09	25.5
WP_004189666.1\|3173288_3174269_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-11	26.8

DBSCAN-SWA_232

3179453 : 3180224

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189677.1\|3179453_3180224_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.2e-12	27.4

DBSCAN-SWA_233

3185700 : 3196740

Burkholderia_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002907799.1\|3185700_3186585_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.5e-21	28.7
WP_071531893.1\|3187108_3187570_+	hypothetical protein	NA	NA	NA	NA
WP_072769241.1\|3187566_3187794_+	hypothetical protein	NA	NA	NA	NA
WP_071570840.1\|3188473_3189052_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	5.9e-19	35.5
WP_029780732.1\|3189190_3189598_-	acid resistance repetitive basic protein Asr	NA	NA	NA	NA
WP_004148609.1\|3189773_3191147_-	MdtK family multidrug efflux MATE transporter	NA	NA	NA	NA
WP_002907792.1\|3191376_3192012_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.3e-22	36.3
WP_002907788.1\|3192048_3193197_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.2e-84	45.4
WP_002907785.1\|3193489_3194671_-	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
WP_004184276.1\|3194783_3195788_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_002907778.1\|3195714_3196740_-	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	1.2e-30	30.9

DBSCAN-SWA_234

3200012 : 3200885

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189707.1\|3200012_3200885_-	C40 family peptidase	A0A217EQL1	Bacillus_phage	1.7e-17	39.5

DBSCAN-SWA_235

3205072 : 3206560

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002907760.1\|3205072_3205969_+	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	1.8e-06	28.7
WP_004184268.1\|3206038_3206560_+	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	2.3e-51	58.0

DBSCAN-SWA_236

3210366 : 3211728

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570839.1\|3210366_3211728_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.9e-18	33.7

DBSCAN-SWA_237

3215064 : 3216339

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002907740.1\|3215064_3216339_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.1e-86	42.0

DBSCAN-SWA_238

3227594 : 3228965

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004180160.1\|3227594_3228965_-	beta-glucosidase	A0A0B5JD41	Pandoravirus	2.1e-67	35.1

DBSCAN-SWA_239

3234516 : 3236567

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002907640.1\|3234516_3235044_+	cytochrome b561	A0A0U2QLA7	Escherichia_phage	5.9e-18	46.8
WP_002907563.1\|3235148_3235424_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_004189749.1\|3235448_3236567_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	1.8e-32	29.8

DBSCAN-SWA_240

3243392 : 3246033

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189752.1\|3243392_3244898_+	carboxylesterase/lipase family protein	M1PNU1	Moumouvirus	7.3e-29	38.0
WP_004175900.1\|3244944_3246033_-	NAD(P)-dependent alcohol dehydrogenase	M1PHA2	Moumouvirus	6.9e-05	24.4

DBSCAN-SWA_241

3256464 : 3258426

Phage_TP(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002907469.1\|3256464_3258426_+	U32 family peptidase	Q6DW11	Phage_TP	5.1e-22	28.0

DBSCAN-SWA_242

3265318 : 3266332

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151215.1\|3265318_3266332_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.1e-24	56.4

DBSCAN-SWA_243

3282025 : 3284131

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189794.1\|3282025_3284131_-	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	1.6e-138	67.6

DBSCAN-SWA_244

3295185 : 3295965

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002906697.1\|3295185_3295965_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-19	31.0

DBSCAN-SWA_245

3305401 : 3306106

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189827.1\|3305401_3306106_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-31	34.6

DBSCAN-SWA_246

3309763 : 3314502

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087529040.1\|3309763_3311127_-\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5
WP_004180107.1\|3311585_3312266_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_004189838.1\|3312262_3312958_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_004148517.1\|3312957_3314502_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.4e-19	39.5

DBSCAN-SWA_247

3320609 : 3322109

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004175980.1\|3320609_3322109_+	efflux MFS transporter KmrA	A0A0M3UL24	Mycobacterium_phage	7.8e-31	29.3

DBSCAN-SWA_248

3328588 : 3329362

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004143751.1\|3328588_3329362_+	1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase	W8CYX9	Bacillus_phage	3.8e-05	48.5

DBSCAN-SWA_249

3340634 : 3342251

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189869.1\|3340634_3342251_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-19	31.6

DBSCAN-SWA_250

3345839 : 3350610

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002906221.1\|3345839_3346850_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	4.9e-29	25.8
WP_002906218.1\|3347102_3347702_+	inorganic diphosphatase	A0A1B1ISK6	uncultured_Mediterranean_phage	5.0e-21	39.1
WP_004189873.1\|3347904_3348858_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_023278968.1\|3348894_3350610_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	8.0e-32	23.8

DBSCAN-SWA_251

3357095 : 3359433

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151242.1\|3357095_3358010_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.4e-83	58.6
WP_004143718.1\|3358666_3358852_+	general stress protein	NA	NA	NA	NA
WP_004143717.1\|3359217_3359433_+	hypothetical protein	H9NCK9	Mycobacterium_phage	9.4e-07	48.0

DBSCAN-SWA_252

3364240 : 3364645

Stx_converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570830.1\|3364240_3364645_+	YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	2.0e-10	41.6

DBSCAN-SWA_253

3375567 : 3376248

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002906011.1\|3375567_3376248_+	MgtC family protein	G3MA03	Bacillus_virus	2.1e-15	41.9

DBSCAN-SWA_254

3392770 : 3394851

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023278971.1\|3392770_3393511_+	response regulator	W8CYM9	Bacillus_phage	5.0e-31	38.0
WP_023278972.1\|3393507_3394851_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.7e-11	24.7

DBSCAN-SWA_255

3399152 : 3403270

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002905540.1\|3399152_3400538_-	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	7.4e-28	26.0
WP_004180008.1\|3400844_3401780_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004180004.1\|3401804_3402545_-	ABC transporter permease	NA	NA	NA	NA
WP_004189949.1\|3402541_3403270_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.7e-18	30.5

DBSCAN-SWA_256

3409263 : 3410520

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029503401.1\|3409263_3410520_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-20	37.5

DBSCAN-SWA_257

3438871 : 3439609

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004143660.1\|3438871_3439609_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-36	42.9

DBSCAN-SWA_258

3458399 : 3459452

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151868.1\|3458399_3459452_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.2e-14	23.6

DBSCAN-SWA_259

3474125 : 3474872

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029496902.1\|3474125_3474872_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.3e-15	27.0

DBSCAN-SWA_260

3488333 : 3488852

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023313190.1\|3488333_3488852_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	1.3e-25	37.6

DBSCAN-SWA_261

3495011 : 3496544

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015065592.1\|3495011_3496544_+\|transposase	IS3-like element ISKpn38 family transposase	A0A1B1P773	Bacillus_phage	3.1e-51	39.8

DBSCAN-SWA_262

3519395 : 3520169

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009485221.1\|3519395_3520169_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.5e-22	29.6

DBSCAN-SWA_263

3527464 : 3529021

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004143418.1\|3527464_3529021_+	acyl--CoA ligase	A0A1V0SBX8	Catovirus	1.5e-16	25.2

DBSCAN-SWA_264

3536383 : 3537559

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190129.1\|3536383_3537559_+	glycerate kinase	W6LM47	Streptococcus_phage	6.1e-39	37.1

DBSCAN-SWA_265

3563349 : 3564729

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004184021.1\|3563349_3564729_-	purine permease	Q9KX94	Enterobacteria_phage	5.3e-18	26.8

DBSCAN-SWA_266

3575222 : 3576014

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176216.1\|3575222_3576014_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-19	30.0

DBSCAN-SWA_267

3583269 : 3588687

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001323889.1\|3583269_3584847_-	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.2e-95	99.4
WP_001161490.1\|3585156_3585717_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
WP_001138014.1\|3585720_3588687_+\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0

DBSCAN-SWA_268

3592871 : 3594296

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004148352.1\|3592871_3594296_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.0e-16	33.7

DBSCAN-SWA_269

3599693 : 3600455

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002904489.1\|3599693_3600455_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	2.7e-32	36.2

DBSCAN-SWA_270

3612403 : 3612778

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002904397.1\|3612403_3612778_+	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	2.3e-08	32.3

DBSCAN-SWA_271

3616024 : 3617530

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570811.1\|3616024_3616723_-	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	5.6e-16	26.9
WP_004190223.1\|3616732_3617530_-	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.8e-10	26.9

DBSCAN-SWA_272

3621681 : 3637576

Escherichia_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004148338.1\|3621681_3622785_-	cobalamin-independent methionine synthase II family protein	A0A218MNE0	uncultured_virus	1.4e-101	48.9
WP_002904247.1\|3622933_3623332_-	rhodanese	NA	NA	NA	NA
WP_004176251.1\|3623399_3624497_+	transcriptional regulator FtrA	NA	NA	NA	NA
WP_004205985.1\|3624465_3624681_+	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_002904139.1\|3624733_3625174_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004183956.1\|3625428_3626493_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.0e-65	44.5
WP_004190234.1\|3626689_3629797_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.5
WP_004176258.1\|3629851_3631117_+	MFS transporter	NA	NA	NA	NA
WP_001620097.1\|3631147_3632236_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_004176262.1\|3632322_3632583_-	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
WP_004176269.1\|3632880_3633741_+	class A broad-spectrum beta-lactamase SHV-11	A0A077SL40	Escherichia_phage	2.2e-155	99.3
WP_002210513.1\|3633761_3634523_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_002903955.1\|3634783_3635686_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_004190239.1\|3635697_3636963_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	3.9e-233	99.5
WP_002210516.1\|3636955_3637576_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_273

3646721 : 3663604

Escherichia_phage(44.44%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190262.1\|3646721_3647396_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	4.3e-82	62.1
WP_015958377.1\|3647446_3648289_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004190266.1\|3648316_3648703_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_071570810.1\|3648780_3650826_-	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	2.3e-17	20.5
WP_002903733.1\|3650956_3651706_+	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
WP_002903730.1\|3651797_3652484_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_004176285.1\|3652534_3652966_-	universal stress protein	A0A1W6JNV4	Morganella_phage	2.7e-21	40.7
WP_071570809.1\|3653230_3654694_-	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	2.5e-42	31.6
WP_002903724.1\|3654957_3656241_-	MFS transporter	NA	NA	NA	NA
WP_004219442.1\|3656354_3656717_-	YnfA family protein	A0A218MNG8	uncultured_virus	1.6e-22	54.9
WP_002903720.1\|3656825_3657167_+	DUF1283 family protein	NA	NA	NA	NA
WP_004179730.1\|3657245_3657806_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_004183934.1\|3657799_3658510_-	YnfC family lipoprotein	NA	NA	NA	NA
WP_002903714.1\|3658611_3658881_+	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_071570808.1\|3659031_3661467_+	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	4.6e-214	49.0
WP_004152235.1\|3661477_3662095_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	2.6e-73	58.1
WP_004190282.1\|3662096_3662954_+	dimethyl sulfoxide reductase anchor subunit	A0A077SK59	Escherichia_phage	1.2e-23	35.9
WP_004209765.1\|3662995_3663604_+	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	8.3e-24	35.3

DBSCAN-SWA_274

3680735 : 3681695

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004148291.1\|3680735_3681695_+	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	2.7e-53	90.3

DBSCAN-SWA_275

3693371 : 3696149

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570806.1\|3693371_3696149_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.1e-65	31.1

DBSCAN-SWA_276

3715058 : 3715574

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004224598.1\|3715058_3715574_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.6e-23	53.5

DBSCAN-SWA_277

3726817 : 3732099

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151564.1\|3726817_3728119_+	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	2.9e-18	24.0
WP_004183886.1\|3728194_3729127_+	DNA replication terminus site-binding protein	NA	NA	NA	NA
WP_002903315.1\|3729116_3730517_-	class II fumarate hydratase	NA	NA	NA	NA
WP_087529040.1\|3730735_3732099_-\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5

DBSCAN-SWA_278

3742387 : 3745915

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151566.1\|3742387_3742591_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	2.6e-22	73.1
WP_004179667.1\|3742660_3743140_-	hypothetical protein	NA	NA	NA	NA
WP_002903236.1\|3743376_3743730_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_004190344.1\|3743833_3745042_+	selenium metabolism membrane protein YedE/FdhT	NA	NA	NA	NA
WP_002903233.1\|3745038_3745272_+	sulfurtransferase-like selenium metabolism protein YedF	NA	NA	NA	NA
WP_004224558.1\|3745522_3745915_+	DUF1398 domain-containing protein	C6ZCX4	Enterobacteria_phage	3.0e-19	38.5

DBSCAN-SWA_279

3758128 : 3759334

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176366.1\|3758128_3759334_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	6.9e-22	28.0

DBSCAN-SWA_280

3768020 : 3772658

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190385.1\|3768020_3768695_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.8e-31	52.5
WP_023279019.1\|3768755_3772658_-	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	3.8e-53	29.2

DBSCAN-SWA_281

3797133 : 3798654

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190429.1\|3797133_3798654_+	amino acid ABC transporter permease/ATP-binding protein	A0A1V0SE00	Indivirus	2.0e-10	25.8

DBSCAN-SWA_282

3808821 : 3809811

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002902515.1\|3808821_3809811_+	2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.5e-70	45.9

DBSCAN-SWA_283

3814929 : 3822076

Escherichia_phage(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002902433.1\|3814929_3816084_+	porin OmpK37	Q1MVN1	Enterobacteria_phage	4.8e-113	58.9
WP_002902432.1\|3816227_3816440_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_004140161.1\|3816521_3816956_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	3.2e-30	50.7
WP_004190449.1\|3817189_3818125_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.6e-138	93.4
WP_004151591.1\|3818170_3819544_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.6e-53	32.3
WP_004148192.1\|3820069_3821053_-	zinc transporter ZntB	NA	NA	NA	NA
WP_020316476.1\|3821332_3822076_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.0e-16	30.5

DBSCAN-SWA_284

3829684 : 3830698

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152912.1\|3829684_3830698_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-29	39.1

DBSCAN-SWA_285

3856269 : 3857367

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279043.1\|3856269_3857367_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.4e-47	41.0

DBSCAN-SWA_286

3861220 : 3863572

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570800.1\|3861220_3863572_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	6.9e-18	32.2

DBSCAN-SWA_287

3867743 : 3870398

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570799.1\|3867743_3870398_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.3e-97	33.6

DBSCAN-SWA_288

3878384 : 3883823

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190559.1\|3878384_3879917_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.5e-21	30.0
WP_004176437.1\|3880133_3880895_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-21	32.5
WP_004176438.1\|3881003_3881918_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004176439.1\|3882218_3882407_+	hypothetical protein	NA	NA	NA	NA
WP_004190562.1\|3882953_3883823_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.3e-49	41.7

DBSCAN-SWA_289

3914511 : 3916315

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004140266.1\|3914511_3915504_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	3.0e-07	27.2
WP_004140269.1\|3915505_3916315_+	peptide ABC transporter ATP-binding protein SapF	A0A2H4PQG7	Staphylococcus_phage	2.1e-14	28.9

DBSCAN-SWA_290

3920945 : 3922880

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002901787.1\|3920945_3922880_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	7.0e-08	24.6

DBSCAN-SWA_291

3928470 : 3929073

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002901778.1\|3928470_3929073_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-43	49.5

DBSCAN-SWA_292

3933913 : 3939279

Tupanvirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002901763.1\|3933913_3936511_-	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	2.9e-89	35.6
WP_002901761.1\|3936917_3937169_+	YciN family protein	NA	NA	NA	NA
WP_002901758.1\|3937216_3938263_-\|protease	protease SohB	NA	NA	NA	NA
WP_004148112.1\|3938307_3938523_-	hypothetical protein	NA	NA	NA	NA
WP_004196459.1\|3938517_3939279_+	YciK family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.2e-08	23.2

DBSCAN-SWA_293

3962699 : 3965657

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190761.1\|3962699_3964295_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.3e-47	36.5
WP_004190764.1\|3964298_3965657_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	3.3e-36	40.4

DBSCAN-SWA_294

3972954 : 3973632

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004140326.1\|3972954_3973632_+	PKHD-type hydroxylase YbiX	A0A127KM56	Cyanophage	3.3e-21	33.8

DBSCAN-SWA_295

3980926 : 3986659

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176511.1\|3980926_3981688_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-15	28.6
WP_002901611.1\|3981779_3982370_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_004151918.1\|3982505_3983897_+	L-cystine transporter	NA	NA	NA	NA
WP_004140343.1\|3983955_3984288_-	cell division activator CedA	NA	NA	NA	NA
WP_002901554.1\|3984400_3986659_+	catalase HPII	A0A2K9L572	Tupanvirus	1.0e-143	48.4

DBSCAN-SWA_296

3992923 : 4001428

Bacillus_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151921.1\|3992923_3993751_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.7e-70	53.5
WP_004190804.1\|3993851_3994715_+	excinuclease Cho	NA	NA	NA	NA
WP_001067858.1\|3995281_3995986_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
WP_000427619.1\|3996081_3997086_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_000714163.1\|3997267_3997489_-	hypothetical protein	NA	NA	NA	NA
WP_000268337.1\|3997561_3997840_-	hypothetical protein	NA	NA	NA	NA
WP_000122922.1\|3997826_3999554_-	toprim domain-containing protein	A0A0H5AWB1	Pseudomonas_phage	9.3e-20	39.8
WP_001077336.1\|3999731_4000118_-	hypothetical protein	NA	NA	NA	NA
WP_000595210.1\|4000576_4001428_-	hypothetical protein	A0A219UQS0	Bacillus_phage	3.6e-09	29.4

DBSCAN-SWA_297

4019923 : 4023486

Iodobacteriophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001282585.1\|4019923_4020913_-	phage recombination protein Bet	B5AX97	Iodobacteriophage	1.1e-52	39.6
WP_000987165.1\|4021007_4021538_-	single-stranded DNA-binding protein	A0A291LCB6	Klebsiella_phage	2.6e-42	71.8
WP_000739139.1\|4021598_4022507_-	hypothetical protein	NA	NA	NA	NA
WP_000085160.1\|4022517_4023486_-	CbbQ/NirQ/NorQ C-terminal domain-containing protein	J9Q733	Salmonella_phage	3.1e-20	30.4

DBSCAN-SWA_298

4042970 : 4046329

Morganella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001221666.1\|4042970_4043504_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	6.1e-47	54.1
WP_015056382.1\|4043597_4044743_-	class C beta-lactamase CMY-4	NA	NA	NA	NA
WP_000608644.1\|4045066_4046329_-\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0

DBSCAN-SWA_299

4060068 : 4106029

Streptococcus_phage(13.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000366823.1\|4060068_4062261_+	DNA topoisomerase 3	A0A1X9I6W8	Streptococcus_phage	9.9e-43	29.4
WP_000467110.1\|4062275_4062764_+	hypothetical protein	NA	NA	NA	NA
WP_001326171.1\|4062854_4063154_-	hypothetical protein	A0A0K1LLW2	Caulobacter_phage	3.6e-20	55.4
WP_000464630.1\|4063365_4063983_-	hypothetical protein	NA	NA	NA	NA
WP_000268552.1\|4064038_4064695_-	hypothetical protein	NA	NA	NA	NA
WP_000936897.1\|4064694_4066122_-	DNA cytosine methyltransferase	NA	NA	NA	NA
WP_000647188.1\|4066125_4066626_-	hypothetical protein	I3UMJ0	Colwellia_phage	9.5e-18	38.4
WP_001447539.1\|4066634_4066946_-	hypothetical protein	NA	NA	NA	NA
WP_001326170.1\|4066951_4067383_-	hypothetical protein	NA	NA	NA	NA
WP_000344149.1\|4067450_4068125_-	hypothetical protein	NA	NA	NA	NA
WP_000044823.1\|4068099_4068381_-	hypothetical protein	NA	NA	NA	NA
WP_001125904.1\|4068373_4068751_-	hypothetical protein	A0A2H4P7P5	Pseudomonas_phage	1.7e-22	49.6
WP_000939033.1\|4069077_4069221_+	hypothetical protein	NA	NA	NA	NA
WP_000074431.1\|4069312_4069948_+	N-6 DNA methylase	NA	NA	NA	NA
WP_000703827.1\|4070000_4070273_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001207227.1\|4070321_4071503_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_001151304.1\|4071506_4072292_-	ParA family protein	A0A1X9IGI7	Lactococcus_phage	6.1e-11	26.4
WP_000338945.1\|4072465_4072777_-	hypothetical protein	NA	NA	NA	NA
WP_001043260.1\|4073083_4073899_+	sulfonamide-resistant dihydropteroate synthase Sul2	NA	NA	NA	NA
WP_001082319.1\|4073959_4074763_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
WP_000480968.1\|4074762_4075599_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_000844627.1\|4075904_4076147_+\|transposase	transposase	NA	NA	NA	NA
WP_000164043.1\|4076178_4076829_-	tetracycline resistance transcriptional repressor TetR(A)	NA	NA	NA	NA
WP_000804063.1\|4076934_4078134_+	tetracycline efflux MFS transporter Tet(A)	NA	NA	NA	NA
WP_000743213.1\|4078499_4078724_-	hypothetical protein	NA	NA	NA	NA
WP_071571099.1\|4078720_4079458_-	recombinase family protein	NA	NA	NA	NA
WP_001044210.1\|4079943_4080084_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|4080089_4080794_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_004896925.1\|4081678_4082221_+	hypothetical protein	NA	NA	NA	NA
WP_000155092.1\|4082579_4083464_-	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_071571089.1\|4083519_4084995_-	Msr family ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	1.3e-160	59.0
WP_002001451.1\|4085393_4086578_-\|transposase	IS4-like element ISEc29 family transposase	A0A0F7LAS3	uncultured_marine_virus	4.5e-50	35.4
WP_002026779.1\|4086626_4086812_+	hypothetical protein	NA	NA	NA	NA
WP_077252464.1\|4087031_4087313_+	hypothetical protein	NA	NA	NA	NA
WP_000359986.1\|4087293_4088067_-	ArmA family 16S rRNA (guanine(1405)-N(7))-methyltransferase	NA	NA	NA	NA
WP_000050481.1\|4089465_4091007_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000259031.1\|4091411_4092251_-	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000679427.1\|4092244_4092592_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_023622808.1\|4092755_4093547_-	AadA family aminoglycoside 3''-O-nucleotidyltransferase	NA	NA	NA	NA
WP_023622807.1\|4094000_4094474_-	trimethoprim-resistant dihydrofolate reductase DfrA	A0A140HLG8	Bacillus_phage	7.4e-20	34.4
WP_023622806.1\|4094569_4094842_-	hypothetical protein	NA	NA	NA	NA
WP_023622804.1\|4095281_4095914_-	type B chloramphenicol O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	9.2e-26	43.0
WP_023622803.1\|4096003_4096558_-	aminoglycoside N-acetyltransferase AAC(6')-IIa	NA	NA	NA	NA
WP_001067855.1\|4097569_4098274_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001393253.1\|4100595_4100928_+	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
WP_000239590.1\|4100974_4101850_-	class A extended-spectrum beta-lactamase CTX-M-15	A0A1B0VBP7	Salmonella_phage	1.1e-125	82.4
WP_000608644.1\|4102105_4103368_-\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
WP_004190819.1\|4103777_4104812_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_002901489.1\|4104808_4106029_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.0e-26	27.2

DBSCAN-SWA_300

4112086 : 4112719

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176522.1\|4112086_4112719_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	7.8e-09	31.3

DBSCAN-SWA_301

4118021 : 4124052

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004148065.1\|4118021_4119968_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	8.2e-41	30.3
WP_004190843.1\|4119972_4121016_-	selenide, water dikinase SelD	NA	NA	NA	NA
WP_002901387.1\|4121241_4121988_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_087529040.1\|4122689_4124052_+\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5

DBSCAN-SWA_302

4127910 : 4129977

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190847.1\|4127910_4128552_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	3.2e-18	37.1
WP_002901255.1\|4128723_4129977_+	glycoside hydrolase family 18 protein	D2J4H7	Artogeia_rapae_granulovirus	2.6e-24	25.6

DBSCAN-SWA_303

4133661 : 4134477

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072200169.1\|4133661_4134477_-	aldo/keto reductase	A0A1V0SDE7	Indivirus	1.3e-16	26.5

DBSCAN-SWA_304

4137790 : 4147313

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570774.1\|4137790_4139074_+	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	1.7e-10	36.3
WP_004190861.1\|4139119_4139683_-	hypothetical protein	NA	NA	NA	NA
WP_002901230.1\|4139841_4140324_+	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	1.6e-17	39.1
WP_004190867.1\|4140445_4140757_-	hypothetical protein	NA	NA	NA	NA
WP_004140436.1\|4140824_4140944_+	hypothetical protein	NA	NA	NA	NA
WP_004179386.1\|4141013_4141895_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004190870.1\|4142070_4143288_+	MFS transporter	NA	NA	NA	NA
WP_002901225.1\|4143284_4144034_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	4.3e-14	29.1
WP_004190873.1\|4144200_4145106_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004152360.1\|4145112_4146378_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	7.6e-197	79.6
WP_002901192.1\|4146380_4146800_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	5.5e-35	57.5
WP_002901096.1\|4147070_4147313_+	DinI family protein	Q6UAW0	Klebsiella_phage	4.1e-27	72.2

DBSCAN-SWA_305

4154242 : 4157828

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176549.1\|4154242_4155256_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.9e-12	29.0
WP_004150782.1\|4155313_4155415_+	YoaK family small membrane protein	NA	NA	NA	NA
WP_004213093.1\|4155414_4155489_+	protein YoaJ	NA	NA	NA	NA
WP_004140488.1\|4155606_4155732_+	hypothetical protein	NA	NA	NA	NA
WP_004190891.1\|4155791_4156055_-	DUF2534 family protein	NA	NA	NA	NA
WP_004150783.1\|4156185_4156824_-	leucine efflux protein LeuE	NA	NA	NA	NA
WP_004148038.1\|4156913_4157828_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	1.1e-72	50.4

DBSCAN-SWA_306

4163855 : 4164382

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000534858.1\|4163855_4164095_+	type II toxin-antitoxin system antitoxin RelB	A0A2H4JBG1	uncultured_Caudovirales_phage	1.6e-18	54.4
WP_000323025.1\|4164094_4164382_+	type II toxin-antitoxin system mRNA interferase RelE	A0A2H4JBF4	uncultured_Caudovirales_phage	1.4e-29	66.0

DBSCAN-SWA_307

4167498 : 4168761

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000608644.1\|4167498_4168761_-\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0

DBSCAN-SWA_308

4171776 : 4173561

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190899.1\|4171776_4173561_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-17	36.1

DBSCAN-SWA_309

4188165 : 4189416

Phage_21(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004150800.1\|4188165_4189416_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-19	92.6

DBSCAN-SWA_310

4192644 : 4194015

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190926.1\|4192644_4194015_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.7e-107	45.1

DBSCAN-SWA_311

4201234 : 4202371

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004147966.1\|4201234_4202371_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	2.6e-31	36.0

DBSCAN-SWA_312

4206804 : 4211647

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004190946.1\|4206804_4208433_-	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.1e-27	26.8
WP_004190949.1\|4208670_4210674_-	transketolase	NA	NA	NA	NA
WP_009484250.1\|4210693_4211647_-	transaldolase	A0A0E3G6C9	Synechococcus_phage	3.6e-13	38.3

DBSCAN-SWA_313

4218905 : 4222656

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176563.1\|4218905_4219736_-	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	5.3e-21	34.0
WP_004140619.1\|4219750_4220662_-	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_004176565.1\|4220710_4221955_-	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_002900798.1\|4221954_4222656_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	7.8e-34	40.4

DBSCAN-SWA_314

4242380 : 4243022

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002900674.1\|4242380_4243022_-	dTMP kinase	Q2Z0N0	Pseudomonas_phage	3.8e-27	37.0

DBSCAN-SWA_315

4246301 : 4247483

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000103754.1\|4246301_4246538_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.5e-10	45.2
WP_002899294.1\|4246748_4247483_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-15	34.1

DBSCAN-SWA_316

4266639 : 4266891

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002898994.1\|4266639_4266891_+	DNA damage-inducible protein I	H6WRY5	Salmonella_phage	5.1e-12	48.7

DBSCAN-SWA_317

4270132 : 4271053

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004140735.1\|4270132_4271053_+	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	3.3e-56	42.2

DBSCAN-SWA_318

4279404 : 4279932

Infectious_spleen_and_kidney_necrosis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176593.1\|4279404_4279932_-	O-acetyl-ADP-ribose deacetylase	A0A140G0J9	Infectious_spleen_and_kidney_necrosis_virus	1.3e-28	45.3

DBSCAN-SWA_319

4289959 : 4290748

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002898923.1\|4289959_4290748_-	phosphate starvation-inducible protein PhoH	R4II13	Cronobacter_phage	6.4e-93	77.6

DBSCAN-SWA_320

4307582 : 4311101

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176611.1\|4307582_4308077_+	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	6.9e-37	75.0
WP_004191019.1\|4308098_4309421_+	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	4.1e-201	87.6
WP_004893057.1\|4309826_4310717_-	DMT family transporter	NA	NA	NA	NA
WP_002898708.1\|4310927_4311101_-	general stress protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_321

4333311 : 4333812

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570769.1\|4333311_4333587_+	hypothetical protein	A0A0M3ULK3	Salmonella_phage	1.3e-24	62.1
WP_168786282.1\|4333560_4333812_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	3.4e-24	81.7

DBSCAN-SWA_322

4338131 : 4380190

Salmonella_phage(22.58%)

transposase,protease,holin,tail,integrase,head

attL 4344592:4344606|attR 4378417:4378431

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570766.1\|4338131_4338662_-	hypothetical protein	K7P6W1	Enterobacteria_phage	9.1e-35	48.3
WP_004199518.1\|4338658_4339198_-	lysozyme	H6WRZ4	Salmonella_phage	4.5e-82	78.7
WP_004199490.1\|4339199_4339415_-\|holin	class II holin family protein	A5LH82	Enterobacteria_phage	1.1e-12	61.0
WP_071570765.1\|4339627_4340878_+	hypothetical protein	NA	NA	NA	NA
WP_064150322.1\|4341325_4341634_-	hypothetical protein	NA	NA	NA	NA
WP_071570764.1\|4341630_4344348_-	hypothetical protein	Q858F8	Salmonella_phage	1.5e-258	50.8
WP_071570763.1\|4344347_4346189_-	hypothetical protein	Q858F9	Salmonella_phage	3.0e-77	32.4
4344592:4344606	attL	NA	NA	NA	NA
WP_071570761.1\|4346188_4348495_-	transglycosylase SLT domain-containing protein	K4NWI2	Pseudomonas_phage	1.4e-34	32.1
WP_004099053.1\|4348616_4349585_-\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	5.1e-185	98.8
WP_071570759.1\|4349727_4349997_-	hypothetical protein	NA	NA	NA	NA
WP_071570757.1\|4350108_4350606_-	hypothetical protein	NA	NA	NA	NA
WP_029503976.1\|4350609_4350831_-	hypothetical protein	NA	NA	NA	NA
WP_016197572.1\|4351040_4351322_-	hypothetical protein	NA	NA	NA	NA
WP_004199486.1\|4351324_4351726_-	hypothetical protein	NA	NA	NA	NA
WP_071570756.1\|4351718_4353995_-	hypothetical protein	Q6J1R5	Burkholderia_virus	5.5e-113	34.5
WP_071570784.1\|4353994_4354600_-	hypothetical protein	NA	NA	NA	NA
WP_004191050.1\|4354661_4355135_-	hypothetical protein	K4NYY6	Pseudomonas_phage	1.8e-26	46.3
WP_004191051.1\|4355173_4356169_-	hypothetical protein	W6MW28	Pseudomonas_phage	2.7e-104	60.2
WP_071570754.1\|4356179_4356932_-	hypothetical protein	NA	NA	NA	NA
WP_029503969.1\|4356918_4357242_-	hypothetical protein	NA	NA	NA	NA
WP_064185222.1\|4357244_4358909_-\|head,tail	head-tail connector protein	A0A221SAN2	Ralstonia_phage	3.1e-105	39.4
WP_020947864.1\|4358908_4360303_-	hypothetical protein	A0A0E3JIA1	Rhodoferax_phage	3.1e-58	36.9
WP_071570753.1\|4360387_4360840_-	DNA-packaging protein	A3EYX3	Salmonella_phage	4.2e-49	66.4
WP_009308351.1\|4360846_4361107_-	hypothetical protein	NA	NA	NA	NA
WP_071570751.1\|4361090_4361324_-	hypothetical protein	NA	NA	NA	NA
WP_071570750.1\|4361385_4361910_-	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	8.1e-44	52.9
WP_004199525.1\|4361950_4362391_-	phage family protein	R9TRJ4	Aeromonas_phage	4.3e-14	43.8
WP_071570748.1\|4362396_4362744_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071570746.1\|4362731_4363055_-	DUF968 domain-containing protein	A0A1I9KFA7	Aeromonas_phage	6.8e-25	55.8
WP_025712903.1\|4363044_4363638_-	DUF1367 family protein	H9C173	Pectobacterium_phage	3.6e-80	71.6
WP_025712904.1\|4363706_4363898_-	hypothetical protein	NA	NA	NA	NA
WP_064162584.1\|4364078_4364417_-	hypothetical protein	A0A193GYX4	Enterobacter_phage	3.0e-47	82.0
WP_004141581.1\|4364429_4365047_-	HNH endonuclease	NA	NA	NA	NA
WP_004141582.1\|4365043_4365274_-	hypothetical protein	A0A2H4JCC5	uncultured_Caudovirales_phage	5.0e-06	37.3
WP_071570744.1\|4365276_4365867_-	adenine methylase	A0A0F6TJC3	Escherichia_coli_O157_typing_phage	6.7e-95	83.9
WP_042929464.1\|4365994_4366780_-	hypothetical protein	C7BGF1	Burkholderia_phage	1.0e-66	54.5
WP_004191074.1\|4366819_4367053_-	hypothetical protein	NA	NA	NA	NA
WP_071570743.1\|4367056_4367707_-	hypothetical protein	NA	NA	NA	NA
WP_025712911.1\|4367745_4369134_-	AAA family ATPase	Q8HA30	Enterobacteria_phage	1.1e-106	47.9
WP_032415178.1\|4369130_4370114_-	helix-turn-helix domain-containing protein	H9C164	Pectobacterium_phage	1.3e-39	73.8
WP_016197573.1\|4370116_4370275_-	hypothetical protein	NA	NA	NA	NA
WP_022644597.1\|4370358_4370805_-	hypothetical protein	H9C162	Pectobacterium_phage	5.7e-30	56.1
WP_022644596.1\|4370865_4371060_-	hypothetical protein	NA	NA	NA	NA
WP_025712912.1\|4371140_4371527_+	helix-turn-helix domain-containing protein	A5VW98	Enterobacteria_phage	3.4e-15	57.8
WP_024623105.1\|4372468_4372702_+	hypothetical protein	NA	NA	NA	NA
WP_022644594.1\|4372709_4372955_+	hypothetical protein	A0A1B1W282	Salmonella_phage	3.7e-15	59.5
WP_071570741.1\|4372984_4375114_+	hypothetical protein	H9C157	Pectobacterium_phage	8.0e-98	34.2
WP_009308318.1\|4375113_4375680_+	siphovirus Gp157 family protein	H9C156	Pectobacterium_phage	2.5e-51	61.5
WP_004199480.1\|4376076_4376301_+	DUF4224 domain-containing protein	H9C153	Pectobacterium_phage	4.5e-20	68.1
WP_025712918.1\|4376304_4377333_+\|integrase	tyrosine-type recombinase/integrase	A0A192Y7M7	Salmonella_phage	4.0e-95	54.4
WP_004176629.1\|4377608_4379261_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
4378417:4378431	attR	NA	NA	NA	NA
WP_004191089.1\|4379530_4380190_+\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	1.1e-37	47.1

DBSCAN-SWA_323

4385133 : 4387188

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176653.1\|4385133_4387188_-	DNA helicase IV	A7KV33	Bacillus_phage	1.8e-14	26.0

DBSCAN-SWA_324

4399879 : 4401787

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004147848.1\|4399879_4401787_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.2e-49	28.3

DBSCAN-SWA_325

4410553 : 4415676

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004150838.1\|4410553_4411327_+	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-29	38.5
WP_002898220.1\|4411531_4414147_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	1.7e-20	22.4
WP_002898217.1\|4414473_4415676_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.1e-41	31.5

DBSCAN-SWA_326

4421737 : 4426084

Bandra_megavirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002898206.1\|4421737_4423138_+\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	1.0e-80	36.8
WP_086893435.1\|4423729_4423969_+	hypothetical protein	Q1MVN1	Enterobacteria_phage	2.0e-05	45.8
WP_071570783.1\|4424575_4426084_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.2e-44	31.3

DBSCAN-SWA_327

4444442 : 4448985

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002898170.1\|4444442_4446191_-	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	4.6e-59	30.7
WP_023279136.1\|4446227_4448492_-	ComEC family protein	NA	NA	NA	NA
WP_002898165.1\|4448697_4448985_-	integration host factor subunit beta	A7KV42	Bacillus_phage	4.2e-10	40.2

DBSCAN-SWA_328

4453158 : 4454247

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002898155.1\|4453158_4454247_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.0e-80	46.8

DBSCAN-SWA_329

4458298 : 4488428

Tetraselmis_virus(13.33%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191136.1\|4458298_4460581_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	6.5e-162	41.9
WP_002898145.1\|4460772_4461513_+	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.4e-20	26.5
WP_004150843.1\|4461675_4462824_-	MFS transporter	NA	NA	NA	NA
WP_004150844.1\|4463098_4463962_-	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_004191137.1\|4463963_4464581_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	5.8e-73	58.1
WP_071570733.1\|4464591_4467030_-	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	4.7e-219	50.1
WP_002898139.1\|4467230_4468523_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.3e-94	44.7
WP_004191141.1\|4468613_4469957_-	replication-associated recombination protein RarA	G3MBE0	Bacillus_virus	3.3e-81	40.7
WP_002898132.1\|4469965_4470577_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_016946995.1\|4470699_4474953_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	5.2e-88	49.2
WP_000228469.1\|4475088_4475583_-	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_002898019.1\|4476115_4477084_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.2e-62	44.0
WP_002898017.1\|4477198_4478965_+	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	2.3e-21	25.9
WP_004191145.1\|4478965_4480687_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.2e-14	34.3
WP_002898014.1\|4480731_4481433_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_001040187.1\|4481786_4482005_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_002896522.1\|4482124_4484404_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_002896520.1\|4484434_4484752_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896516.1\|4485077_4485299_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_004191149.1\|4485375_4487316_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.5e-37	40.5
WP_004191152.1\|4487312_4488428_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7

DBSCAN-SWA_330

4501240 : 4505591

Roseobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004209681.1\|4501240_4502071_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0UZW5	Roseobacter_phage	4.1e-05	31.6
WP_023279141.1\|4502102_4503242_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_002896394.1\|4504120_4504636_+	lipoprotein	NA	NA	NA	NA
WP_002896392.1\|4504862_4505591_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.2e-29	37.1

DBSCAN-SWA_331

4508735 : 4520323

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570732.1\|4508735_4510208_-	sensor histidine kinase	W8CYF6	Bacillus_phage	7.9e-28	31.8
WP_002896380.1\|4510204_4510921_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-34	36.9
WP_004147758.1\|4510999_4512127_-	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A2K5B251	Erysipelothrix_phage	1.8e-19	25.6
WP_002896376.1\|4512168_4512657_-	DUF2593 family protein	NA	NA	NA	NA
WP_002896372.1\|4512714_4513560_-	putrescine ABC transporter permease PotI	NA	NA	NA	NA
WP_002896371.1\|4513556_4514510_-	putrescine ABC transporter permease PotH	NA	NA	NA	NA
WP_002896370.1\|4514520_4515654_-	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	2.2e-30	34.9
WP_002896368.1\|4515817_4516930_-	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
WP_002896365.1\|4517278_4517758_-	YbjN domain-containing protein	NA	NA	NA	NA
WP_002896363.1\|4517846_4518749_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	2.0e-34	35.3
WP_004191168.1\|4518863_4519586_-	nitroreductase NfsA	NA	NA	NA	NA
WP_002896354.1\|4519569_4519857_-	YbjC family protein	NA	NA	NA	NA
WP_002896352.1\|4520059_4520323_+	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	1.6e-27	73.1

DBSCAN-SWA_332

4527795 : 4529795

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151717.1\|4527795_4528554_+	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	2.4e-12	27.6
WP_004191175.1\|4528592_4529795_-	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	8.5e-97	49.6

DBSCAN-SWA_333

4541380 : 4543240

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151710.1\|4541380_4543240_-	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	6.3e-14	29.2

DBSCAN-SWA_334

4547483 : 4549916

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570731.1\|4547483_4549916_+	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A2K8HAT8	Bacteriophage	8.0e-09	47.4

DBSCAN-SWA_335

4557518 : 4559111

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002895876.1\|4557518_4559111_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	5.0e-60	28.7

DBSCAN-SWA_336

4562120 : 4563497

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279156.1\|4562120_4563497_-	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	1.4e-23	23.6

DBSCAN-SWA_337

4567499 : 4572651

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002895845.1\|4567499_4568012_-	outer membrane protein OmpX	H6WZM8	Escherichia_phage	1.7e-14	33.8
WP_002895842.1\|4568363_4569251_+	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_002895841.1\|4569488_4569992_+	DNA starvation/stationary phase protection protein Dps	A0A222Z0F3	Streptomyces_phage	9.3e-05	47.6
WP_002895839.1\|4570400_4571147_+	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_002895837.1\|4571272_4571932_+	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_004142040.1\|4571928_4572651_+	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	3.3e-35	42.7

DBSCAN-SWA_338

4576725 : 4584678

Erwinia_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004223802.1\|4576725_4576986_+	DUF1471 domain-containing protein	A0A1B2IB27	Erwinia_phage	1.6e-05	47.9
WP_002895824.1\|4577006_4577273_+	DksA/TraR family C4-type zinc finger protein	A0A1S6UBD1	Serratia_phage	1.6e-16	52.3
WP_004176772.1\|4577558_4577819_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_004191225.1\|4577928_4578897_-	DNA-binding protein YbiB	NA	NA	NA	NA
WP_071570730.1\|4578926_4581083_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	2.6e-43	26.3
WP_004151702.1\|4581270_4582626_-	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.3e-48	31.8
WP_004176778.1\|4582840_4583833_-	transketolase family protein	NA	NA	NA	NA
WP_002895753.1\|4583832_4584678_-	transketolase	G9E5U1	Micromonas_pusilla_virus	3.1e-08	30.3

DBSCAN-SWA_339

4589883 : 4591623

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176789.1\|4589883_4591623_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.3e-17	31.5

DBSCAN-SWA_340

4601790 : 4602696

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004142092.1\|4601790_4602696_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	1.7e-28	29.8

DBSCAN-SWA_341

4609193 : 4609916

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152853.1\|4609193_4609916_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.9e-07	24.9

DBSCAN-SWA_342

4613719 : 4618803

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191247.1\|4613719_4615009_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	3.8e-18	27.8
WP_002895575.1\|4615079_4615556_+	kinase inhibitor	NA	NA	NA	NA
WP_004191248.1\|4615795_4617178_-	amino acid permease	NA	NA	NA	NA
WP_004147671.1\|4617276_4618803_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.7e-81	38.0

DBSCAN-SWA_343

4625256 : 4626620

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087529040.1\|4625256_4626620_-\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5

DBSCAN-SWA_344

4630342 : 4631077

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176830.1\|4630342_4631077_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.4e-49	50.3

DBSCAN-SWA_345

4635923 : 4642446

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191263.1\|4635923_4636982_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	1.5e-17	34.2
WP_004191265.1\|4636984_4637674_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_004176834.1\|4637673_4638447_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_002895156.1\|4638589_4638739_-	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_002895154.1\|4638891_4639680_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_071570727.1\|4639747_4641220_+	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	2.0e-10	24.1
WP_002895150.1\|4641429_4642446_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.8e-79	45.4

DBSCAN-SWA_346

4646806 : 4650317

Edwardsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002895086.1\|4646806_4647859_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	1.2e-81	48.0
WP_002895084.1\|4648173_4648539_+	hypothetical protein	NA	NA	NA	NA
WP_004147641.1\|4648656_4649601_+	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	3.4e-24	28.4
WP_004151689.1\|4649597_4650317_-	nicotinamide riboside transporter PnuC	I6W764	Vibriophage	2.0e-24	34.6

DBSCAN-SWA_347

4674643 : 4675435

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894935.1\|4674643_4675435_-	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	2.1e-11	26.2

DBSCAN-SWA_348

4681244 : 4688674

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570726.1\|4681244_4682723_+	dipeptide permease DtpD	A0A0P0IY73	Acinetobacter_phage	1.1e-45	28.8
WP_004147610.1\|4682694_4684137_-	deoxyribodipyrimidine photo-lyase	F2Y1V1	Organic_Lake_phycodnavirus	5.1e-56	33.1
WP_004142243.1\|4684320_4684530_-	DUF2517 family protein	NA	NA	NA	NA
WP_020323459.1\|4684836_4684926_+	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_004152226.1\|4684925_4686605_+	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_004191295.1\|4686625_4688674_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	7.9e-26	24.3

DBSCAN-SWA_349

4695500 : 4696274

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152229.1\|4695500_4696274_+	esterase	A0A286MQ79	Mycobacterium_phage	2.9e-05	29.7

DBSCAN-SWA_350

4700962 : 4704764

Escherichia_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894753.1\|4700962_4702630_-\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	93.5
WP_004147599.1\|4702808_4704764_-	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	6.4e-09	48.6

DBSCAN-SWA_351

4709517 : 4711182

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894734.1\|4709517_4711182_+	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	7.2e-86	39.7

DBSCAN-SWA_352

4715222 : 4716269

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176871.1\|4715222_4716269_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	3.2e-47	46.6

DBSCAN-SWA_353

4722273 : 4730239

Planktothrix_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894706.1\|4722273_4722999_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-29	36.6
WP_004176875.1\|4723372_4725043_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_004191314.1\|4725108_4726902_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	1.6e-27	35.9
WP_002894699.1\|4726947_4727430_-	zinc ribbon-containing protein	NA	NA	NA	NA
WP_004147581.1\|4727656_4730239_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.0e-184	42.5

DBSCAN-SWA_354

4737283 : 4739770

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004147579.1\|4737283_4738432_+	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	1.1e-08	51.6
WP_002894539.1\|4738570_4739770_+	D-alanyl-D-alanine carboxypeptidase DacA	B6DZZ7	Stx2-converting_phage	6.5e-105	49.0

DBSCAN-SWA_355

4744648 : 4745309

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894459.1\|4744648_4745032_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	6.8e-24	49.1
WP_002439184.1\|4745099_4745309_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.2e-22	79.7

DBSCAN-SWA_356

4749399 : 4751470

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894401.1\|4749399_4749828_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	7.4e-19	40.0
WP_002894398.1\|4749904_4751470_-	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	6.4e-44	34.6

DBSCAN-SWA_357

4754605 : 4768320

Streptococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002894369.1\|4754605_4755829_+	DUF3440 domain-containing protein	A0A220GKF8	Streptococcus_phage	4.1e-62	34.1
WP_004151651.1\|4755813_4756440_+	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	1.1e-52	48.2
WP_072158507.1\|4756440_4757586_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_004179015.1\|4757727_4758417_+	acireductone synthase	NA	NA	NA	NA
WP_002894357.1\|4758413_4758956_+	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase	NA	NA	NA	NA
WP_004191355.1\|4759063_4761373_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	4.3e-81	33.2
WP_002894353.1\|4761781_4762762_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004191358.1\|4762806_4764309_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.2e-16	30.1
WP_004147555.1\|4764305_4765295_+	ABC transporter permease	NA	NA	NA	NA
WP_004191361.1\|4765291_4766296_+	ABC transporter permease	NA	NA	NA	NA
WP_004191364.1\|4766307_4767249_+	sugar kinase	NA	NA	NA	NA
WP_004191366.1\|4767291_4768320_-	2-hydroxyacid dehydrogenase	A0A2R8FCS0	Cedratvirus	7.2e-28	34.0

DBSCAN-SWA_358

4785432 : 4789853

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023328707.1\|4785432_4786935_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.9e-17	27.5
WP_023328708.1\|4787098_4788187_+	oxidoreductase	NA	NA	NA	NA
WP_023328709.1\|4788244_4788988_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_002893907.1\|4789171_4789474_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_004176911.1\|4789448_4789853_+	helix-turn-helix transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	3.0e-06	33.3

DBSCAN-SWA_359

4812112 : 4816853

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002893737.1\|4812112_4812907_+	iron-enterobactin ABC transporter ATP-binding protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.5e-09	25.7
WP_004191399.1\|4812971_4816853_-	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	1.5e-54	27.6

DBSCAN-SWA_360

4828246 : 4829791

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004176928.1\|4828246_4829791_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.6e-15	29.3

DBSCAN-SWA_361

4836494 : 4842408

Vibrio_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004142478.1\|4836494_4838528_-\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	5.8e-21	27.7
WP_004151671.1\|4838656_4839244_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_023328716.1\|4839257_4840730_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_023328717.1\|4840743_4842408_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	4.7e-61	31.2

DBSCAN-SWA_362

4846965 : 4857698

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570717.1\|4846965_4847802_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.9e-13	31.4
WP_004178936.1\|4847788_4848493_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-25	36.6
WP_087529040.1\|4849002_4850366_-\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5
WP_023328720.1\|4850682_4852020_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_004176941.1\|4852200_4852965_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_004151676.1\|4853018_4853780_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-19	31.5
WP_002893189.1\|4853772_4854438_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_002893187.1\|4854452_4855094_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_004176946.1\|4855141_4855993_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_004176948.1\|4856234_4857698_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.8e-17	24.6

DBSCAN-SWA_363

4866651 : 4869375

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152949.1\|4866651_4869375_-	cation-transporting P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	2.1e-66	27.1

DBSCAN-SWA_364

4905407 : 4911007

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009484533.1\|4905407_4905770_-	helix-turn-helix domain-containing protein	A0A222YXG1	Escherichia_phage	2.6e-57	89.8
WP_129498415.1\|4906179_4906506_-	hypothetical protein	NA	NA	NA	NA
WP_023288402.1\|4906562_4907618_-	galactitol-1-phosphate 5-dehydrogenase	E3SJ82	Synechococcus_phage	1.1e-12	24.9
WP_023288400.1\|4907886_4908159_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_023288399.1\|4908203_4909043_-	class II aldolase	NA	NA	NA	NA
WP_023279216.1\|4909048_4909792_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_023279217.1\|4909972_4911007_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L7I1	Tupanvirus	2.0e-14	28.1

DBSCAN-SWA_365

4915778 : 4916894

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279222.1\|4915778_4916894_-	class II histone deacetylase	A0A2K9KZC4	Tupanvirus	1.5e-39	32.7

DBSCAN-SWA_366

4931794 : 4932592

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002892698.1\|4931794_4932592_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.0e-14	29.7

DBSCAN-SWA_367

4939214 : 4945016

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004191473.1\|4939214_4940615_+	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	7.3e-15	24.6
WP_014907957.1\|4940638_4941649_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_004183251.1\|4941664_4942306_-	hypothetical protein	NA	NA	NA	NA
WP_004152946.1\|4942489_4943512_-	ABC transporter permease	NA	NA	NA	NA
WP_004142660.1\|4943531_4945016_-	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	4.9e-09	20.0

DBSCAN-SWA_368

4953681 : 5027720

uncultured_Caudovirales_phage(27.59%)

tRNA,transposase,plate,terminase,holin,tail,lysis

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002892491.1\|4953681_4955199_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	9.5e-85	36.3
WP_004151795.1\|4955530_4957006_-	dipeptide permease DtpD	A0A0P0IY73	Acinetobacter_phage	6.9e-48	29.0
WP_002892486.1\|4957065_4959213_-	lysine decarboxylase CadA	NA	NA	NA	NA
WP_002892484.1\|4959295_4960630_-	cadaverine/lysine antiporter	NA	NA	NA	NA
WP_004191488.1\|4960995_4962564_-	lysine decarboxylation/transport transcriptional activator CadC	NA	NA	NA	NA
WP_002892402.1\|4962857_4963130_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_002892400.1\|4963230_4964151_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	5.4e-51	40.1
WP_002892397.1\|4964661_4965528_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004147417.1\|4965550_4966576_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_004191492.1\|4966577_4969013_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_004893746.1\|4969023_4969719_-	molecular chaperone	NA	NA	NA	NA
WP_004191498.1\|4969777_4970338_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_002892378.1\|4970808_4971471_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_004191501.1\|4971448_4971754_+	hypothetical protein	NA	NA	NA	NA
WP_004147414.1\|4971806_4973111_-	citrate synthase	NA	NA	NA	NA
WP_020804400.1\|4973156_4973297_-	hypothetical protein	NA	NA	NA	NA
WP_002892370.1\|4973621_4973792_+	hypothetical protein	NA	NA	NA	NA
WP_002892366.1\|4973870_4974272_-	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_002892360.1\|4974667_4974961_-	hypothetical protein	NA	NA	NA	NA
WP_141770833.1\|4975727_4975940_-	hypothetical protein	NA	NA	NA	NA
WP_071570712.1\|4975942_4976206_-	hypothetical protein	NA	NA	NA	NA
WP_071570710.1\|4978092_4978671_-\|tail	tail fiber assembly protein	K7PMH7	Enterobacteria_phage	2.2e-50	51.8
WP_071570709.1\|4978670_4979456_-\|tail	tail fiber protein	E5G6P0	Salmonella_phage	1.2e-30	53.5
WP_071570708.1\|4979455_4980229_-	DUF2612 domain-containing protein	A0A2H4J1A9	uncultured_Caudovirales_phage	3.8e-66	49.8
WP_071570707.1\|4980225_4981425_-\|plate	baseplate J/gp47 family protein	A0A0M4RD32	Salmonella_phage	2.6e-162	75.4
WP_071570706.1\|4981424_4981778_-	hypothetical protein	A0A2H4J629	uncultured_Caudovirales_phage	1.9e-49	79.5
WP_071570848.1\|4981779_4982433_-	hypothetical protein	A0A2H4J8H6	uncultured_Caudovirales_phage	8.5e-59	62.9
WP_071570849.1\|4982605_4983274_+	hypothetical protein	NA	NA	NA	NA
WP_088295932.1\|4983306_4983540_-	hypothetical protein	A0A2H4J1A5	uncultured_Caudovirales_phage	6.4e-17	51.3
WP_065519883.1\|4983640_4984672_-	hypothetical protein	A0A2H4J1B2	uncultured_Caudovirales_phage	9.6e-97	52.5
WP_025714270.1\|4984674_4984902_-	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	1.6e-20	57.3
WP_023158909.1\|4984977_4985577_-	hypothetical protein	A0A2H4J1B3	uncultured_Caudovirales_phage	5.8e-54	58.1
WP_071570850.1\|4985576_4987580_-	lytic transglycosylase domain-containing protein	A0A2H4J9N7	uncultured_Caudovirales_phage	2.2e-243	63.1
WP_049073657.1\|4987569_4987722_-	hypothetical protein	A0A2H4J1A2	uncultured_Caudovirales_phage	1.7e-18	86.0
WP_065802505.1\|4987763_4988183_-	hypothetical protein	A0A2H4J2V6	uncultured_Caudovirales_phage	3.0e-41	66.7
WP_023312781.1\|4988186_4988630_-	DUF3277 family protein	A0A0M5M1K6	Salmonella_phage	2.1e-61	80.0
WP_071570851.1\|4988639_4989785_-	DUF3383 domain-containing protein	A0A2H4J8G4	uncultured_Caudovirales_phage	1.6e-164	77.2
WP_071570701.1\|4989788_4990229_-	hypothetical protein	A0A2H4J1A0	uncultured_Caudovirales_phage	7.8e-40	51.0
WP_023312779.1\|4990323_4990710_-	hypothetical protein	A0A2H4J1A4	uncultured_Caudovirales_phage	2.8e-49	79.0
WP_071570700.1\|4990709_4991216_-	hypothetical protein	NA	NA	NA	NA
WP_071570699.1\|4991212_4991632_-	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	4.4e-40	60.7
WP_071570698.1\|4991600_4991882_-	hypothetical protein	NA	NA	NA	NA
WP_040217289.1\|4991921_4992863_-	DUF2184 domain-containing protein	A0A2H4J191	uncultured_Caudovirales_phage	1.0e-137	77.4
WP_071570697.1\|4992874_4993369_-	hypothetical protein	A0A2H4JHM9	uncultured_Caudovirales_phage	5.5e-50	62.7
WP_071570696.1\|4993372_4994575_-	DUF2213 domain-containing protein	A0A0M4R5A6	Salmonella_phage	6.1e-111	55.9
WP_071570780.1\|4994626_4995175_-	hypothetical protein	A0A0M4REK0	Salmonella_phage	4.8e-47	56.3
WP_071570695.1\|4995230_4996682_-	DUF1073 domain-containing protein	A0A0M4S6U1	Salmonella_phage	2.9e-192	68.8
WP_071570694.1\|4996919_4998320_-\|terminase	PBSX family phage terminase large subunit	A0A077KAW0	Edwardsiella_phage	1.2e-187	69.0
WP_162377993.1\|4998270_4998759_-	hypothetical protein	NA	NA	NA	NA
WP_085949497.1\|4999326_5000474_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-147	92.6
WP_071570691.1\|5000748_5001504_-	trypsin-like peptidase domain-containing protein	A0A2H4J9L7	uncultured_Caudovirales_phage	4.7e-77	57.3
WP_049162787.1\|5001616_5001796_-	hypothetical protein	NA	NA	NA	NA
WP_134905963.1\|5001826_5002078_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	2.2e-15	92.9
WP_077268745.1\|5002835_5003300_-\|lysis	lysis protein	M9NYX9	Enterobacteria_phage	7.0e-39	56.5
WP_071570981.1\|5003296_5003794_-	lysozyme	K7P7Q3	Enterobacteria_phage	1.4e-77	83.0
WP_032419911.1\|5003771_5004041_-\|holin	holin	K7P6H9	Enterobacteria_phage	2.1e-32	78.3
WP_071570856.1\|5004658_5005159_-	antiterminator	G8C7V7	Escherichia_phage	1.6e-86	90.9
WP_071570857.1\|5005292_5005928_-	recombination protein NinG	M9NYX8	Enterobacteria_phage	1.6e-81	77.0
WP_071570858.1\|5005920_5006589_-	metallophosphoesterase	K7P6H8	Enterobacteria_phage	5.0e-107	80.5
WP_071570982.1\|5006585_5006753_-	NinE family protein	NA	NA	NA	NA
WP_071570859.1\|5006758_5007355_-	DUF1367 family protein	A0A0U2RT94	Escherichia_phage	3.6e-56	54.3
WP_172825048.1\|5007518_5007689_-	hypothetical protein	NA	NA	NA	NA
WP_088295931.1\|5007688_5008243_-	DUF551 domain-containing protein	R9TQX3	Aeromonas_phage	2.7e-37	50.0
WP_023301661.1\|5008341_5008521_-	hypothetical protein	NA	NA	NA	NA
WP_071570861.1\|5008517_5008970_-	ead/Ea22-like family protein	A0A077SLK5	Escherichia_phage	3.9e-10	37.9
WP_141770835.1\|5008966_5009182_-	hypothetical protein	NA	NA	NA	NA
WP_071570862.1\|5009178_5009736_-	hypothetical protein	NA	NA	NA	NA
WP_071570863.1\|5009732_5009957_-	hypothetical protein	H9C169	Pectobacterium_phage	3.0e-11	48.5
WP_071570864.1\|5009953_5010256_-	hypothetical protein	NA	NA	NA	NA
WP_012542627.1\|5010252_5011122_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	4.0e-96	70.1
WP_071570865.1\|5011106_5012006_-	hypothetical protein	G8C7U5	Escherichia_phage	3.4e-106	72.1
WP_071570866.1\|5012006_5012699_-	GIY-YIG nuclease family protein	A0A088F856	Sulfitobacter_phage	7.8e-10	46.7
WP_071570867.1\|5012785_5013106_-	hypothetical protein	A0A0M4RU01	Salmonella_phage	1.0e-36	69.8
WP_023284762.1\|5013155_5013371_-	helix-turn-helix transcriptional regulator	Q716D6	Shigella_phage	4.2e-15	60.9
WP_029602664.1\|5013470_5014103_+	helix-turn-helix domain-containing protein	A0A1I9KG86	Aeromonas_phage	1.2e-33	40.0
WP_009652632.1\|5014421_5014547_+	hypothetical protein	NA	NA	NA	NA
WP_004151303.1\|5014539_5014734_+	hypothetical protein	NA	NA	NA	NA
WP_071570868.1\|5014822_5015107_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	1.5e-39	79.8
WP_014342891.1\|5015286_5015622_+	hypothetical protein	A0A0F7L7F5	uncultured_marine_virus	1.3e-10	34.3
WP_071570869.1\|5015618_5016242_+	YqaJ viral recombinase family protein	S0A2A9	Cellulophaga_phage	1.8e-45	48.1
WP_071570870.1\|5016238_5016658_+	regulator	M9NYX4	Enterobacteria_phage	1.1e-62	81.3
WP_071570871.1\|5016663_5017320_+	DNA methyltransferase	G8C7S6	Escherichia_phage	2.3e-112	87.5
WP_071570872.1\|5017316_5017535_+	TraR/DksA family transcriptional regulator	A0A0K2FI84	Escherichia_phage	3.5e-09	52.8
WP_019725112.1\|5017538_5017781_+	excisionase family protein	A0A286S2A4	Klebsiella_phage	2.0e-29	81.3
WP_065803155.1\|5017828_5019091_+	DUF3596 domain-containing protein	A0A286S1S8	Klebsiella_phage	1.5e-232	94.8
WP_004189344.1\|5019331_5020141_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_071570873.1\|5020152_5021448_-	MFS transporter	Q6JIH2	Burkholderia_virus	7.4e-62	36.8
WP_004189341.1\|5021751_5022678_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004189338.1\|5022776_5023253_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004180410.1\|5023302_5024946_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	5.7e-136	50.4
WP_002910720.1\|5025229_5026123_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004175491.1\|5026128_5026848_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-11	26.0
WP_004189332.1\|5026844_5027720_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	9.5e-05	41.5

DBSCAN-SWA_369

5031581 : 5033876

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189325.1\|5031581_5033876_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.1e-158	41.7

DBSCAN-SWA_370

5041511 : 5108018

Enterobacteria_phage(42.42%)

capsid,tRNA,portal,plate,terminase,protease,tail,integrase,head

attL 5033716:5033732|attR 5099584:5099600

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5033716:5033732	attL	NA	NA	NA	NA
WP_002910830.1\|5041511_5042258_-\|protease	proteasome-type protease	NA	NA	NA	NA
WP_002910832.1\|5042274_5043090_-	transglutaminase family protein	NA	NA	NA	NA
WP_002910835.1\|5043086_5044016_-	alpha-E domain-containing protein	NA	NA	NA	NA
WP_004180417.1\|5044009_5045449_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_004175476.1\|5045833_5047579_+	alpha,alpha-trehalase	NA	NA	NA	NA
WP_004189310.1\|5047830_5049951_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_002910846.1\|5049992_5050604_-	membrane-bound lytic murein transglycosylase EmtA	A0A0H3V0Q1	Geobacillus_virus	3.0e-05	40.7
WP_002910883.1\|5050779_5051694_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_004189307.1\|5051786_5053520_+	potassium/proton antiporter	NA	NA	NA	NA
WP_071570875.1\|5054099_5054348_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_071570876.1\|5054392_5055547_-	phage late control D family protein	B9A7A9	Serratia_phage	2.1e-177	80.7
WP_071570877.1\|5055700_5056882_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0A7NV69	Enterobacteria_phage	3.0e-155	68.8
WP_032424801.1\|5056881_5057397_+\|tail	phage major tail tube protein	A0A0A7NPV8	Enterobacteria_phage	1.5e-63	70.6
WP_032426989.1\|5057451_5057751_+\|tail	phage tail assembly protein	B9A7B2	Serratia_phage	8.5e-30	71.9
WP_071570878.1\|5057783_5057921_+\|tail	GpE family phage tail protein	O80316	Escherichia_phage	5.8e-10	71.8
WP_071570879.1\|5057910_5060832_+\|tail	phage tail tape measure protein	A0A0A7NRZ9	Enterobacteria_phage	7.6e-208	45.2
WP_040197746.1\|5060842_5061331_+\|tail	phage tail protein	A0A0A7NV65	Enterobacteria_phage	4.7e-54	62.3
WP_071570880.1\|5061459_5062623_-\|tail	phage tail protein	S4TP62	Salmonella_phage	5.3e-43	48.4
WP_071570881.1\|5062702_5063002_-	hypothetical protein	NA	NA	NA	NA
WP_071570882.1\|5063013_5065062_-	hypothetical protein	A0A1W5PUZ2	Salmonella_phage	1.3e-15	35.2
WP_049118716.1\|5065066_5065663_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	3.3e-41	42.9
WP_071570883.1\|5065655_5066555_-\|plate	baseplate J/gp47 family protein	A0A0A7NPY5	Enterobacteria_phage	1.1e-91	60.9
WP_071570884.1\|5066541_5066910_-	GPW/gp25 family protein	A0A0A7NQ90	Enterobacteria_phage	8.0e-30	58.3
WP_071570885.1\|5066906_5067491_-\|plate	phage baseplate assembly protein V	A0A0A7NRZ3	Enterobacteria_phage	2.3e-63	61.7
WP_071570886.1\|5067490_5068132_-	phage virion morphogenesis protein	A0A0A7NV60	Enterobacteria_phage	6.2e-46	50.7
WP_071570887.1\|5068128_5068587_-\|tail	phage tail protein	A0A0A7NPU6	Enterobacteria_phage	9.6e-33	48.1
WP_071570888.1\|5068731_5069127_-	DUF2570 domain-containing protein	NA	NA	NA	NA
WP_071570889.1\|5069123_5069675_-	lysozyme	I7K3G5	Yersinia_phage	3.3e-27	38.3
WP_032424784.1\|5069671_5069953_-	hypothetical protein	B9A7B8	Serratia_phage	8.2e-19	58.4
WP_032424783.1\|5069943_5070144_-\|tail	tail protein X	A0A0A7NV57	Enterobacteria_phage	2.3e-15	66.2
WP_071570890.1\|5070143_5070641_-\|head	head completion/stabilization protein	B9A7B7	Serratia_phage	1.8e-61	71.5
WP_071570891.1\|5070743_5071658_-\|terminase	terminase	B9A7B6	Serratia_phage	8.5e-89	77.0
WP_032424780.1\|5071705_5072755_-\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	1.8e-106	55.0
WP_070550023.1\|5072779_5073613_-\|capsid	GPO family capsid scaffolding protein	A0A0A7NRY7	Enterobacteria_phage	5.5e-95	65.6
WP_071570892.1\|5073773_5075495_+	helix-turn-helix domain-containing protein	A0A0A7NV54	Enterobacteria_phage	6.9e-225	65.6
WP_071570893.1\|5075494_5076541_+\|portal	phage portal protein	A0A0A7NPT9	Enterobacteria_phage	9.9e-142	68.8
WP_071570894.1\|5077140_5078115_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_071570895.1\|5078341_5080936_-	replication endonuclease	A0A0M4RTM8	Salmonella_phage	1.0e-195	52.9
WP_071570896.1\|5080928_5081948_-	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	2.4e-92	53.4
WP_157665536.1\|5081923_5082076_-	hypothetical protein	NA	NA	NA	NA
WP_077271908.1\|5082086_5082314_-	hypothetical protein	NA	NA	NA	NA
WP_071570898.1\|5083258_5083453_-	hypothetical protein	NA	NA	NA	NA
WP_071570899.1\|5083449_5083677_-	hypothetical protein	NA	NA	NA	NA
WP_071570900.1\|5083685_5084264_-	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	2.4e-33	40.0
WP_071570901.1\|5084260_5084485_-	hypothetical protein	NA	NA	NA	NA
WP_071570983.1\|5084554_5084827_-	hypothetical protein	NA	NA	NA	NA
WP_032737937.1\|5084829_5085069_-	DUF4754 family protein	NA	NA	NA	NA
WP_086893446.1\|5085065_5085293_-	hypothetical protein	NA	NA	NA	NA
WP_032737939.1\|5085322_5085589_-	hypothetical protein	NA	NA	NA	NA
WP_064174338.1\|5085670_5085970_+	helix-turn-helix transcriptional regulator	Q1JS37	Enterobacteria_phage	7.7e-23	55.2
WP_064174353.1\|5086034_5087003_+\|integrase	tyrosine-type recombinase/integrase	A0A0F7LBR0	Escherichia_phage	3.8e-79	46.3
WP_032426923.1\|5087006_5087396_+	hypothetical protein	NA	NA	NA	NA
WP_032426928.1\|5087510_5087822_+	hypothetical protein	NA	NA	NA	NA
WP_004189304.1\|5087957_5089028_-	catabolic alanine racemase DadX	NA	NA	NA	NA
WP_004175465.1\|5089037_5090336_-	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_032413859.1\|5090434_5090581_-	hypothetical protein	NA	NA	NA	NA
WP_002910889.1\|5090657_5092190_+	SpoVR family protein	NA	NA	NA	NA
WP_002910890.1\|5092264_5092984_-	fatty acid metabolism transcriptional regulator FadR	NA	NA	NA	NA
WP_004189299.1\|5093232_5094783_+	sodium/proton antiporter NhaB	NA	NA	NA	NA
WP_002910894.1\|5094911_5095442_+	disulfide bond formation protein DsbB	NA	NA	NA	NA
WP_002910895.1\|5095592_5095937_+	DUF1971 domain-containing protein	NA	NA	NA	NA
WP_002910896.1\|5095943_5096390_-	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_004189297.1\|5096484_5097144_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_002910898.1\|5097160_5097442_-	YcgL domain-containing protein	NA	NA	NA	NA
WP_002910899.1\|5097568_5098267_+	septum site-determining protein MinC	NA	NA	NA	NA
WP_002910900.1\|5098290_5099103_+	septum site-determining protein MinD	NA	NA	NA	NA
WP_002910902.1\|5099106_5099376_+	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_014343235.1\|5099452_5100568_-	ribonuclease D	NA	NA	NA	NA
5099584:5099600	attR	NA	NA	NA	NA
WP_002910904.1\|5100649_5102335_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	26.0
WP_002910905.1\|5102540_5103122_-	Slp family lipoprotein	NA	NA	NA	NA
WP_004189291.1\|5103160_5103856_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_004175456.1\|5104001_5105912_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	1.1e-90	33.0
WP_002910910.1\|5106043_5106388_+	RidA family protein	NA	NA	NA	NA
WP_004145519.1\|5106388_5106574_-	YoaH family protein	NA	NA	NA	NA
WP_004189289.1\|5106662_5108018_+	aminodeoxychorismate synthase component 1	S4VT78	Pandoravirus	2.3e-42	40.4

DBSCAN-SWA_371

5111926 : 5113486

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145524.1\|5111926_5113486_-	CNNM family cation transport protein YoaE	A0A0R6PEZ3	Moraxella_phage	1.1e-40	44.0

DBSCAN-SWA_372

5120926 : 5121136

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062678.1\|5120926_5121136_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_373

5126372 : 5128421

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004145536.1\|5126372_5128421_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	3.0e-86	33.3

DBSCAN-SWA_374

5135928 : 5136582

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071570906.1\|5135928_5136582_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	4.0e-56	50.7

DBSCAN-SWA_375

5140304 : 5141273

Pectobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002911406.1\|5140304_5140535_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	5.9e-15	57.4
WP_002911407.1\|5140613_5141273_+	exodeoxyribonuclease X	A0A0H4IT92	Pseudoalteromonas_phage	2.2e-14	31.7

DBSCAN-SWA_376

5148697 : 5150173

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002911427.1\|5148697_5150173_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	3.2e-77	36.8

DBSCAN-SWA_377

5154098 : 5170645

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002911444.1\|5154098_5155418_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	5.3e-15	38.2
WP_004180437.1\|5155433_5156378_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_002911449.1\|5156456_5157209_+	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	6.7e-15	32.4
WP_002911451.1\|5157208_5157994_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_071570907.1\|5158057_5159068_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.4e-07	23.9
WP_002911454.1\|5159076_5159688_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_004200335.1\|5159767_5160289_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	3.4e-10	35.1
WP_002911459.1\|5160323_5161064_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002911477.1\|5161091_5161535_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_002911479.1\|5161536_5163324_-\|tRNA	aspartate--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.3e-11	27.2
WP_004145564.1\|5163591_5164158_+	hydrolase	NA	NA	NA	NA
WP_004200337.1\|5164154_5164973_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.1e-60	82.7
WP_002911484.1\|5165025_5165421_+	MAPEG family protein	NA	NA	NA	NA
WP_002911486.1\|5165460_5166204_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	4.1e-25	30.0
WP_004189248.1\|5166200_5167205_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_004145568.1\|5167286_5168030_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_004145569.1\|5168106_5168676_-	VOC family protein	NA	NA	NA	NA
WP_004189246.1\|5168911_5170645_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	6.1e-88	33.8

DBSCAN-SWA_378

5177582 : 5179097

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002911516.1\|5177582_5179097_-	L-arabinose ABC transporter ATP-binding protein AraG	A0A2R8FG22	Brazilian_cedratvirus	6.9e-11	30.0

DBSCAN-SWA_379

5195705 : 5196458

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151455.1\|5195705_5196458_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	2.2e-26	34.4

DBSCAN-SWA_380

5203059 : 5211503

Burkholderia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189221.1\|5203059_5204739_-	cellulose biosynthesis regulator YedQ	A0A127AWB9	Bacillus_phage	6.9e-20	41.1
WP_002911591.1\|5204854_5205766_-	DUF808 domain-containing protein	NA	NA	NA	NA
WP_004184683.1\|5205949_5206861_+	drug/metabolite exporter YedA	NA	NA	NA	NA
WP_004200342.1\|5206835_5207330_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	5.7e-31	50.7
WP_004153246.1\|5207310_5208711_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	3.9e-101	53.0
WP_002911594.1\|5208787_5209495_-	phosphohydrolase	S4W232	Pandoravirus	2.8e-07	27.7
WP_004151461.1\|5209537_5209819_-	hypothetical protein	NA	NA	NA	NA
WP_002911596.1\|5210357_5211503_+	porin OmpC	Q1MVN1	Enterobacteria_phage	1.1e-117	58.7

DBSCAN-SWA_381

5229091 : 5253747

Bacillus_phage(40.0%)

integrase

attL 5228406:5228421|attR 5248748:5248763

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5228406:5228421	attL	NA	NA	NA	NA
WP_023278866.1\|5229091_5230354_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0VMI6	Pseudomonas_phage	4.1e-73	39.3
WP_000703040.1\|5230547_5231852_-	yersiniabactin biosynthesis salicylate synthase YbtS	NA	NA	NA	NA
WP_023340455.1\|5231879_5233160_-	yersiniabactin-associated zinc MFS transporter YbtX	NA	NA	NA	NA
WP_002212761.1\|5233152_5234955_-	yersiniabactin ABC transporter ATP-binding/permease protein YbtQ	W8CYL7	Bacillus_phage	2.7e-22	26.6
WP_071570908.1\|5234941_5236654_-	yersiniabactin ABC transporter ATP-binding/permease protein YbtP	W8CYL7	Bacillus_phage	1.2e-30	26.6
WP_000140406.1\|5236910_5237870_+	yersiniabactin transcriptional regulator YbtA	NA	NA	NA	NA
WP_071570909.1\|5238060_5244168_+	yersiniabactin non-ribosomal peptide synthetase HMWP2	A0A2K9L3I8	Tupanvirus	1.5e-32	28.3
WP_071570910.1\|5244255_5253747_+	yersiniabactin polyketide synthase HMWP1	D0R7J2	Paenibacillus_phage	8.1e-49	36.5
5248748:5248763	attR	NA	NA	NA	NA

DBSCAN-SWA_382

5261313 : 5261499

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000205185.1\|5261313_5261499_+	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	5.6e-08	42.1

DBSCAN-SWA_383

5278232 : 5287208

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045339309.1\|5278232_5279180_-	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	1.3e-52	39.6
WP_157671194.1\|5280051_5281206_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_071570925.1\|5281211_5287208_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	1.2e-05	30.6

DBSCAN-SWA_384

5292856 : 5293942

Thermus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045338337.1\|5292856_5293942_-	DNA cytosine methyltransferase	A7XXH6	Thermus_virus	6.2e-38	33.5

DBSCAN-SWA_385

5300691 : 5301528

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004180471.1\|5300691_5301528_-	alpha/beta hydrolase	A0A2D1GKK1	Mycobacterium_phage	4.8e-14	28.8

DBSCAN-SWA_386

5317049 : 5318213

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004153104.1\|5317049_5318213_-	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	2.2e-182	80.6

DBSCAN-SWA_387

5326650 : 5327550

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002912152.1\|5326650_5327550_+	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	1.4e-11	92.1

DBSCAN-SWA_388

5334261 : 5355191

Escherichia_phage(15.38%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009307467.1\|5334261_5335242_+	glycosyltransferase family 2 protein	B9UDL7	Salmonella_phage	8.9e-44	34.8
WP_023342684.1\|5335243_5336704_+	hypothetical protein	E5AGC8	Erwinia_phage	4.2e-106	43.6
WP_009307464.1\|5336773_5337982_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.4e-08	39.1
WP_025987645.1\|5338077_5339220_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_004180501.1\|5339220_5340114_-	glycosyltransferase	NA	NA	NA	NA
WP_032413769.1\|5340110_5341265_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.1e-77	41.5
WP_032413771.1\|5341280_5343176_-	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_002912371.1\|5343191_5343932_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.7e-07	24.9
WP_002912373.1\|5343931_5344699_-	ABC transporter permease	NA	NA	NA	NA
WP_042943910.1\|5345742_5346747_+	NAD-dependent epimerase	E3T4Y8	Cafeteria_roenbergensis_virus	2.3e-31	29.5
WP_004144151.1\|5347147_5347270_+	small membrane protein	NA	NA	NA	NA
WP_009484573.1\|5347693_5348860_-	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	4.1e-112	54.5
WP_029498789.1\|5349040_5349595_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	8.6e-52	57.6
WP_029498787.1\|5349609_5350500_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.8e-28	34.2
WP_004175258.1\|5350531_5351401_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.7e-111	67.0
WP_042943911.1\|5351427_5352492_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	7.5e-105	54.7
WP_014343305.1\|5352714_5354121_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	4.7e-38	28.7
WP_077271909.1\|5354348_5355191_-	glycosyltransferase	A0A0N9QZR6	Chrysochromulina_ericina_virus	2.4e-13	30.3

DBSCAN-SWA_389

5374323 : 5381192

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001741945.1\|5374323_5375214_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	5.6e-45	41.0
WP_004151147.1\|5375979_5377563_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	5.0e-36	43.5
WP_023285356.1\|5378000_5379848_-	outer membrane assembly protein AsmA	NA	NA	NA	NA
WP_004151145.1\|5379878_5380460_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	5.1e-31	41.6
WP_002912442.1\|5380550_5381192_-	uridine kinase	A0A1V0SAA3	Catovirus	2.0e-36	39.3

DBSCAN-SWA_390

5398312 : 5405217

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004149058.1\|5398312_5399791_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.5e-30	28.3
WP_004175198.1\|5399787_5400510_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_004144192.1\|5400828_5402190_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.8e-207	94.8
WP_004151134.1\|5402432_5403329_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
WP_023307294.1\|5403569_5404343_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
WP_004175147.1\|5404353_5405217_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5

DBSCAN-SWA_391

5432236 : 5439291

Enterobacteria_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002912753.1\|5432236_5434270_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	8.9e-54	27.4
WP_002912756.1\|5434385_5434856_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	6.6e-61	74.4
WP_004144215.1\|5434903_5435623_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_002912760.1\|5435616_5437305_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.5e-259	84.1
WP_002912762.1\|5437534_5437648_+	protein YohO	NA	NA	NA	NA
WP_004151128.1\|5437622_5438360_-	ABC transporter permease	NA	NA	NA	NA
WP_004149083.1\|5438343_5439291_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.9e-25	31.7

DBSCAN-SWA_392

5445825 : 5446380

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002912829.1\|5445825_5446380_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.3e-20	37.8

DBSCAN-SWA_393

5462404 : 5463925

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002912876.1\|5462404_5463925_-	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	3.1e-11	32.0

DBSCAN-SWA_394

5467689 : 5471596

Cellulophaga_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004184878.1\|5467689_5468358_-	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	3.4e-55	55.8
WP_004151123.1\|5468718_5469552_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_002912926.1\|5469622_5471596_-	catecholate siderophore receptor CirA	A0A0P0I887	Acinetobacter_phage	4.8e-12	36.5

DBSCAN-SWA_395

5475995 : 5476850

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023278790.1\|5475995_5476850_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	8.9e-24	33.2

DBSCAN-SWA_396

5482558 : 5490531

Serratia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014343350.1\|5482558_5483245_-	hypothetical protein	A0A289ZIY5	Serratia_phage	2.1e-39	41.3
WP_004151121.1\|5483776_5484031_-	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_002912951.1\|5484178_5484751_+	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_071570934.1\|5484821_5486012_-	mannonate dehydratase	NA	NA	NA	NA
WP_004189024.1\|5486219_5487686_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	3.2e-45	31.2
WP_004189021.1\|5487806_5488784_+	GTP-binding protein	NA	NA	NA	NA
WP_002912965.1\|5488821_5489535_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_002912967.1\|5489961_5490531_+	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	A0A1V0DZX6	Clostridioides_phage	3.1e-12	38.0

DBSCAN-SWA_397

5496118 : 5502205

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004189011.1\|5496118_5497708_+	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	7.7e-21	32.8
WP_002912974.1\|5497711_5498056_-	hypothetical protein	NA	NA	NA	NA
WP_002912975.1\|5498387_5499584_-	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	2.6e-21	24.2
WP_009486447.1\|5499580_5500300_-	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_004144263.1\|5500447_5502205_+	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	6.4e-101	41.8

DBSCAN-SWA_398

5506439 : 5507447

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004144267.1\|5506439_5507447_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	2.4e-84	49.8

DBSCAN-SWA_399

5513812 : 5514973

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004151114.1\|5513812_5514973_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.6e-78	48.2

DBSCAN-SWA_400

5518893 : 5522291

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913002.1\|5518893_5519958_-	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A0G2Y3R2	Acanthamoeba_polyphaga_mimivirus	2.0e-17	49.5
WP_002913003.1\|5520031_5521084_-	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_071570936.1\|5521187_5522291_-	porin OmpC	Q1MVN1	Enterobacteria_phage	2.1e-118	60.4

DBSCAN-SWA_401

5526430 : 5538561

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913009.1\|5526430_5529271_-	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	8.3e-42	25.9
WP_023278787.1\|5529402_5532036_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	3.5e-95	31.0
WP_002913014.1\|5532182_5532911_+	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
WP_002913016.1\|5533255_5535541_+	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	2.5e-283	63.6
WP_004140835.1\|5535642_5536773_+	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	1.0e-176	79.7
WP_002913017.1\|5536772_5537027_+	2Fe-2S ferredoxin-like protein	G9IAA2	Pseudomonas_phage	8.2e-26	65.3
WP_002913018.1\|5537490_5538561_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	2.1e-09	52.6

DBSCAN-SWA_402

5546406 : 5547612

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004175029.1\|5546406_5547612_-	L-rhamnonate dehydratase	Q6A202	Oenococcus_phage	7.9e-26	28.0

DBSCAN-SWA_403

5550728 : 5551682

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913072.1\|5550728_5551682_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.1e-67	54.1

DBSCAN-SWA_404

5579708 : 5580308

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913188.1\|5579708_5580308_+	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	2.4e-07	39.8

DBSCAN-SWA_405

5592710 : 5593484

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913206.1\|5592710_5593484_-	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	1.9e-09	29.1

DBSCAN-SWA_406

5597775 : 5599293

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002913213.1\|5597775_5599293_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.0e-86	43.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP021961

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 70424

Salmonella_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032413377.1\|904_1252_+	hypothetical protein	NA	NA	NA	NA
WP_071571073.1\|2055_2241_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	1.3e-09	59.6
WP_032413443.1\|2953_3397_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_032413375.1\|3393_3864_+	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_017901409.1\|3973_4234_-	hypothetical protein	NA	NA	NA	NA
WP_075209834.1\|4869_5838_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	9.7e-184	98.1
WP_071571074.1\|6329_6500_-	hypothetical protein	NA	NA	NA	NA
WP_032414164.1\|6527_6881_+	EAL domain-containing protein	NA	NA	NA	NA
WP_000427620.1\|7062_8067_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001138073.1\|8145_11118_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.1
WP_001162012.1\|11120_11678_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
WP_032029331.1\|12286_12991_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.9e-139	99.6
WP_001166628.1\|13480_13936_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001294656.1\|14007_14373_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000732275.1\|14388_14664_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_000522996.1\|14691_15117_+	organomercurial transporter MerC	NA	NA	NA	NA
WP_071571067.1\|15155_16841_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	6.7e-39	29.1
WP_001277466.1\|16858_17224_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_001087807.1\|17220_17457_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_000993245.1\|17522_17735_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000147567.1\|17860_18421_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	4.0e-49	86.2
WP_062826775.1\|20024_20915_+	FRG domain-containing protein	NA	NA	NA	NA
WP_032216024.1\|21458_22439_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	3.0e-185	99.1
WP_008786741.1\|24388_24745_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_008786740.1\|24783_26094_-	MFS transporter	NA	NA	NA	NA
WP_169708473.1\|26103_26352_-	metal-sensing transcriptional repressor	NA	NA	NA	NA
WP_008786738.1\|26585_27683_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_008786737.1\|27726_28104_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021740570.1\|28287_31305_-\|transposase	Tn3-like element IS3000 family transposase	A0A125RQ78	Bacillus_phage	7.2e-52	24.7
WP_071571068.1\|32648_33899_+	DUF1173 family protein	NA	NA	NA	NA
WP_004099053.1\|33920_34889_+\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	5.1e-185	98.8
WP_004993232.1\|34969_35422_+	hypothetical protein	NA	NA	NA	NA
WP_019768104.1\|35483_35966_-	hypothetical protein	NA	NA	NA	NA
WP_014386410.1\|37266_38046_+	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	6.9e-31	34.7
WP_004994718.1\|38197_39223_+\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
WP_004201164.1\|39323_40136_+	subclass B1 metallo-beta-lactamase NDM-1	NA	NA	NA	NA
WP_004201167.1\|40139_40505_+	bleomycin binding protein Ble-MBL	NA	NA	NA	NA
WP_004201168.1\|40509_41148_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_004201169.1\|41158_42190_-	twin-arginine translocation (TAT) pathway signal sequence domain protein	NA	NA	NA	NA
WP_004201171.1\|42194_42524_-	divalent-cation tolerance protein CutA	NA	NA	NA	NA
WP_004201172.1\|42717_43008_+	co-chaperone GroES	A0A221S322	uncultured_virus	2.1e-17	47.8
WP_004201176.1\|43063_44704_+	chaperonin GroEL	A0A219YK78	uncultured_virus	8.2e-175	62.1
WP_001553819.1\|47376_50274_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	4.2e-182	37.8
WP_000509965.1\|50368_50974_+	recombinase family protein	A0A1S5Y2X8	uncultured_archaeal_virus	9.4e-20	35.3
WP_001214976.1\|51735_52143_+	cysteine hydrolase	NA	NA	NA	NA
WP_000058717.1\|52280_53165_+	EamA family transporter	NA	NA	NA	NA
WP_000804064.1\|53196_54396_-	tetracycline efflux MFS transporter Tet(A)	NA	NA	NA	NA
WP_000164043.1\|54501_55152_+	tetracycline resistance transcriptional repressor TetR(A)	NA	NA	NA	NA
WP_001067855.1\|57049_57754_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000237816.1\|58776_59229_+	NAD(+)--rifampin ADP-ribosyltransferase Arr-2	NA	NA	NA	NA
WP_012300772.1\|59549_60809_+	chloramphenicol efflux MFS transporter CmlA5	S4TR35	Salmonella_phage	1.7e-26	31.7
WP_000846390.1\|61073_61874_+	oxacillin-hydrolyzing class D beta-lactamase OXA-10	NA	NA	NA	NA
WP_001209508.1\|61890_62682_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000679427.1\|62805_63153_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|63146_63986_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000050481.1\|64390_65932_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_032413363.1\|66223_67216_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_000427620.1\|67619_68624_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_004186900.1\|69539_70424_+	hypothetical protein	J9Q7H0	Salmonella_phage	2.6e-50	43.2

DBSCAN-SWA_2

83622 : 87500

Macacine_betaherpesvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004117790.1\|83622_84594_-	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	7.0e-150	86.9
WP_023287153.1\|84593_85760_-	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	7.5e-223	97.2
WP_017900946.1\|86489_87500_+	replication initiation protein	J9Q7H0	Salmonella_phage	1.1e-86	53.5

DBSCAN-SWA_3

93315 : 95017

Klosneuvirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_077271912.1\|93315_94005_-	hypothetical protein	A0A1V0SL93	Klosneuvirus	5.9e-10	24.2
WP_004099053.1\|94048_95017_-\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	5.1e-185	98.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP021959

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14448 : 23667

Escherichia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071571081.1\|14448_16506_+	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	2.6e-21	25.4
WP_001568057.1\|16550_16982_+	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
WP_001568058.1\|16978_17707_+	plasmid SOS inhibition protein A	NA	NA	NA	NA
WP_001568059.1\|17703_18030_+	hypothetical protein	NA	NA	NA	NA
WP_023280872.1\|18085_18460_+	hypothetical protein	NA	NA	NA	NA
WP_009310022.1\|18660_19170_+\|transposase	IS3 family transposase	A0A2I6AZV8	Macacine_betaherpesvirus	6.9e-48	58.7
WP_071571082.1\|19412_20393_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_019706020.1\|20485_20698_+	hypothetical protein	NA	NA	NA	NA
WP_014343499.1\|20708_20933_+	hypothetical protein	NA	NA	NA	NA
WP_004152720.1\|21013_21334_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	6.8e-09	39.5
WP_004152721.1\|21323_21602_+	helix-turn-helix transcriptional regulator	O64356	Escherichia_phage	2.5e-07	39.4
WP_023287139.1\|21602_22016_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004152492.1\|22845_23667_+	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	1.2e-44	40.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP021962

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

757 : 31904

Salmonella_phage(83.87%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014342076.1\|757_934_+	hypothetical protein	J9Q7G9	Salmonella_phage	4.7e-12	68.8
WP_019704552.1\|1296_1632_+	hypothetical protein	J9Q7Z5	Salmonella_phage	2.1e-37	67.6
WP_014342074.1\|1631_1844_+	hypothetical protein	J9Q7S8	Salmonella_phage	4.3e-28	80.0
WP_014342073.1\|2295_3513_-	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	1.3e-73	47.3
WP_014342193.1\|3713_4358_+	hypothetical protein	J9Q739	Salmonella_phage	8.3e-99	80.7
WP_019704555.1\|4671_6231_-	DUF4041 domain-containing protein	X5JAC1	Clostridium_phage	6.6e-57	52.3
WP_014342188.1\|6883_7969_+	metallophosphoesterase	J9Q7S9	Salmonella_phage	2.0e-182	84.2
WP_014342187.1\|7968_8202_+	hypothetical protein	J9Q7H1	Salmonella_phage	3.4e-18	66.1
WP_019704556.1\|8198_10115_+	AAA family ATPase	J9Q741	Salmonella_phage	3.3e-300	84.8
WP_014342184.1\|10140_10851_+	hypothetical protein	J9Q6J5	Salmonella_phage	2.8e-71	57.6
WP_014342183.1\|10860_11430_+	hypothetical protein	J9Q7Z7	Salmonella_phage	3.8e-95	90.5
WP_014342182.1\|11505_13809_+	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	90.9
WP_014342181.1\|13939_15082_+	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	9.0e-213	95.8
WP_014342180.1\|15159_16035_+	nucleoside triphosphate pyrophosphohydrolase family protein	J9Q742	Salmonella_phage	4.5e-140	84.7
WP_014342179.1\|16228_17332_+	thymidylate synthase	J9Q6J6	Salmonella_phage	2.5e-180	79.8
WP_014342178.1\|17351_17747_+	hypothetical protein	J9Q7Z8	Salmonella_phage	2.6e-50	74.8
WP_019704561.1\|17743_18220_+	dihydrofolate reductase	J9Q7T1	Salmonella_phage	1.9e-71	79.0
WP_014342176.1\|18219_18864_+	AAA family ATPase	J9Q7H4	Salmonella_phage	6.8e-93	76.6
WP_014342175.1\|18927_19347_+	hypothetical protein	J9Q743	Salmonella_phage	1.9e-51	73.4
WP_014342174.1\|19356_19914_+	3'-5' exonuclease	J9Q6J8	Salmonella_phage	1.4e-86	84.2
WP_014342173.1\|20039_20873_+	hypothetical protein	J9Q7Z9	Salmonella_phage	1.1e-63	56.4
WP_014342172.1\|21057_21651_+	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	2.6e-107	94.9
WP_014342171.1\|21853_22087_+	hypothetical protein	J9Q7H5	Salmonella_phage	9.2e-32	85.5
WP_074181465.1\|22616_23285_+	ribonuclease HI	J9Q745	Salmonella_phage	2.6e-119	93.2
WP_064142047.1\|23430_23970_+	hypothetical protein	J9Q6J9	Salmonella_phage	2.2e-28	46.5
WP_019704567.1\|24270_24696_+	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	9.8e-56	80.9
WP_014342167.1\|24695_24851_+	DUF3927 family protein	H6WZJ7	Escherichia_phage	1.7e-05	61.2
WP_014342166.1\|24978_25557_+	hypothetical protein	J9Q7H6	Salmonella_phage	5.1e-55	57.0
WP_014342165.1\|25685_25901_+	restriction endonuclease subunit M	J9Q747	Salmonella_phage	1.2e-14	69.8
WP_071571095.1\|25962_29079_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	6.0e-25	23.8
WP_014342161.1\|29154_30351_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_014342160.1\|30347_31904_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	5.8e-106	42.9

DBSCAN-SWA_2

35849 : 95927

Salmonella_phage(92.59%)

terminase,portal,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014342156.1\|35849_36068_+	hypothetical protein	J9Q6K7	Salmonella_phage	6.4e-27	81.9
WP_014342155.1\|36080_36293_+	hypothetical protein	J9Q804	Salmonella_phage	7.6e-25	74.3
WP_014342154.1\|36441_36741_+	hypothetical protein	J9Q7T7	Salmonella_phage	5.0e-30	70.7
WP_032734118.1\|36860_37268_+	hypothetical protein	Q6UAS0	Klebsiella_phage	3.6e-23	45.0
WP_014342150.1\|37879_38362_+	hypothetical protein	J9Q805	Salmonella_phage	2.9e-64	70.0
WP_014342149.1\|38956_39160_-	hypothetical protein	J9Q7I3	Salmonella_phage	5.4e-28	95.5
WP_004109892.1\|39210_39861_-	hypothetical protein	J9Q754	Salmonella_phage	8.4e-107	91.7
WP_014342147.1\|40494_41025_-	transcriptional regulator	J9Q6L0	Salmonella_phage	3.5e-71	84.5
WP_019704582.1\|41180_41618_+	hypothetical protein	A0A1V0E7W1	Vibrio_phage	9.5e-14	36.4
WP_014342145.1\|41668_41944_-	hypothetical protein	J9Q7T9	Salmonella_phage	4.0e-26	68.1
WP_014342144.1\|41946_43506_-	DEAD/DEAH box helicase	J9Q7I4	Salmonella_phage	1.5e-279	92.7
WP_014342143.1\|43565_44270_+	ParB N-terminal domain-containing protein	J9Q756	Salmonella_phage	3.7e-108	88.8
WP_014342142.1\|44269_44938_+	ParB N-terminal domain-containing protein	J9Q6L1	Salmonella_phage	1.9e-106	91.4
WP_019704584.1\|44934_45573_+	ATP-binding cassette domain-containing protein	J9Q807	Salmonella_phage	1.4e-109	97.6
WP_014342139.1\|45565_45820_+	hypothetical protein	J9Q7U0	Salmonella_phage	1.0e-39	95.2
WP_004109872.1\|45825_46716_+	hypothetical protein	J9Q7I6	Salmonella_phage	5.4e-165	97.0
WP_004109869.1\|46725_46992_+	hypothetical protein	J9Q757	Salmonella_phage	1.3e-37	90.9
WP_014342138.1\|47167_47809_+	DNA-binding protein	J9Q6D4	Salmonella_phage	6.6e-96	88.2
WP_004109863.1\|47811_49068_+\|terminase	terminase	J9Q7Y2	Salmonella_phage	9.4e-248	97.4
WP_019704587.1\|49100_50675_+\|portal	phage portal protein	J9Q7R1	Salmonella_phage	1.3e-275	88.7
WP_014342135.1\|50697_51597_+	hypothetical protein	J9Q7F4	Salmonella_phage	1.0e-123	82.6
WP_004109857.1\|51623_52502_+	hypothetical protein	J9Q710	Salmonella_phage	4.7e-153	94.2
WP_014342134.1\|52580_53009_+	Ig domain-containing protein	J9Q6D6	Salmonella_phage	7.9e-29	71.6
WP_019704523.1\|53056_53491_+	hypothetical protein	J9Q7Y3	Salmonella_phage	2.9e-63	84.0
WP_014342131.1\|53490_54324_+	hypothetical protein	J9Q7R2	Salmonella_phage	4.1e-130	83.0
WP_004109848.1\|54421_54766_+	hypothetical protein	J9Q7F6	Salmonella_phage	7.4e-54	92.1
WP_004109845.1\|54756_55230_+	hypothetical protein	J9Q711	Salmonella_phage	1.9e-76	93.6
WP_014342130.1\|55231_55624_+	hypothetical protein	J9Q6D8	Salmonella_phage	5.3e-48	69.0
WP_004109839.1\|55691_56438_+	Ig domain-containing protein	J9Q7Y4	Salmonella_phage	3.7e-106	83.0
WP_004109835.1\|56499_56817_+	hypothetical protein	J9Q7R3	Salmonella_phage	1.8e-46	93.3
WP_014342129.1\|56942_57167_+	hypothetical protein	J9Q7F7	Salmonella_phage	2.0e-31	93.2
WP_019704526.1\|57174_61713_+	tape measure protein	J9Q712	Salmonella_phage	0.0e+00	72.1
WP_004109823.1\|61756_62092_+\|tail	phage tail protein	J9Q6E1	Salmonella_phage	3.4e-51	84.5
WP_004109820.1\|62178_62877_+\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	1.2e-122	87.4
WP_004109817.1\|62869_63667_+	C40 family peptidase	J9Q7R4	Salmonella_phage	5.4e-140	85.3
WP_014342125.1\|63654_64266_+\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	5.0e-77	72.1
WP_088295936.1\|64282_76453_+	DUF1983 domain-containing protein	J9Q713	Salmonella_phage	2.8e-30	59.8
WP_014342121.1\|76505_78005_+\|tail	tail fiber domain-containing protein	A0A0P0IDN1	Klebsiella_phage	2.1e-108	52.1
WP_004109805.1\|78101_78425_+	hypothetical protein	J9Q6E7	Salmonella_phage	2.3e-49	95.3
WP_014342120.1\|78438_79131_+	membrane protein	J9Q7Y7	Salmonella_phage	7.0e-120	89.6
WP_014342119.1\|79133_79385_+	hypothetical protein	J9Q7R6	Salmonella_phage	6.4e-23	71.1
WP_014342117.1\|79587_80109_-	hypothetical protein	NA	NA	NA	NA
WP_014342116.1\|80348_81014_+	AAA family ATPase	J9Q7R7	Salmonella_phage	8.3e-102	83.3
WP_014342115.1\|81019_81376_+	hypothetical protein	J9Q7G3	Salmonella_phage	1.4e-44	97.9
WP_019704531.1\|81448_82216_+	hypothetical protein	J9Q719	Salmonella_phage	6.6e-18	42.9
WP_019704532.1\|82208_82619_+	hypothetical protein	J9Q6F2	Salmonella_phage	7.1e-19	38.6
WP_014342111.1\|82801_83527_+	hypothetical protein	J9Q7R8	Salmonella_phage	1.3e-127	88.4
WP_014342110.1\|83591_84932_+	AAA family ATPase	J9Q7G4	Salmonella_phage	7.0e-241	95.7
WP_014342109.1\|85079_86204_+	hypothetical protein	J9Q720	Salmonella_phage	1.4e-202	91.3
WP_019704535.1\|86246_87413_-	hypothetical protein	NA	NA	NA	NA
WP_014342107.1\|87710_88499_+	hypothetical protein	J9Q7Z0	Salmonella_phage	5.3e-71	50.8
WP_014342106.1\|88578_89046_+	hypothetical protein	J9Q7R9	Salmonella_phage	2.0e-49	63.9
WP_014342105.1\|89045_90368_+	putative DNA ligase	J9Q7G5	Salmonella_phage	4.8e-226	85.2
WP_014342104.1\|90379_90544_+	hypothetical protein	J9Q729	Salmonella_phage	6.7e-13	72.5
WP_014342103.1\|90527_90743_+	hypothetical protein	J9Q6I3	Salmonella_phage	3.2e-23	77.1
WP_019704538.1\|90890_91307_+	hypothetical protein	NA	NA	NA	NA
WP_021740570.1\|92909_95927_-\|transposase	Tn3-like element IS3000 family transposase	A0A125RQ78	Bacillus_phage	7.2e-52	24.7

DBSCAN-SWA_3

120046 : 131725

Salmonella_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014342089.1\|120046_122332_+	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	8.0e-245	66.1
WP_019704545.1\|122428_123661_+	AAA family ATPase	J9Q733	Salmonella_phage	1.3e-212	86.6
WP_019704546.1\|123841_127360_+	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	93.0
WP_014342084.1\|127374_127800_+	hypothetical protein	J9Q7S4	Salmonella_phage	8.6e-60	83.7
WP_019704547.1\|128000_128420_+	hypothetical protein	A0A291AWZ9	Escherichia_phage	1.8e-46	61.9
WP_014342082.1\|128431_128731_+	lipoprotein	NA	NA	NA	NA
WP_014342081.1\|128895_129327_+	hypothetical protein	J9Q6I8	Salmonella_phage	1.4e-65	91.6
WP_014342080.1\|129446_130454_+	hypothetical protein	J9Q7Z3	Salmonella_phage	1.6e-144	88.3
WP_014342079.1\|130514_131459_+	exonuclease	J9Q7S6	Salmonella_phage	1.1e-171	93.0
WP_019704549.1\|131458_131725_+	hypothetical protein	J9Q7G8	Salmonella_phage	1.7e-34	84.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021958

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021960

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP021961

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP021959

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. NZ_CP021962

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection