CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022046	Staphylococcus sciuri strain FDAARGOS_285 chromosome, complete genome	3 crisprs	cas3,DEDDh,DinG,WYL,csa3	1	0	9	0
NZ_CP022047	Staphylococcus sciuri strain FDAARGOS_285 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022046_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022046_1

164392-164480

Orphan

Consensus_repeat	Method
ATATTAATATGTGTAGGTATTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022046_1

>merge|NZ_CP022046|1|164392-164480|CRISPRCasFinder
ATATTAATATGTGTAGGTATTGCTTTAAGAGCGATTACAGGCGTGTCTTGGTTATATGTCGGTACGATATTAATAGGTGTAGGTATTGC

>NZ_CP022046|1|1|164392-164480|CRISPRCasFinder
ATATTAATATGTGTAGGTATTGC	TTTAAGAGCGATTACAGGCGTGTCTTGGTTATATGTCGGTACG
ATATTAATAGGTGTAGGTATTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022046.2\|WP_088592149.1\|162565_163426_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|225547
NZ_CP022046.2\|WP_058590681.1\|176426_177029_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP022046.2\|WP_167388689.1\|175148_176357_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|143479
NZ_CP022046.2\|WP_058590685.1\|170979_171492_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022046.2\|WP_058590694.1\|161229_162144_+\|LytR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|181811
NZ_CP022046.2\|WP_088592150.1\|163459_164020_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP022046.2\|WP_058590702.1\|157083_157815_+\|epoxyqueuosine-reductase-QueH	unknown	unknown	gnl\|CDD\|224551
NZ_CP022046.2\|WP_058590696.1\|159747_160440_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP022046.2\|WP_167388688.1\|168996_169557_+\|serine-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|226075
NZ_CP022046.2\|WP_088592148.1\|158796_159690_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|226383
NZ_CP022046.2\|WP_058590684.1\|171725_173339_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP022046.2\|WP_078355220.1\|160490_161066_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP022046.2\|WP_088592151.1\|167431_168349_-\|ribonucleoside-hydrolase-RihC	unknown	unknown	gnl\|CDD\|182713
NZ_CP022046.2\|WP_058592196.1\|156462_156987_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240049
NZ_CP022046.2\|WP_088592153.1\|169636_170365_-\|transglycosylase	unknown	unknown	gnl\|CDD\|369056
NZ_CP022046.2\|WP_088592154.1\|173841_175053_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP022046.2\|WP_048540757.1\|168615_168978_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP022046.2\|WP_084755914.1\|162189_162489_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022046.2\|WP_088592147.1\|158071_158749_+\|thiaminase-II	unknown	unknown	gnl\|CDD\|381701
NZ_CP022046.2\|WP_058590689.1\|165540_166923_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|224038

Protein	Function_ID	Function_description	E-value
NZ_CP022046.2\|WP_088592149.1\|162565_163426_+\|phosphotransferase	gnl\|CDD\|225547	COG3001, COG3001, Uncharacterized protein conserved in bacteria [Function unknown].	4.96271e-88
NZ_CP022046.2\|WP_058590681.1\|176426_177029_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.19686e-37
NZ_CP022046.2\|WP_167388689.1\|175148_176357_-\|hypothetical-protein	gnl\|CDD\|143479	cd07563, Peptidase_S41_IRBP, Interphotoreceptor retinoid-binding protein; serine protease family S41. Interphotoreceptor retinoid-binding protein (IRBP) is a homolog of the S41 protease, C-terminal processing peptidase (CTPase) family. It is thought to facilitate the compartmentalization of the visual cycle that requires poorly soluble and potentially toxic retinoids to cross the aqueous subretinal space between the photoreceptors and the retinal pigment epithelium (RPE). IRBP is secreted by photoreceptors into the interphotoreceptor matrix (IPM) where it is rapidly turned over by a combination of RPE and photoreceptor endocytosis. It is the most abundant soluble protein component of the IPM, consisting of homologous modules, each repeat structure arising through the duplication (as in teleost IRBP) or quadruplication (in tetrapods) of an ancient gene, arisen in the early evolution of the vertebrate eye. IRBP has been shown to promote the release of all-trans retinol from photoreceptors and facilitates its delivery to the RPE. Conversely, IRBP can promote the release of 11-cis-retinal from the RPE, prevent its isomerization in the subretinal space, and transfer it to photoreceptors. In vivo evidence implicates IRBP as a retinoid transporter in the visual cycle, suggesting a critical role for IRBP in cone function essential for human vision. IRBP is a dominant autoimmune antigen in the eye; IRBP proteolysis analysis has proven a useful biomarker for autoimmune uveitis (AU) disorders, a major cause of blindness. This family also includes a chlamydia-secreted protein, designated chlamydia protease-like activity factor (CPAF), known to degrade host proteins, enabling Chlamydia to evade host defenses and replicate.	7.92051e-08
NZ_CP022046.2\|WP_088592151.1\|167431_168349_-\|ribonucleoside-hydrolase-RihC	gnl\|CDD\|182713	PRK10768, PRK10768, ribonucleoside hydrolase RihC; Provisional.	9.12966e-125
NZ_CP022046.2\|WP_088592150.1\|163459_164020_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.19396e-17
NZ_CP022046.2\|WP_058590702.1\|157083_157815_+\|epoxyqueuosine-reductase-QueH	gnl\|CDD\|224551	COG1636, COG1636, Uncharacterized protein conserved in bacteria [Function unknown].	1.73625e-88
NZ_CP022046.2\|WP_058590696.1\|159747_160440_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.73231e-28
NZ_CP022046.2\|WP_167388688.1\|168996_169557_+\|serine-hydrolase-family-protein	gnl\|CDD\|226075	COG3545, COG3545, Predicted esterase of the alpha/beta hydrolase fold [General function prediction only].	5.18501e-28
NZ_CP022046.2\|WP_088592148.1\|158796_159690_-\|VOC-family-protein	gnl\|CDD\|226383	COG3865, COG3865, Uncharacterized protein conserved in bacteria [Function unknown].	1.12293e-43
NZ_CP022046.2\|WP_058590684.1\|171725_173339_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP022046.2\|WP_078355220.1\|160490_161066_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	6.54085e-21
NZ_CP022046.2\|WP_058592196.1\|156462_156987_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240049	cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.17617e-45
NZ_CP022046.2\|WP_088592153.1\|169636_170365_-\|transglycosylase	gnl\|CDD\|369056	pfam06737, Transglycosylas, Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.	3.43386e-18
NZ_CP022046.2\|WP_088592154.1\|173841_175053_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.06157e-38
NZ_CP022046.2\|WP_048540757.1\|168615_168978_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.10478e-17
NZ_CP022046.2\|WP_058590694.1\|161229_162144_+\|LytR-family-transcriptional-regulator	gnl\|CDD\|181811	PRK09379, PRK09379, LytR family transcriptional regulator.	1.57817e-67
NZ_CP022046.2\|WP_088592147.1\|158071_158749_+\|thiaminase-II	gnl\|CDD\|381701	cd19366, TenA_C_BhTenA-like, TenA_C proteins similar to Bacillus halodurans TenA. This family of TenA proteins belongs to the TenA_C class as it has a conserved active site Cys residue; the double Glu residues identified in the active site of TenA_E from the archaeon Pyrococcus furiosus is conserved in this family. TenA_C proteins (EC 3.5.99.2) catalyze the hydrolysis of the thiamin breakdown product 4-amino-5-amino-methyl-2-methylpyrimidine (amino-HMP) to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP) in a thiamin salvage pathway. This family includes Bacillus halodurans TenA which participates in a salvage pathway where the thiamine degradation product 2-methyl-4-formylamino-5-aminomethylpyrimidine (formylamino-HMP) is hydrolyzed first to amino-HMP by the YlmB protein, and the amino-HMP is then hydrolyzed by TenA to produce HMP. It has also been suggested that TenA proteins act as transcriptional regulators based on changes in gene-expression patterns when TenA is overexpressed in Bacillus subtilis, however this effect may be indirect.	4.8744e-126
NZ_CP022046.2\|WP_058590689.1\|165540_166923_+\|amino-acid-permease	gnl\|CDD\|224038	COG1113, AnsP, Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism].	0

>NZ_CP022046.2|WP_088592150.1|163459_164020_-|helix-turn-helix-domain-containing-protein
MKDIHTIVAHNLSQYRTSQQLSLSTVSKLTGVSKTMLNQIENGQSNPTITTLWKIANGLHLPISDLISNKEDNINCVSKSDITPIYNDNQSVTIYPYFPFNIDKNFEMFNMILLSGAEMISEGHHNGSEEYIIVHSGILEIDINGVKHTVRQDDAIRFESDVTHTYRNIGKEDVHLTATIQYQQHK
>NZ_CP022046.2|WP_088592149.1|162565_163426_+|phosphotransferase
MNKDWQSQLPIDDIKELIPVSGGDVNEAYRIERQIGTDFLLVQHNRSEGFYAAEIAGLEAFEEAGVTAPVVKGYGQIKGDAYLILSYLEEGRRGSQSELGKLVAKLHSHYQQDDKFGFHLPYHGSDITFENGWKDTWINIFVEQRLDQLRDEIVRRGLWSKDELQQFEQVRTVIIEALTEHKSKPSLLHGDLWAGNFMFLSNGEPALFDPSPLYGDREFDLGATRVFGGFTEAFYKAYDEALPLSKGANERIKFYELYLLMVHLVKFGSMYAGSVQRTMDDILNDK
>NZ_CP022046.2|WP_084755914.1|162189_162489_+|hypothetical-protein
MTSINEVKIEQNINHLIQNYGIQLLNYMSDCERDEKALLSVFDKVDDQIIKASLELLKQNNLINIRTEEIMPPNIYYHLTKDGELILQMIYKFESLNFE
>NZ_CP022046.2|WP_058590694.1|161229_162144_+|LytR-family-transcriptional-regulator
MKLTRKGKVTIIIAALVLITGIFVTVKAININNKVYQPINKQDTKHVKEKIKNNKPISIAIFGVDSNKERESENIGERTDSIMLASINPKTKTTKLVSVPRDMAVNIPGYSSHDKVAHAYAYGGSKTAVQTLKNEFNIPIDGYITVDMDGFKKTIDALDGVNVKSNKSFTFNGTKFKAGEKVKLNGQEALDFVRSRKEAGAGDDEGRQERQRIVIEATSKKLKNNLNVNNFNELMNVAQDNITTSFNLNDTRKLITDYKSATEYFEKLSIDGVNQIESDGIWYFEADKDAKQQIVKTYKNNLKS
>NZ_CP022046.2|WP_078355220.1|160490_161066_-|phosphatase-PAP2-family-protein
MKKDSKLIICYAILLILIVSLIFTNYINPIDQYVYQFIQTETLAFRLHNYLSIISFLFSPLHSGILICILLIGLYFYNRRNLLQYFIFSFSSLFIGTALKYIIQRPRPSDLIDGYSFPSMHTLTLFVAIFLILALYNHVTVKWITAILILSMMCSRIYLSAHFFSDTVASLIIVHLVYLSVTKFMHQSSRL
>NZ_CP022046.2|WP_058590696.1|159747_160440_-|GNAT-family-N-acetyltransferase
MRYNTFNQPIGDEIESFKEPNMPSIDMLEGKYSKLEHLNESHIDQLFPLLCSSENDANWTYLPHEPIHDKASFTQLIEERIISKDPYFFAIVDKETHQALGIMSLLRINPKASTIEVGHIHYSSLLKRTRIATEVQYLLAQYVFETLKYRRYEWKCDSYNAPSKHAAERLGFKYEGTFRQALVYKGRNRDTNWFSIIDKEWPSIKKQYEEWLDESNFNHDGTQINKLSMN
>NZ_CP022046.2|WP_088592148.1|158796_159690_-|VOC-family-protein
MNNQRIVPHLWFDNEAQEAVDYYMQTFPESEIISDVTFTDTPSGDAKQLTFNIFGYKFMAINAGPYFTKNPSISFTVLFNQSEAALLDKVWTALAHNGKIMMELDTYDFSEKYGWLEDQFSVSWQLLITDQPFDDRIRPSFMFINDNVGRAEEAINYYTSVFKNSGDISKFYYPEGMDPDKPDTLAHAEFKLEDQYFVALDSAHKHEFNLNEGISLMLFLEDQQEIDYYWDKLSAVPEAEQCGWVKDQFGVSWQIVPKIMDQMAEEGTPEQISNVTKAFLKMKKFDVETLIKVYEGK
>NZ_CP022046.2|WP_088592147.1|158071_158749_+|thiaminase-II
MKFTDRVFNRIEPIWQSYMEHPFIIGLGDGTLDQDKFKHWLKQDYIYLIEYARLFSIGAAKSTDLKMMATYADLANGTLNTEMSLHRGYAKQFGITEAELEETEPAQTTVGYTSYMLNMAQQGGIENVIAAILTCTWSYNYIGLKLVEIEGASDHLLYGEWINMYASDEFSQYKEDCIQLMDQVAEGKTEAELQRLEDIIVKTSYYEYMFWDMAEHLETWPVLVK
>NZ_CP022046.2|WP_058590702.1|157083_157815_+|epoxyqueuosine-reductase-QueH
MISADGIIAKMKNQKINYDKVMRKMISEWERSETRPSILIHSCCAPCSTYTLELLTQYADVAIYFANPNIHPKSEYERRARVQETFVEQFNERTNSNVKYIEAAYEPHKFMKMVKSKELADENEGGLRCTACFEMRLELVAEAAADLGYDYFASALTLSPKKNAQLINELGMDVQDLYHVYYLPSDFKKNKGYERSIKMCNEYEIFRQCYCGCVFAAMKQGIDFKEVNKQAKAYLESCNKSCM
>NZ_CP022046.2|WP_058592196.1|156462_156987_+|NUDIX-domain-containing-protein
MRMENWDLYDENRQLLNETMTRGNEVPANRYHLVIHVCIINKQGQLLIQKRRDDKQGWPGKWDFSAGGSAVQGDTNRDAAERETYEELGIQLDLTNRRPHFTINFDDGYDDFFIVHQDINIEKLSFPTEEVQEVKWVTKYELLDMIKEGLFIPYRNSLIEFIFEMNIGLGTIRE
>NZ_CP022046.2|WP_058590689.1|165540_166923_+|amino-acid-permease
MEDNHLKRGLSSRQVQMIALGGTIGVGLFMGASSTIKWSGPSAILAYLVAGLFLYLVMRAMGELVYLYPTTGSFANYASDYLHPVAGYVTAWSNIFQWIVVGMSEVIAVGQYMQYWWPDLPTWIPGVIVVVTLAAANLASVKAFGEFEFWFAMIKVVTIILMIIAGFGLIFFGLGNGGNAIGLGNLTEHGGFFPKGIVGFFFALSMVVGSYQGVELIGITAGETKDPQKNIKKAVNGVIWRILIFYIGAIFVIVTVYPWDQLGNVGSPFVATFAKVGITIAAGLINFVVITAAMSGCNSGIFSSSRMVYTLAQKGQMPRIFTKVMKTGVPFFAVLAISIGIFVGVILNIVLPLVIDGSENIFVYVYSASILPGMVPWFMILFSHIQFRRHHSDEIKDHPFKMPFAPYSNYLTLGFFILVLIGMLFNSETRVSVIIGIVFLSVMAIIYFLRGYHKEDKGEY
>NZ_CP022046.2|WP_088592151.1|167431_168349_-|ribonucleoside-hydrolase-RihC
MTIPIIIDTDPGIDDIIAISAALHSKELDVRLITTIGGNVGIKRTTQNALDIVNYFHSNTPVAKGVDKPLINTLETAEHVHGQNGIGNAQIKTTLHNELLEEHAVIAMRDTILNSEEPITLVPIGPLTNIGLLFSLFPETKKNIKRIVLMGGAAVGGNATPVAEFNIFVDPHAAKIVFDQDIPIVMCGLDVTRETMINKDDLNIIQTQGDFGNIIIDMLSSYNDVNAGEKHEHIIHDLCTIFYLLYPEMFTTQRANVSVITEGQAAGCTYTEFSDEGKVEVCMHAQNKQFREKFVDFIKAIHQNQ
>NZ_CP022046.2|WP_048540757.1|168615_168978_+|helix-turn-helix-transcriptional-regulator
MNIGAKIKEEREINGWSQEELANKLHVTRQSVSKWELGKVYPGIDILVQMSDIFDVSLDELIKGDKNLKHTIIETYRNEPNHNQNYYDRPMNGWEFLSRFWWLVFPFGGIIIGIINALVQ
>NZ_CP022046.2|WP_167388688.1|168996_169557_+|serine-hydrolase-family-protein
MDKQLYIAHGYTADSKKHWFKWLTEQFEDIDSKILDFPNSSNPVLEDWNKTLLDEVDISSGNNVIVAHSLGVVTVLDYLSRYEGEWNVKGLVLVAGFYEKIPNLNKIDAYMDQTQVDFEKIIKQVPNSVSVIASHDRLVPRHLSERLAERLQSEEVIIQHVGHFCDSDGYTEFPEVAEIVNDMFNK
>NZ_CP022046.2|WP_088592153.1|169636_170365_-|transglycosylase
MKKAFLTSSLAVAIGATGVASTQVADAAEQDVNKEQLAQLAQSNAPELNEHAIQEGAYNINFTLEGYEYNFQSDGQNFTWEYHATNAADSESTQAPVAEQQQPVAEENVAEQTPAPAANNTANEQATQEAPQQVEAPKQETQETTTQTTQTSTTSSSASEGSSVNVNDHLKLIAQRESGGDLKAVNPSSGAAGKYQFLQSTWDSVAPAEYKGVSPTEAPESVQDAAAVKLYNTAGASQWVTA
>NZ_CP022046.2|WP_058590685.1|170979_171492_+|hypothetical-protein
MNKLTKLTIATGISFGTIFGIVDFPGQDSHEVEAATTPYYTYKGYTGHDGSFILDSAFINALMYKNVTMNNYRIVQPQSYEGNIYTHRTSYDQTFYFGGKYEEEYAASAKFPVKKHHISKAQILKAYGNDYTIEETRNGEEYRFLVGGNLIIFTIDNNYVTTVNIGENLK
>NZ_CP022046.2|WP_058590684.1|171725_173339_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MNIINMSKLSKSYTGDLIFEDIKYDLNEGDCVGLVGRNGEGKSTLLKLMAGVEVPTEGQISWQKNISIGYLNQLPQYEEDKEIYECLSEVFKEINHISQKMKFLEDEMANNTNDLERLLKQYGALQETFEEIGGYERDALIRRVSHGLKINHLLNQTWGKLSGGERTKVGLAQILLQQPKLLLLDEPTNHLDISSVDWLADFIKQYNGAVMIVSHDRYFLDETVNQILEIDQGHLHIYHGNYSYFVKEKEARIIREFEAYQTQQKKIKKMEDSIKQLRLWASQAKPPNAAMYKRAKSMEKALNRIKRLDKPVLENKKMNVNLTEGQRVSNDVIEFKKVSKMYEDILFEDIDLLIRRKEHVSIIGNNGTGKSTLLKMMMQQIEPDDGEVHCASNLRIGYLSQHTFENIENQTVIEIFRDVVNVTEGQARHILAQFMFYGEDVFNTVESLSGGEKMRLRWAQIVNQDFNVLILDEPTNHLDIDSKETIEEALLEYEGTIIAVSHDRYFLNKLFDITYLLQDKQLTKYEGNYDYVKEKLS
>NZ_CP022046.2|WP_088592154.1|173841_175053_+|MFS-transporter
MKKFLKINDFYLILSSLALTRISESLLGIAVLWSLYVYTDSVYLVGLLTLFQVLPIIIFSFYSGALADSYNNKSILIITNLSRFILLMLSGLIFYIIQSDLLNIILLYILVFILAILTSFYLPSFQATIKKTISNQKLINANSSAEFIKHICNIFGLLLGGLLVDSLGLINTLFLGGLLFLGGAILMKIAYIPIFSQQIIDKKIKGSISESFSYLRRSSNLLQQSIYYLIIINISVAPISLIFVLMSDQLKLGSIGLSVLMISFSIGSIIGTICASYILKIVEESKINYLLIVMYSVLVILTVLISNTILVVLLIFLTGITSSLSVIFINTFIQRETSNEFIGRVSSFRSLALRIPPPIIVMIFSYLVDILNIAYAAIIINSITIILATFVFIKRQKKMVGNE
>NZ_CP022046.2|WP_167388689.1|175148_176357_-|hypothetical-protein
MTLKEFNIIENQLINEYAGYFDKKELITQFPSKLSNINEEEFYFYMTKYLNKFHDPHLKLVDFNGLYPNIRVQLYNDQLYVIDSRNPQIPTGTVIYNLGSYSINYILENDHDLLKSSNPERMEWSDVLKKYKYIVSDSKEISILQKDKPDFFEQSYIIENKSTYIYIKFTDFIDHLKISNLIDKHKNLLLNAKQIIIDVRGNRGGSDLAYLKLLPYLTTESITITDDTPYYHRFTKSYCDERIHTISELIKQMPDSDDLDEYKSILNLYKDNYDKGFVNINNNPESDTIKGIQEKCPDVKVLADFECGSSGDNFVKFAHEFKNIEIIGRPTKGMNDYSNIMFIDINGKYKLSVPHSKDGNVDLGKSMGKTGIPVDHYISWTPEELEKDIILEIAINRFTSLT
>NZ_CP022046.2|WP_058590681.1|176426_177029_-|GntR-family-transcriptional-regulator
MANKELSIYQKIRNDIINGDLTQNEKITESKLAQRYHVSRTPIREAIKQLELEYFIRDGYIYVPTVEEYRNIFEMRILIETHAIKKASIVFTQGDIEELKSYASIGDDKTEEEIIQINDQFHQKIMSATKNSFIIDTYSKLKSYIYLFSKTVINKKRPGLIEEHQKIAEMLEKRQTEAAIELMKEHLLNDLEFSLYYLKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022046_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022046_2

757639-757797

Orphan

Consensus_repeat	Method
TGCGGGAGTATTTCAACTTTTAGAATACATTCCTTCCCGGAATGAGATATAGGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022046_2

>merge|NZ_CP022046|2|757639-757797|CRISPRCasFinder
TGCGGGAGTATTTCAACTTTTAGAATACATTCCTTCCCGGAATGAGATATAGGTGCAAGTCCTATCTTCCGCTCCATTATTATTAATACTGCTATTTATTAAAATGCGGGAGTATTTCAACTCTTAGAATACATTCCTTCCCGGAATGAGATATAGGTG

>NZ_CP022046|2|2|757639-757797|CRISPRCasFinder
TGCGGGAGTATTTCAACTTTTAGAATACATTCCTTCCCGGAATGAGATATAGGTG	CAAGTCCTATCTTCCGCTCCATTATTATTAATACTGCTATTTATTAAAA
TGCGGGAGTATTTCAACTCTTAGAATACATTCCTTCCCGGAATGAGATATAGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022046.2\|WP_048540696.1\|748136_749090_+\|2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240632
NZ_CP022046.2\|WP_058591075.1\|767541_768594_+\|PTS-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|226167
NZ_CP022046.2\|WP_167388697.1\|759622_759925_+\|DUF4440-domain-containing-protein	unknown	unknown	gnl\|CDD\|227327
NZ_CP022046.2\|WP_058591892.1\|743488_745075_+\|FMN-binding-glutamate-synthase-family-protein	unknown	unknown	gnl\|CDD\|223147
NZ_CP022046.2\|WP_088592265.1\|765307_767407_-\|alpha-glucosidase	unknown	unknown	gnl\|CDD\|269885
NZ_CP022046.2\|WP_048539828.1\|762546_763842_+\|TRAP-transporter-large-permease	unknown	unknown	gnl\|CDD\|224509
NZ_CP022046.2\|WP_025907200.1\|749168_749621_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP022046.2\|WP_058591894.1\|746301_747588_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP022046.2\|WP_048540697.1\|749646_750087_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP022046.2\|WP_048539826.1\|761064_762066_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270389
NZ_CP022046.2\|WP_078354783.1\|741682_743422_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP022046.2\|WP_048539822.1\|758253_758469_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237343
NZ_CP022046.2\|WP_048539827.1\|762058_762547_+\|TRAP-transporter-small-permease	unknown	unknown	gnl\|CDD\|225632
NZ_CP022046.2\|WP_058591893.1\|745111_746206_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP022046.2\|WP_058591081.1\|758530_759496_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380509
NZ_CP022046.2\|WP_058591891.1\|739954_740986_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NZ_CP022046.2\|WP_058591079.1\|759953_760904_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380496
NZ_CP022046.2\|WP_025907189.1\|741066_741615_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP022046.2\|WP_049320370.1\|747672_748131_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP022046.2\|WP_088592264.1\|763857_765264_+\|glucuronate-isomerase	unknown	unknown	gnl\|CDD\|376859

Protein	Function_ID	Function_description	E-value
NZ_CP022046.2\|WP_048540696.1\|748136_749090_+\|2-hydroxyacid-dehydrogenase	gnl\|CDD\|240632	cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family. Phosphoglycerate Dehydrogenase (PGDH) catalyzes the NAD-dependent conversion of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first step in serine biosynthesis. Over-expression of PGDH has been implicated as supporting proliferation of certain breast cancers, while PGDH deficiency is linked to defects in mammalian central nervous system development. PGDH is a member of the 2-hydroxyacid dehydrogenase family, enzymes that catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-Adenosylhomocysteine Hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	2.45821e-140
NZ_CP022046.2\|WP_058591075.1\|767541_768594_+\|PTS-transporter-subunit-IIC	gnl\|CDD\|226167	COG3641, PfoR, Predicted membrane protein, putative toxin regulator [General function prediction only].	5.0972e-84
NZ_CP022046.2\|WP_167388697.1\|759622_759925_+\|DUF4440-domain-containing-protein	gnl\|CDD\|227327	COG4994, COG4994, Uncharacterized protein conserved in bacteria [Function unknown].	2.83679e-13
NZ_CP022046.2\|WP_058591892.1\|743488_745075_+\|FMN-binding-glutamate-synthase-family-protein	gnl\|CDD\|223147	COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism].	1.5757e-137
NZ_CP022046.2\|WP_088592265.1\|765307_767407_-\|alpha-glucosidase	gnl\|CDD\|269885	cd06599, GH31_glycosidase_Aec37, E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.	0
NZ_CP022046.2\|WP_048539828.1\|762546_763842_+\|TRAP-transporter-large-permease	gnl\|CDD\|224509	COG1593, DctQ, TRAP-type C4-dicarboxylate transport system, large permease component [Carbohydrate transport and metabolism].	6.17603e-125
NZ_CP022046.2\|WP_025907200.1\|749168_749621_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	4.24397e-53
NZ_CP022046.2\|WP_058591894.1\|746301_747588_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP022046.2\|WP_048540697.1\|749646_750087_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	4.6157e-63
NZ_CP022046.2\|WP_048539826.1\|761064_762066_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270389	cd13671, PBP2_TRAP_SBP_like_3, Uncharacterized substrate-binding protein of the Tripartite ATP-independent Periplasmic transporter family; the type 2 periplasmic-binding protein fold. This subfamily includes uncharacterized periplasmic substrate-binding proteins similar to TRAP transport systems such as SiaP (a sialic acid binding virulence factor) and TeaA (an ectoine binding protein). TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process and a smaller membrane of unknown function. The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.4742e-129
NZ_CP022046.2\|WP_078354783.1\|741682_743422_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP022046.2\|WP_048539822.1\|758253_758469_-\|hypothetical-protein	gnl\|CDD\|237343	PRK13304, PRK13304, aspartate dehydrogenase.	0.000288458
NZ_CP022046.2\|WP_048539827.1\|762058_762547_+\|TRAP-transporter-small-permease	gnl\|CDD\|225632	COG3090, DctM, TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism].	3.61635e-32
NZ_CP022046.2\|WP_058591893.1\|745111_746206_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.10565e-62
NZ_CP022046.2\|WP_058591081.1\|758530_759496_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380509	cd06286, PBP1_CcpB-like, ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species. This group includes the ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species. Catabolite control protein B (CcpB) is 30% identical in sequence to CcpA which functions as the major transcriptional regulator of carbon catabolite repression/regulation (CCR), a process in which enzymes necessary for the metabolism of alternative sugars are inhibited in the presence of glucose. Like CcpA, the DNA-binding protein CcpB exerts its catabolite-repressing effect by a mechanism dependent on the presence of HPr(Ser-P), the small phosphocarrier proteins of the phosphoenolpyruvate-sugar phosphotransferase system, but with a less significant degree.	5.37073e-90
NZ_CP022046.2\|WP_058591891.1\|739954_740986_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	8.5158e-134
NZ_CP022046.2\|WP_058591079.1\|759953_760904_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380496	cd06272, PBP1_hexuronate_repressor-like, ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and close homologs, all members of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are members of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	2.31756e-65
NZ_CP022046.2\|WP_025907189.1\|741066_741615_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	9.11255e-124
NZ_CP022046.2\|WP_049320370.1\|747672_748131_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	2.70363e-69
NZ_CP022046.2\|WP_088592264.1\|763857_765264_+\|glucuronate-isomerase	gnl\|CDD\|376859	pfam02614, UxaC, Glucuronate isomerase. This is a family of Glucuronate isomerases also known as D-glucuronate isomerase, uronic isomerase, uronate isomerase, or uronic acid isomerase, EC:5.3.1.12. This enzyme catalyzes the reactions: D-glucuronate <=> D-fructuronate and D-galacturonate <=> D-tagaturonate. It is not however clear where the experimental evidence for this functional assignment came from and thus this family has no literature reference.	0

>NZ_CP022046.2|WP_048540697.1|749646_750087_-|YgzB-family-protein
MEGIDLKLFRKKPTSKINRIRSFALGLIFLGMIVMYIGVFFFYYFKSQIVFSIFLVLGMLALGLSFIVYFWIGMLSSRTIQVQCPNCDHYTKMLGRADICANCNQPLTLDKNLEGKAFNQDYNNKRKSKKLEEQQTEEHAEEKKKS
>NZ_CP022046.2|WP_025907200.1|749168_749621_+|peroxide-responsive-transcriptional-repressor-PerR
MQQNIENVEHMLDDAIGTLRSTGVRITPQRQSILQYLIETDSHPTADEIYQSLSPQFPNMSVATVYNNLKVFKETGLVKELTYGDASSRFDFETHNHYHIICDQCGKISDFHYPRLDEVEQLAQHVTSFSVTHHRMEIYGVCPECQNKNK
>NZ_CP022046.2|WP_048540696.1|748136_749090_+|2-hydroxyacid-dehydrogenase
MKVVTLMRLKEQEERLKETFPNVDFIFYKHPNEARDEDLEDVDILVSYHGEVNPSFLDKCKNIKLIAWFATGVNQLPLDYIQDRGIKLTNARGVHAIQIAEFIFAYILNDIKLFRTSYESQKKREFNHKLKPDSINEKTILFLGTGKIPQRTAEVAKAFNMKVIGINTTGHVVPGFDEVYSIEERRHVYHKADFIVNVLPETEETIHLLQKEDFKQMNEDTHFINVGRGTVVSESVLYEALSSKDIRYASIDVFEEEPLPENSLLYDLDNVFITAHITGNDLNNLKRSTDILIENLKHIKNDASDKLINIVNAEAGY
>NZ_CP022046.2|WP_049320370.1|747672_748131_+|thioredoxin-dependent-thiol-peroxidase
MIQIGEKFPDFNLKNQNGELISNEDLKGSKVVVYFYPRDNTPTCTTEACDFRDNLEDFNELNTKVYGISGDSEKKHANFSNKHNLNFDLLVDEDYKLSEEVGVYQLKKSFGKESMGIVRTTFVLDEEGTVIHKIDKVKVKTQIEDLKNFIKE
>NZ_CP022046.2|WP_058591894.1|746301_747588_-|glutamate-1-semialdehyde-2,1-aminomutase
MDFTKSEYLQTLSNEYILGGVNSPSRSYKAVGGGAPVVMQKGKGAYFYDVDGNKYIDYLQAYGPIIAGHAHPHITEAIKAAAEDGVLFGTPTEYEITFAKKLRNAIPSLEKIRFVNSGTEAVMTTIRVARAYTKRDKIIKFAGCYHGHSDLVLVAAGSGPSQLGTPDSAGVPKSVAQEVITVPFNDIDSFKEAMEHWGDQVAGVLVEPIVGNFGMVEPKEGFLEAVNEVTHQYGGLVIYDEVITAFRFHYGAAQDLLGVYPDLTAFGKVIGGGLPIGAYGGRQEIMEHVAPLGPAYQAGTMAGNPLSMRAGIALLEILEQPGVYDKLDQLGQQLEEGLLELIKKHNVKATVNRIKGALTLYFTDEKVENYVQAENTDGEQFAKFFKLMLNQGINLAPSKYEAWFLTTEHTEEDINQTLNAVDYAFSQL
>NZ_CP022046.2|WP_058591893.1|745111_746206_-|aromatic-acid-exporter-family-protein
MKFGARIFKTGIAIVLAIFIANLLPGPAMITSIAGVAAMVAMQPSVYRSFKTIVEQFQGNVIGAITAVAIFSIFGNNVVFIGLTAIIIISILYKFNLQHVSNLAVVTALIILGHHEGDFYISAFYRFVLVMIGVLSAFLVNFTFLPPKFETKMYYNSLNISTDIFKWFRLVLNGTTEFHYVKQDLETIRTRIVKLEQFYLYYKEERAYTKKQAFSQMRKKILFKEIIASTRRAYEVLRKMNRYENDIHNLNDNLKVQMKFELDELMAQHEQILVRISQKAKHEIDQVPDYLVEPYKEDLMEIFIKDIMDNPDQEDYYIENVMQVISAMLDYKATILHLDKLSSSYFKFHPEDSDIQIEDEDFDL
>NZ_CP022046.2|WP_058591892.1|743488_745075_+|FMN-binding-glutamate-synthase-family-protein
MTFLSILQLIVNILFFVIIIGGIIACISLYVIDKRQKHHSVLRNYPVLGRVRYFLESIGPELRQYLILNDNAGKPFSRKQYLNIVMPGKYKNRIESFGSLRKFEEPGFYLQNTMFPVDHDELEINQDEQMSTFIYEISNEGLFDRKEKQKQKDVDPYKLTSDNQIIIGDDLKHPFIINRLIGQSGMSYGALGKNAITALSKGLGRSGSWMNTGEGGLSDHHLSGGCDIIFQIGPGLFGVRDKEGNFDETEFIEKANMNQVKAFELKLAQGAKTRGGHIEGAKVTEEIAEIRNVTPFETVNSPNRFEFLHNNKELLQFVQRLRELSDKPVGIKLVVGNINDLKKLIHEMVSSNIIPDFITVDGGEGGTGATYQELVDTVGLPLFSALPILDVELKKFKIRDKVKVFASGKLITPDQIAIALALGADLVNVARSLMINVGCIMAQQCHTNNCPVGVATTDPKKESALVVSEKEYRVSNYIVSLHEGLFNLAAAVGVKSPNQINENHLLYRSANGNVMNVKQYKKSIYKEQ
>NZ_CP022046.2|WP_078354783.1|741682_743422_+|ABC-transporter-ATP-binding-protein
MIKRYLQFVKPYKWHIVGTIIIGILKFGIPLLLPLLIKYVIDDVINNGALSIGQKTEKLTYAMLIMGFIFVVLRPPIEYFRQYLAQWTSNKILYDIRKKLYTHLQALSSRFYANNKAGEVISRVINDVEQTKDFILTGLMNVWLDLVTIVIALSIMFVLDIKLTFTAIAIFPVFIFSIYYFFGKLRSLTRRRSQSLAELQGFLHERVSGMSVIKSFAIEKNEEKRFDKRNQNFLTKATDHTKWNAKSFAVINTVTDIGPLLVVGIGGFLVIQGNLTVGTLAAFVAYLEQLYGPLRRLVSSSTTLTQSIASMDRVFHLFDEKYDVKNEDDAQDIVIKEGHITFDDVSFKYNNYEDEVLKHINLDINKGETVAFVGMSGGGKSTLISLLPRFYDVTKGSISIDNHNVKDFTTESLRNQVGMVEQDNILFSDSIKENILLGKPDASDEEVIEASKKANAHDFIMSLPNGYDTEVGERGVKLSGGQKQRVSIARIFLNNPPVLVLDEATSALDLESEKIIQDALEILSTERTTLIVAHRLSTITHADKIVVIQNGQIEEVGSHKELMAAQGSYYNLYNIQSFG
>NZ_CP022046.2|WP_025907189.1|741066_741615_+|DUF402-domain-containing-protein
MVKESIPKEGQVIKIQSYKHDGNIHRVWSETTILKGTSHVIIGGNNRTLVTESDGRTWVTREPAIVYFHSEYWFNVICMFREDGVYYYCNLSSPFVCDEEAIKYIDYDLDIKVYPSGKYHLLDEDEYKQHMKQMNYPKDIDVILRRNVDILQQWIERKKGPFAPDFIKVWQERFHSIDRRNS
>NZ_CP022046.2|WP_058591891.1|739954_740986_+|A/G-specific-adenine-glycosylase
MIETKQFKDDLLNWFHKNKRQMPWRETSNPYYIWLSEVMLQQTQVNTVRPYYKAFIERFPTIESLSEANEEDVLKYWEGLGYYSRVRNFQEAVKEVHHSYHGVVPDNPDDFKKLKGVGPYTNAAVMSIVHNHPIPAVDGNVLRVWSRLTGNDSDIAAPKTKKLYEDELQPFVEEHSGDFNQAMMELGATICTPKKTLCIMCPVQKHCYAFANGIVEELPVKKKKIKKKTIDFNVLYITNRSGEILVRQRDTKLLNGMWEFPMFEADESIHSIEETLDAVIDIDQTPEFTTKHVFTHMTWNMNVYRAHTQKSEFDYPYKWIKKEEKDQLSFSTSMSKIFNQLNG
>NZ_CP022046.2|WP_048539822.1|758253_758469_-|hypothetical-protein
MNKQKVGIDGCNITSEIYVEILQHTSNIDIVACTDESLSKAISMKNKYDIPQVMTRSKMYKDKKIDYIIKL
>NZ_CP022046.2|WP_058591081.1|758530_759496_-|LacI-family-DNA-binding-transcriptional-regulator
MTNLKKVAKRAGVSPSTVSRVINNHPYVNEEKRQKVLDTIEELNYIPNINAIHLKKGKTNLIGVVLPFSNHPYFSQLIQGISEEAIKSNKKIVLFQTAYDTDQEIDALEMLKLKQIDALIICSRNISLNIVEQYIEYGPISIFENISNSKFRTTYIDHYNAFKQALNHLYNNGHRHIACAINRRNSTSSILRIQAYKDFCSENSITYNDQDIYENFVLLEDGQRLAQEIENKENPTTAIVVSGDNTAAGLFISLDEEKKKNISIIGFENHKISKLLNLTTIEIPLFQIGKSLFNQLYEDKLNNYLFETKLIKRNSVFKLNH
>NZ_CP022046.2|WP_167388697.1|759622_759925_+|DUF4440-domain-containing-protein
MDASNRNDKSFIINLLDDEFKEIGKSGRMIYKRDIEESTLHTFDYEISDFIVEKIQKGIVLTTYELINKTDHITTKRSTLWIRKQSEWKMRFHQGTIVKK
>NZ_CP022046.2|WP_058591079.1|759953_760904_-|LacI-family-DNA-binding-transcriptional-regulator
MAVTLKDIANACGVSYSTVSKALKNSPLVTAETTERIQQKAKEMNYIPNNSARSLVSNKSQTIGLIWPSVDRVAVSTLVSEINNFLKNTGYFMSVSIDDVETAAHKFLELRFDGIIVFDEGEASTLPSIISSNIPVVAYGTDRKLEYPIVNVNHKHAMILSLDDLMQNNITNICYIGDLNTDDIRQIIKKETFEHYCKEHHLNYNMIDSKGLSAEDTFFALKSYLTNHTLPEGIICGSYDITLGLIHTLKDSLDQHIVYSYDNVPQFDHMDTVIHSVGVPTKKIAETLVNILINAIEYKENQPNVYHLEPELVKRK
>NZ_CP022046.2|WP_048539826.1|761064_762066_+|TRAP-transporter-substrate-binding-protein
MKKILLLIVSVFIVLYGCQQSDAQDKDVKTLTLAHNQSTTHPVHKSLEEFKKEVERKSHGKLKIKIYANGQLGSEREAIEMTQTNAIQFTKVSASALESFSESYSLFSMPYLFKSQDSFRSIMKKPEVQNSFFNTTKDNGFVGITYYDAGLRNIYTKDREIKTNKDLHGLKTRVQPSKTSVELIKSLGGTPTPMAFGEVYTALQSGVIDAAENNETALTDNKHGEVAKNYYNTEHAIVPDILIMNKDAYNDLSKEEKGWIKSAARSSTEKHEVIWDKAIKEGIKTAKEDMNVKFHDVDKSSFKKAVKPLQEEFKNNKGTEKQYKLIKEAEQNE
>NZ_CP022046.2|WP_048539827.1|762058_762547_+|TRAP-transporter-small-permease
MNKLTHYIDRTLLSVSGVLVTVMVILSVWQVITRYILNTPSTTSEEIIRFLLIWFALLSAAYVFGKKKHIAILFIREKFPVKAQLFIERLTNIIILLVALILMIYGGIKIVALTWTQIAPSTGVSMALMYGALPISGLFIAFYSIRGIITNELPENDEGGEV
>NZ_CP022046.2|WP_048539828.1|762546_763842_+|TRAP-transporter-large-permease
MTTIAGIVLFVSLAVFLAFGIPIAISIILSSLLTLILIFPFDVTILTAAQRMITGIDNFTMLAIPLFVLAGILMNNGGIAFRLINFAKVLVGRLPGSLAHTNIVGNMLFGSISGSSVAAAAAMGRIMTPMETTQGYKKSYSAAANIASAPSGLLIPPSSLLIVYSLVSGGTSIAALFIAGYIPGILWGLGCMVVAYFLAKKHGYPVSEKVSWKDKLFLTLDAIPSLLLIIIVIGGIVAGIFTATEGAAVAVLYAFILSLIYRNLKIKDIPAIIIETVEITGMILFLITASALFSLVMSFTGLPEAISGGILSLTENPILLLLLMNLILLIVGTFMDITPAVLIFTPIFLPIADSIGLDPIHFGIVIAFNLCIGNITPPVGSALFVGSSVANVRIESVIKTLIPYFIILIILLLLITFVPQLSLFLPKLLGL
>NZ_CP022046.2|WP_088592264.1|763857_765264_+|glucuronate-isomerase
MSMIQENFIVQSKKGQALYKVAKDIPIFDFHCHLDPKEIYENKPFTTITEVWLKHDHYKWRLMRAYGIDESYITGDKSDKEKFDAFISLLPKSIMNPMYHWCHLELARYFNINENLNKIEKDQLYNQLNESLQQPEFLPRKLIERSNVQIICTTDDPCDDLKYHQLLREDKSFDVKVLPTFRPDRYIALTKDNVEASINQLENATGTRINHLEEYINALNERIEYFHQNGARSSDQSFAKVLKVDVTKEQADQYFEQIKQGEELDEEDLSRLSGYILTEVSKTYKKYNWVVQFHLGPVRNNNTLLFEEVGPDAGFDSVGDMLSSSDLNRFLDHLNQNDALSDTIIYPNNANDHLMVQATAGNFTSDKVKVQLGAAWWFNDTKEGMEQHLVEYANVGLLSTFVGMLTDSRSLLSYTRHEYFRRILCEMIGKRVERGEIIDDDEIFSEIIKDICFNNAVTLYNIEGVDAI
>NZ_CP022046.2|WP_088592265.1|765307_767407_-|alpha-glucosidase
MYMFNMISQDKNTIVISDKQNEHFFTIRILEDYLINIKSSTQKDISLPTWTITPGDTDLPFEGLSRYDQSNFSCPQYEISEEQHNIIIETKLLKLIIDKEDFYCSWYDLSSSDKEIKIMQDRQTGSYHHQISKNHPTCHYLNRDKNEMYFGLGEKSGKVNKHGRRFRMKNIDAMGYNAETTDPLYKHIPYYLTYNTDENIAFGIFYDDYQDSIVDLGQELDNYHGHYRYYETKSDFLDYYVIAGPSIQQVTTRFSHLTGRPTLMPEWSLSYSGSTMQYTDLPNSDERLLSFLDQCNTHNITIRSFHLSSGYTSIHDKRYVFNWNYDKFKDPKSFGKSYTDQNVELVANIKPILLTDHPLLDEVLAIDGFIKDVNGKPLLVQFWDEKGYYLDFTNKDTIKWWQSKIEQQLLSNHVNCTWNDNNEFEIWDDKAIVNGFGNEANFQDYKAIMPILMMKASREIQQQYHKEQYPYIISRSGAAGMSKYVQTWTGDNYTSWHTLKYNNAMAIGLSLSGVYNFGHDIGGFSGDKPEAELFLRWVQCGAYYPRFSIHSWNDDGTVNEPWMHQKVLSEVKQAMHFHEKLKPYLQSLVIQAHESYEPIIRPTFYQYENDITTFVENDEFMLGEHMLIAPIVEKSQKERTIYLPNNNKGWIDFHSGKQFEDGQTITVKTTLQHIPTFVVKGAEIPVYKDDLKTIENLKF
>NZ_CP022046.2|WP_058591075.1|767541_768594_+|PTS-transporter-subunit-IIC
MDKHFTVKEFFFNILNGIGVGIVIALIPNAILGVLFSYLSQFHPLLEMFNQALLLMQFAMSFIIGIVVAHQFKFQATDAVMIGAAGLIGSGAVKIQNGQFIFVSIGDVVNLIVVLIISCYLMIKLKGKFGSLDMLIMPIIISVVSGFIGMLTLPYVSNVTKGIGKLIEQFSTLNPLMMCILIAITYALLMVTPISVVAIATAVGLNGLSSGAGNMGIVAACVTFLMGSWKVNEKGINIVLIIGAAKMMIPVYFKNPIIAVPLIINGLMSGLLTYFIGIKGTPMSTGFGYTGFVGPANALKFMEGSVFLNILILGVAYFVIPFVFAYIVHKVCLKILPKYNQEMFLFKENN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022046_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022046_3

1203465-1203535

Orphan

Consensus_repeat	Method
AACTCAGACAACAGTTCTGATAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022046_3

>merge|NZ_CP022046|3|1203465-1203535|CRISPRCasFinder
AACTCAGACAACAGTTCTGATAGTCAATCTGATAGTGGTTCCGATTCGAACTCAGACAACAGCTCTGATAG

>NZ_CP022046|3|3|1203465-1203535|CRISPRCasFinder
AACTCAGACAACAGTTCTGATAG	TCAATCTGATAGTGGTTCCGATTCG
AACTCAGACAACAGCTCTGATAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022046.2\|WP_049318859.1\|1213664_1213859_+\|zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378493
NZ_CP022046.2\|WP_025905495.1\|1186536_1186851_+\|cell-division-regulator-GpsB	unknown	unknown	gnl\|CDD\|237616
NZ_CP022046.2\|WP_078355798.1\|1195213_1196098_+\|5'-3'-exonuclease	unknown	unknown	gnl\|CDD\|214682
NZ_CP022046.2\|WP_088592349.1\|1187352_1188477_+\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223194
NZ_CP022046.2\|WP_048539800.1\|1191008_1191488_-\|cytochrome-b5	unknown	unknown	gnl\|CDD\|259980
NZ_CP022046.2\|WP_078355800.1\|1189359_1191012_-\|b(o/a)3-type-cytochrome-c-oxidase-subunit-1	unknown	unknown	gnl\|CDD\|238830
NZ_CP022046.2\|WP_088592348.1\|1185959_1186523_+\|DUF1273-domain-containing-protein	unknown	unknown	gnl\|CDD\|237461
NZ_CP022046.2\|WP_088592350.1\|1191773_1195202_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|206739
NZ_CP022046.2\|WP_088592353.1\|1211163_1212762_+\|poly(glycerol-phosphate)-alpha-glucosyltransferase	unknown	unknown	unknown
NZ_CP022046.2\|WP_084754604.1\|1213869_1214994_+\|virulence-factor	unknown	unknown	gnl\|CDD\|379361
NZ_CP022046.2\|WP_058591262.1\|1214997_1215435_+\|BrxA/BrxB-family-bacilliredoxin	unknown	unknown	gnl\|CDD\|275043
NZ_CP022046.2\|WP_048542963.1\|1218809_1219652_+\|DegV-family-protein	unknown	unknown	gnl\|CDD\|273257
NZ_CP022046.2\|WP_088592354.1\|1218073_1218823_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP022046.2\|WP_058592357.1\|1184841_1185468_-\|Holliday-junction-resolvase-RecU	unknown	unknown	gnl\|CDD\|235015
NZ_CP022046.2\|WP_088592347.1\|1185636_1185966_+\|DUF1798-family-protein	unknown	unknown	gnl\|CDD\|378052
NZ_CP022046.2\|WP_058591263.1\|1215418_1216219_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377360
NZ_CP022046.2\|WP_088592351.1\|1196140_1196539_-\|ribonuclease-HI-family-protein	unknown	unknown	gnl\|CDD\|260011
NZ_CP022046.2\|WP_048542960.1\|1217595_1218072_+\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|365932
NZ_CP022046.2\|WP_048542958.1\|1216626_1217580_+\|thymidylate-synthase	unknown	unknown	gnl\|CDD\|213790
NZ_CP022046.2\|WP_048542951.1\|1212823_1213513_-\|queuosine-precursor-transporter	unknown	unknown	gnl\|CDD\|224652

Protein	Function_ID	Function_description	E-value
NZ_CP022046.2\|WP_049318859.1\|1213664_1213859_+\|zinc-finger-domain-containing-protein	gnl\|CDD\|378493	pfam10782, zf-C2HCIx2C, Zinc-finger. This bacterial family of proteins is a zinc-finger domain of the C2HC type with an additional cysteine.	2.93352e-20
NZ_CP022046.2\|WP_025905495.1\|1186536_1186851_+\|cell-division-regulator-GpsB	gnl\|CDD\|237616	PRK14127, PRK14127, cell division regulator GpsB.	1.8986e-26
NZ_CP022046.2\|WP_078355798.1\|1195213_1196098_+\|5'-3'-exonuclease	gnl\|CDD\|214682	smart00475, 53EXOc, 5'-3' exonuclease.	5.15756e-107
NZ_CP022046.2\|WP_088592349.1\|1187352_1188477_+\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|223194	COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].	1.41032e-175
NZ_CP022046.2\|WP_048539800.1\|1191008_1191488_-\|cytochrome-b5	gnl\|CDD\|259980	cd13913, ba3_CcO_II_C, C-terminal cupredoxin domain of Ba3-like heme-copper oxidase subunit II. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea, which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that archaea acquired heme-copper oxidases through gene transfer from gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead, they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively.	1.59438e-45
NZ_CP022046.2\|WP_078355800.1\|1189359_1191012_-\|b(o/a)3-type-cytochrome-c-oxidase-subunit-1	gnl\|CDD\|238830	cd01660, ba3-like_Oxidase_I, ba3-like heme-copper oxidase subunit I. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively. For general information on the heme-copper oxidase superfamily, please see cd00919.	0
NZ_CP022046.2\|WP_088592348.1\|1185959_1186523_+\|DUF1273-domain-containing-protein	gnl\|CDD\|237461	PRK13660, PRK13660, hypothetical protein; Provisional.	7.18356e-81
NZ_CP022046.2\|WP_088592350.1\|1191773_1195202_+\|hypothetical-protein	gnl\|CDD\|206739	cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. This family also includes bacterial DLPs. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes mitofusins (MFN1 and MFN2 in mammals) that are involved in mitochondrial fusion. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.	4.14505e-32
NZ_CP022046.2\|WP_084754604.1\|1213869_1214994_+\|virulence-factor	gnl\|CDD\|379361	pfam13769, Virulence_fact, Virulence factor. This domain is found in conserved virulence factors. It is often found in association with pfam02985 and pfam08712.	4.09329e-28
NZ_CP022046.2\|WP_058591262.1\|1214997_1215435_+\|BrxA/BrxB-family-bacilliredoxin	gnl\|CDD\|275043	TIGR04191, hypothetical_protein, putative bacilliredoxin, YphP/YqiW family. This protein family is one of several observed in species that express bacillithiol, an analog of glutathione and mycothiol. Rather than being involved in bacillithiol biosynthesis, members are likely to act in bacillithiol-dependent processes. A suggested term is bacilliredoxin (a glutaredoxin-like thiol-dependent oxidoreductase), and a suggested role of YphP is de-bacillithiolation - removing bacillithiol that became linked to protein thiols under oxidative stress. An older description of YphP as a disulphide isomerase therefore may be wrong.	1.15786e-72
NZ_CP022046.2\|WP_048542963.1\|1218809_1219652_+\|DegV-family-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	8.8232e-110
NZ_CP022046.2\|WP_088592354.1\|1218073_1218823_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	7.33403e-54
NZ_CP022046.2\|WP_058592357.1\|1184841_1185468_-\|Holliday-junction-resolvase-RecU	gnl\|CDD\|235015	PRK02234, recU, Holliday junction-specific endonuclease; Reviewed.	2.33979e-101
NZ_CP022046.2\|WP_088592347.1\|1185636_1185966_+\|DUF1798-family-protein	gnl\|CDD\|378052	pfam08807, DUF1798, Bacterial domain of unknown function (DUF1798). This domain is found in many hypothetical proteins. The structure of one of the proteins in this family has been solved and it adopts an all alpha helical fold.	6.55508e-21
NZ_CP022046.2\|WP_058591263.1\|1215418_1216219_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|377360	pfam04445, SAM_MT, Putative SAM-dependent methyltransferase. This is a family of putative SAM-dependent methyltransferases.	5.61769e-05
NZ_CP022046.2\|WP_088592351.1\|1196140_1196539_-\|ribonuclease-HI-family-protein	gnl\|CDD\|260011	cd09279, RNase_HI_like, RNAse HI family that includes archaeal, some bacterial as well as plant RNase HI. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Most archaeal genomes contain only type 2 RNase H (RNase HII); however, a few contain RNase HI as well. Although archaeal RNase HI sequences conserve the DEDD active-site motif, they lack other common features important for catalytic function, such as the basic protrusion region. Archaeal RNase HI homologs are more closely related to retroviral RNase HI than bacterial and eukaryotic type I RNase H in enzymatic properties.	4.28341e-46
NZ_CP022046.2\|WP_048542960.1\|1217595_1218072_+\|dihydrofolate-reductase	gnl\|CDD\|365932	pfam00186, DHFR_1, Dihydrofolate reductase.	1.91358e-79
NZ_CP022046.2\|WP_048542958.1\|1216626_1217580_+\|thymidylate-synthase	gnl\|CDD\|213790	TIGR03284, thym_sym, thymidylate synthase. Members of this protein family are thymidylate synthase, an enzyme that produces dTMP from dUMP. In prokaryotes, its gene usually is found close to that for dihydrofolate reductase, and in some systems the two enzymes are found as a fusion protein. This model excludes a set of related proteins (TIGR03283) that appears to replace this family in archaeal methanogens, where tetrahydrofolate is replaced by tetrahydromethanopterin. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP022046.2\|WP_048542951.1\|1212823_1213513_-\|queuosine-precursor-transporter	gnl\|CDD\|224652	COG1738, yhhQ, Uncharacterized member of the PurR regulon [General function prediction only].	8.92133e-57

>NZ_CP022046.2|WP_088592351.1|1196140_1196539_-|ribonuclease-HI-family-protein
MPQIYFDAASKGNPGESCCACVIIKDDARHHFTSYLGELDNHRAEWEALIFSIQHAIELEVGNALIYTDSKLIADSIDKDYVKNATFKPYFELFKELERQFDLIFVKWIPRSQNKEANQLAQTALRKQLKHK
>NZ_CP022046.2|WP_078355798.1|1195213_1196098_+|5'-3'-exonuclease
MSNKILLIDGMALLFRHFYATSIHKQFMRDSKGIPTNAVQGFIRHSYTVIHDIKPTHVAVCWDMGSKTFRNDMFEAYKSNRVAPPEEMIPQFDRAKEIAEKLGMLNLGITNYEADDVIGTISKRAQEKGHETYVVSGDRDLLQCINTDVDIWLTKKGFNIYNKYDIHKFREEYGLEPHQLVDVKAFMGDTADGYPGVKGIGEKTAIKLIQQYQSVENVLENINELTAGQQKKIITYRDDLAMSKQLAQIHTDVPLETEDLLNQMTYHHEIEQSIEICNEHELFVSSKYLTTNFL
>NZ_CP022046.2|WP_088592350.1|1191773_1195202_+|hypothetical-protein
MDRYQASLDLLYKLKKEIEKSSNQQLIKQINEMIKKIYNEQYTVSFVGHFSAGKSTLINNVIGQNILPSSPVPTTSNTAQLISSDKNSISVNLNNNQYTVVDNQEDVKRLNTEDREVESIEIEFTSDKFNKGFTFQDTPGVDSMSDNHRESAFQYLLTSNYVFYTVDYNHVQSDMNFNFIKSLNKLDIPVILVVNQVDKHDEDEISFDTYKNRVNKAVTDWKLNLEKIFYVSKYDTPNNEKQLFNQYIHQLDQQRTEHQVFIDRVTNYIKQEQLKYINQHMETILSDIDSTEDTFDDDYQAYKEKFNVQSEQSLIQDKDQFTSNLKEKRKEILDNAYLMPYEMRETIRHYLETTAKDYKVKGLFNKDKKKAMIQEETLEQVKEALDIKIHDEITKVWIRSIENLNKYIQDADLFEKIINQQYTISKEELSGHVQEQTSITNDYVLIYSKGITEMINRKIRNETNQLIEEIVNASEVHNESNEETNQLNEYETYVEFKNLKTSLITNNYQHYYIHLDESIDKLIDRHFIHINDLNLEDKKETKQQYKEVQMEQQDNNIHQLKDQINHLKKLPLFEGEVHNIESQVERIEHNITKIAVFGTFSAGKSSLINAILQKPVLLSSPNPTTASITEISYGTEQEVSFKTYEQLLEEINHITEFANKQYSTIESFIEDKEIKQHPSLSSNHLAFFEAIETNFNHYKDVLKEGKSVTFDIEELEKLTADDTHAAFVHKINLRLEEAWLKDKIIIDSPGLNSNNQRHTRETEQIIASSDLIIYVSYYNHAFTDKDGEFLTYMRDMNNLQQSQGLKFVINAIDLAESEQDKQAVISYVESSLDALNIKPECYPVSSKQALKSHDDQFKRLMEALDHFVKVESKQVLKSQVESRIKQLTNELEQMVHTYRQDKAQLEKRKSTLLSYKDKQNFTNQIVIKSHHQLEKEIHDQLYYLKDRLNIQLNDIVKKHFNTSTVTDQFKQSLQMSTKYYVDDLNQKLSLESSLIVERLKNFYARTFDDLLTPTIVELNDASILISKFKHDFKNEINPEPISIQVQDIAKQTINSVSKKDLIKTSKVKETQNEILNDTMKLIDHPIMTFNEALTKNLEHYDTIGESYIEQYNQETIHLIEDYLSVNIDNDVIEKIENVLKEI
>NZ_CP022046.2|WP_048539800.1|1191008_1191488_-|cytochrome-b5
MHKYEKLWLKVGISSLVIFLTILMITGLHNGHTPAASGRDYVNPDKVDQIEPFNKPGLHKVSGKDYDYELVILASAFNYQPGKVEIPKGSKVKIIATSKDTLHGFSLPGTNVNMMLEPGHISEYYKTFNEKREYLVICNEYCGIGHADMKSMIKVVDKK
>NZ_CP022046.2|WP_078355800.1|1189359_1191012_-|b(o/a)3-type-cytochrome-c-oxidase-subunit-1
MITRLNKNDSRLVMAHMYVAIGCLILGGLAGLLQTFVRSGLLQLPKQISYYQILTVHGIVLALVLTTFFILGFQFSAVAKTSGHLTSVQRKFGWVGFWVMILGTLMAATMVLLNKATVLYTFYAPLKAHAIFYIGMALVVVGSWISTVGQILKYVEFKKKNPGKKSPLLSYMVAINGVMWIVCSLGVAATVLLQLIPWSLGLVERVDVTLSRTLFWYFGHALVYFWLLPAYMCWYAIVPKIIGAKAFSDNLARMSFMLFLFFSIPVGIHHQLVEPGIDDTWKYLQVVLTFMVVIPSMMTAFSLFATFENYGRSNGYKGLFTWFKSLPWNDARFVLPFLGMLAFIPGGAGGLVNASAQMNGLIHNTIWVTGHFHLTIASAVIMTFFGIMYWLIPHCTGRKLTKFTNKLALMQGYTWAIGMTIMSGAMHYVGLVKGAPRRSTYSEYGGAKQAAEWIPYQVLQAVGGTILFISIILVVMVFIHLTFLSPKGEEEYPVSEALDEQQPVIRFVENWRFLIIVTVLLILIAYTVPIGQMFTDPAPGAKGLGEGKLW
>NZ_CP022046.2|WP_088592349.1|1187352_1188477_+|class-I-SAM-dependent-RNA-methyltransferase
MYQLLATSPMGLESIVAREVQELGYETKVENGRVLFEGDETAIVKSNLWLRTADRVKIVVGRFHATTFDELFEKTKSLPWEDVIGAQGMFPVQGKSVKSKLFSVSDCQAIVKKAIVERLKHAYQIKGWIDETGSKYQVEVSLLKDEALLTIDTSGSGLHKRGYRLAQGDAPMKETLAAALVRLTNWSGETPFIDPFCGSGTLAIEAALIAQNIAPGFNREFASEDWDIIPEGLYDQLRQEADDAALYDKEINIIASDIDPKMVEIAKDNATEVGLGDIIQFKVQDVHNLEVPEGPVSIIGNPPYGERIGERSEVEAMYKHLGEIMKQNEQASLYMLTSYKEFEPLVGKKATKRRKLFNGYIECTYYQYWGKRNK
>NZ_CP022046.2|WP_025905495.1|1186536_1186851_+|cell-division-regulator-GpsB
MADVTLKLSAKDIYEKEFERGLRGFKTEEVDAFLDDIISDYQKMAELNNEVIKLTEENSKLKKEIEQLRIRVASGRPQGSQQYNSNNVDILKRISNLEKAVFGE
>NZ_CP022046.2|WP_088592348.1|1185959_1186523_+|DUF1273-domain-containing-protein
MMTSVYFTGYKPFELNIFKNEQPEVKVIKAYLKEIIEQEIEEGMEWVIISGQLGFELWAAEVTIEMKNKYPQLKLAILTPFLNHYNKWNETNQQAYHNIVAQADYVNAIHQSDYQGGFQFQQANEFILDNTDKTILFYDDEQEASPKYFKSKLVDFAEKTNYTYSVITFMDLQDFMEFNYNNDNESY
>NZ_CP022046.2|WP_088592347.1|1185636_1185966_+|DUF1798-family-protein
MIQDLLNKLNDMLDIFQHAKDDYEYNFYKDVVPFVEQVDVLLDKLAVHQDTILKLQYMNEQKFQLLISNYKELSVECHYKRTSKKLFFEKHKAVQHDLNYIYTHIGDLS
>NZ_CP022046.2|WP_058592357.1|1184841_1185468_-|Holliday-junction-resolvase-RecU
MNYPNGKKVTKNTSKVSIQNDPKYSRIQYGKRGMRLEEEIDKSNEYFRLENIAVIHKKPTPIQIVDVDYPKRQKAVIKEAYFRKPSTTDYNGVYNGYYIDFEAKETKNKTSFPLNNIHDHQVSHMEQVLNQKGICFLLIKFSYHDSVFLLPFRKFMVYWDRYKSGGKKSITLKEIENDGYLIPIQFKPRINYITIVDQLIKTESEALK
>NZ_CP022046.2|WP_088592353.1|1211163_1212762_+|poly(glycerol-phosphate)-alpha-glucosyltransferase
MNIKEQIKRIINDHSDYERLFISIGYPKVKAVVKSFKLSNKNQMIKFIETYRKKSGKAAKWIKIDIVTSVEDIPFDELKEDLIHTTRNHVEYGFTLDYNWNLAFLPEEINSNAFVRPTNEKGIFILSEKNINHYLRKYKKNYNLYLHKDYAGKVVQKFYTKSFYIEDEQVINLQQEGYKKGLRPVDNLPVEIDRMIQTNTDYLMNLIQDNGKYHYGYFPHFDININAYNNLCHSSTTYAFIKSLSYLKKNVSIAKKPIDYIIKHYLYKHEGATYVFDDTNYINEIKLGQNAAFILAVCGYIQYGRSNKKYLKAAQNVAKGLVNMIDENGETTHVLNYPDLTVKDSFRVIYYEGQAALALLKLYQLDQKEEWLNVAKLLYEKFIRKSYWKHHDYWLSYSTEVLIQLEPEEKYYQFAFQNLGEHLNNLQQRQSTDPLLLGMLMATYNIVESAKQRDKTDLVEQFIDVDLLIDTIHRRADYMRTGYFYPEVAMYFQNPERILEAFYIKYESYRVEIDDIEHYLTSYVEYLKVFNQ
>NZ_CP022046.2|WP_048542951.1|1212823_1213513_-|queuosine-precursor-transporter
MYNELIGIGTFFVTFILMLVLYRIFGKTGLFVWVAIGTIIANIQVIKTVELFSVSATLGNVMFASIYLATDILNDIYGRKQARKAVWLGFSSVIVMVILLQCSLAFIPAQEDISQEALETIFNIVPRIALGSIIAYIIGQHLDVLLFTLIKKKFSSDRTFYIRAYGSTVVSSIVDTAIFVLIAFYGNLPNNVVFEIFFTTYFLKLLTTLSNVPFGYIAKSMYRNGKISE
>NZ_CP022046.2|WP_049318859.1|1213664_1213859_+|zinc-finger-domain-containing-protein
MTLILAQEEKQAIKQIDQLMETYCKGCLLKTHYRETKGKHQAHQYCISECSIGIRIKQLGNKLQ
>NZ_CP022046.2|WP_084754604.1|1213869_1214994_+|virulence-factor
MEIVRVEPTPSPNTMKIVLSFKKEDRSSNTYTEVNDHNPEFINRILQLDGIKSVFHVMDFIAVDKRPKENWDTLLKDVTLAISGSDQEGDFAENQVNEHFGEVKAEVLKFKGIPYQIKLTTQEEEKRKQLPEIYIDSMLKATKDSDNVVFLRKWEDLGVRYGEVEEVLATVQEEILALYPKEKLEALVEEALTSDITIPEKQFVHVDKETFEQEEDWKVKLRMLNDFPTPTEDDYPLLDVALNDEKPQVRRMAIVLLGMIESKETLPYLYKGMKDKVVSVRRTAGDCLSDLGFKEALPVMIEALEDPQKIVRWRAAMFIFDEGDETALEALKKRQDDPAFDVKLQVQMAIERIENGEAALGSVWKQMANRKKEG
>NZ_CP022046.2|WP_058591262.1|1214997_1215435_+|BrxA/BrxB-family-bacilliredoxin
MNAYEQYMKELAQPMRSELTGQGFESLESAGSVKEYMENAQPNETTFIVVNSVCGCAAGLARPAAVTVSQQNDKKPSRIATVFAGQDKEATETMREYIAQVPSSPSMALFKGNELKYFMPREHIEGRDIQEICLDIKDAFDEYCD
>NZ_CP022046.2|WP_058591263.1|1215418_1216219_+|class-I-SAM-dependent-methyltransferase
MNTVTNIRITTAVRTNASLYKQVEDAFSVLSQLESIQNVQIIKRRKLTINQLFQRDTTPLIVFESSGPKLYFTPDTPIYFHLDTVKVKLHMMKQHKMPVLIEMLDEITTDFKTFNFIDGTMGFGRDTYLILKHYQQANVYAIEQNPLIHYVISEGMKHYLTKDELRRIHYINDDYHNWIKQHPELVDILYLDHMFEQTLDENDRMGELSRNIEIPSEIKSVSHFKYLIVKAHYKSEIFKQFNTIQCIRKSTKTHYGLKINQDYKYE
>NZ_CP022046.2|WP_048542958.1|1216626_1217580_+|thymidylate-synthase
MNNFDKAYHDLCKRVLEEGENKDDRTGTGTISIFGHQMRFDLSEGFPLLTTKKVSFKLIATELLWFIKGDTNIRYLLQYKNNIWNEWAFKKWIESNDYDGPDMTDFGRRSLVDDEFNEQYKAQLAIFKDKILNDDDFMIKYGDLGNVYGKQWRDWKDQDGKRFDQLKTLIENIKQNPNSRRHIISAWNPTEIDTMALPPCHTLFQFYVKDGKLSCQLYQRSADIFLGVPFNIASYSLLTHLIAKECGLEVGEFVHTFGDAHIYKNHIDAINEQLSRDSYDAPKLKINTDKSLFDIEYEDLEIDGYESHPSIKAPIAV
>NZ_CP022046.2|WP_048542960.1|1217595_1218072_+|dihydrofolate-reductase
MKSIIVCHDQNRVIGLDNKMPWHLPNDLKRVKALTTGNTIVMGRKTFDSLGKPLPNRRNVVLTTNPSFEHVDVDVIHSLDEIDQLEGHIFIFGGQGLYEQMMDRVDDMYVTVIEDKFQGDAFFPPYDFKDWTVLSSESGELDEKNTLPHTYMHLERKK
>NZ_CP022046.2|WP_088592354.1|1218073_1218823_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MLRTTKTLGYIVGYAALVSSQLNKVKHKKTLINDIRKQDEMIFLYAKRWASRILDSAGVTTHLSGNIEPFDEPVLYISNHEGNFDIPVLINHLPQPFGFISKTEVQKIPFLNPWMEEMNCIYLDRSNRRASLQMIKDGINKLKEQHSLLIFPEGSRSKGGEMQEFKAGSFKLAKSAKVKIVPIAIYGTSNIMEAQDSKKMVPGDVYVHILDPIEPSIFEDKTMQEVSQFVQGKISNTVQSLKENHYVKN
>NZ_CP022046.2|WP_048542963.1|1218809_1219652_+|DegV-family-protein
MSKIKIVVDSTTDLSADFLEENNITVVPLNILIDGVTYVDQEDISSTEFLEKMKDAKELPKTSQPPIGKIVETYDALGTDGSEIISIHMTSELSGTFSAAQQAAQMTESKVTVVDSKFISLAYGFQIEEVVKMINAGKTVEEIVEEIEVIKNNLRLFVVIGNIDNLIKGGRIGKAKGLLGSLMNIKPIGELINGKIEMMHNARTQNAIVKYLMKELDVFLEKKELIKIGIADANAEQLMTKLMNTIKEKKNFHLFDTAVTTPVVSTHTGEGAIGVFFYGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP022046_3	3.1\|1203488\|25\|NZ_CP022046\|CRISPRCasFinder	1203488-1203512	25	NZ_CP022046.2	1206014-1206038	2	0.92
NZ_CP022046_3	3.1\|1203488\|25\|NZ_CP022046\|CRISPRCasFinder	1203488-1203512	25	NZ_CP022046.2	1206950-1206974	2	0.92

1. spacer 3.1|1203488|25|NZ_CP022046|CRISPRCasFinder matches to position: 1206014-1206038, mismatch: 2, identity: 0.92

tcaatctgatagtggttccgattcg	CRISPR spacer
tcaatctgatagtagttctgattcg	Protospacer
*************.****.******

2. spacer 3.1|1203488|25|NZ_CP022046|CRISPRCasFinder matches to position: 1206950-1206974, mismatch: 2, identity: 0.92

tcaatctgatagtggttccgattcg	CRISPR spacer
tcaatctgatagtagttctgattcg	Protospacer
*************.****.******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

816459 : 828130

Staphylococcus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088592271.1\|816459_817869_+	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.5e-132	51.9
WP_088592272.1\|817855_818854_+	o-succinylbenzoate synthase	A0A2H4PQM0	Staphylococcus_phage	3.0e-63	38.2
WP_025905546.1\|818900_819125_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	1.8e-24	67.1
WP_058591984.1\|819135_819921_-	hypothetical protein	NA	NA	NA	NA
WP_048539511.1\|819987_820452_+	nucleoside triphosphatase YtkD	A0A2H4PQM4	Staphylococcus_phage	8.2e-40	54.5
WP_088592733.1\|820459_821212_+	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	3.6e-77	57.1
WP_048539512.1\|821233_822835_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	1.8e-219	68.8
WP_048539513.1\|823232_824426_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.0e-182	79.6
WP_048539514.1\|824906_825818_+	hypothetical protein	A0A2H4PQQ8	Staphylococcus_phage	3.9e-70	55.0
WP_088592273.1\|825876_827259_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_088592274.1\|827287_828130_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	7.0e-106	64.3

DBSCAN-SWA_2

843719 : 851563

Staphylococcus_phage(85.71%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048539534.1\|843719_844874_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.6e-18	49.5
WP_088592277.1\|845126_846641_+	pyridine nucleotide-disulfide oxidoreductase	A0A2H4PQX2	Staphylococcus_phage	9.3e-08	42.9
WP_088592278.1\|847159_848206_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.2e-91	48.0
WP_058592004.1\|848210_848843_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.0e-53	51.0
WP_058592005.1\|848854_850027_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.0e-139	62.1
WP_058592006.1\|850047_850518_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.2e-56	81.0
WP_088592279.1\|850558_851563_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.9e-105	57.5

DBSCAN-SWA_3

855336 : 862566

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088592280.1\|855336_855894_-	methyltransferase domain-containing protein	A0A2H4PQV0	Staphylococcus_phage	3.5e-53	56.8
WP_048539546.1\|855890_856850_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	3.8e-63	80.0
WP_078355921.1\|856969_858145_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	9.5e-125	57.1
WP_088592281.1\|858436_860821_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	79.0
WP_048539549.1\|860842_861154_+	rhodanese-like domain-containing protein	A0A2H4PQR9	Staphylococcus_phage	2.3e-30	62.1
WP_058592011.1\|861306_862566_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	1.1e-30	61.9

DBSCAN-SWA_4

991172 : 1002483

uncultured_Mediterranean_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058592081.1\|991172_992168_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	2.6e-06	29.9
WP_088592312.1\|992184_993210_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_048539646.1\|993225_994365_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	5.4e-85	44.1
WP_025904259.1\|994377_994641_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	9.8e-06	40.9
WP_058592082.1\|994810_997102_+	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.5e-30	33.6
WP_088592313.1\|997361_999656_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	4.9e-69	30.5
WP_025904256.1\|999655_1000174_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	3.3e-29	47.9
WP_025904255.1\|1000293_1002483_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.3e-10	37.7

DBSCAN-SWA_5

1631418 : 1639889

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048542190.1\|1631418_1631985_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.0e-28	39.6
WP_088592425.1\|1631981_1633016_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	7.2e-68	44.0
WP_058591010.1\|1632999_1634496_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.0e-43	31.5
WP_088592426.1\|1634474_1636664_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.6e-141	40.0
WP_048542181.1\|1636656_1637328_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_048542179.1\|1637327_1637588_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_058591012.1\|1637589_1638291_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	1.7e-41	38.6
WP_088592427.1\|1638292_1639420_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_025905207.1\|1639406_1639889_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	8.9e-21	42.0

DBSCAN-SWA_6

1831778 : 1839112

Staphylococcus_phage(50.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088592467.1\|1831778_1832411_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.1e-22	37.3
WP_058591498.1\|1832407_1832770_-	YxeA family protein	NA	NA	NA	NA
WP_088592468.1\|1832769_1834773_-	hypothetical protein	NA	NA	NA	NA
WP_058591500.1\|1834798_1835092_-\|bacteriocin	lactococcin 972 family bacteriocin	NA	NA	NA	NA
WP_058591501.1\|1835346_1836600_-	peptidoglycan DD-metalloendopeptidase family protein	A0A1X9I9G7	Staphylococcus_phage	9.6e-75	74.1
WP_078355576.1\|1836620_1836941_-	PTS mannose transporter subunit IID	Q4ZD59	Staphylococcus_phage	5.5e-27	66.2
WP_025904388.1\|1837083_1837413_+	helix-turn-helix transcriptional regulator	H9A0K4	Staphylococcus_phage	4.1e-09	38.6
WP_025904387.1\|1837444_1837909_+	hypothetical protein	A1BTY5	Staphylococcus_virus	9.1e-39	51.6
WP_058591502.1\|1837963_1839112_-	galactonate dehydratase	Q6A202	Oenococcus_phage	4.5e-63	36.5

DBSCAN-SWA_7

1898659 : 1905824

Staphylococcus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075577747.1\|1898659_1898812_-	hypothetical protein	A0A1Q1PVW7	Staphylococcus_phage	1.1e-12	78.0
WP_058591599.1\|1899651_1899966_+	hypothetical protein	A0A1Q1PW34	Staphylococcus_phage	2.3e-30	80.2
WP_153653758.1\|1900328_1900505_-	hypothetical protein	A0A1Q1PW37	Staphylococcus_phage	6.5e-22	89.7
WP_058591600.1\|1900637_1900862_-	hypothetical protein	NA	NA	NA	NA
WP_088592741.1\|1901179_1901986_-	CHAP domain-containing protein	A0A1W6JQB6	Staphylococcus_phage	2.4e-63	33.2
WP_037560253.1\|1902997_1903465_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	3.3e-57	77.2
WP_058591601.1\|1903475_1905824_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.0e-90	38.1

DBSCAN-SWA_8

1955612 : 1968155

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162841905.1\|1955612_1956569_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.0e-113	67.6
WP_048539936.1\|1956709_1957126_-	FixH family protein	NA	NA	NA	NA
WP_048539937.1\|1957275_1958247_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A2H4J4P3	uncultured_Caudovirales_phage	2.6e-160	85.4
WP_048539938.1\|1958275_1960381_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A2H4J2N6	uncultured_Caudovirales_phage	0.0e+00	84.0
WP_025905413.1\|1960343_1960742_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A2H4J545	uncultured_Caudovirales_phage	3.0e-38	58.3
WP_048539939.1\|1961117_1962002_+	DMT family transporter	NA	NA	NA	NA
WP_048539940.1\|1962001_1962502_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.0e-48	67.9
WP_048539941.1\|1962796_1964311_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.2e-66	34.9
WP_078355508.1\|1964899_1966402_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	4.8e-65	35.8
WP_058591624.1\|1966441_1967023_-	5'(3')-deoxyribonucleotidase	NA	NA	NA	NA
WP_058591625.1\|1967087_1968155_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	8.0e-14	22.8

DBSCAN-SWA_9

2465752 : 2476605

Staphylococcus_phage(45.45%)

integrase

attL 2470472:2470487|attR 2478691:2478706

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088592605.1\|2465752_2466097_-	hypothetical protein	A0A1W6JQM3	Staphylococcus_phage	1.8e-07	29.7
WP_088592606.1\|2467446_2467869_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	1.3e-07	31.8
WP_088592607.1\|2468066_2468273_-	hypothetical protein	A0A2H4JAQ2	uncultured_Caudovirales_phage	9.0e-07	42.9
WP_088592608.1\|2468477_2469353_-	ATP-binding protein	A0A2I6PDV5	Staphylococcus_phage	8.8e-43	38.9
WP_088592609.1\|2469367_2470252_-	DnaD domain protein	A0A2H4J8S8	uncultured_Caudovirales_phage	1.1e-43	48.2
WP_088592610.1\|2470311_2470686_-	hypothetical protein	NA	NA	NA	NA
2470472:2470487	attL	NA	NA	NA	NA
WP_088592611.1\|2470686_2471070_-	pathogenicity island protein	A0A2H4JBF1	uncultured_Caudovirales_phage	3.6e-17	43.5
WP_088592612.1\|2471143_2471326_-	hypothetical protein	NA	NA	NA	NA
WP_088592613.1\|2471342_2471609_-	pathogenicity island protein	Q4ZE77	Staphylococcus_phage	2.3e-18	51.2
WP_088592614.1\|2471612_2472395_-	transcriptional regulator	A1BTY9	Staphylococcus_virus	6.5e-106	72.7
WP_088592615.1\|2472411_2472624_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088592616.1\|2472814_2473735_+	helix-turn-helix transcriptional regulator	Q9AZH9	Lactococcus_phage	1.8e-09	33.0
WP_088592617.1\|2473767_2474991_+\|integrase	site-specific integrase	Q4ZE80	Staphylococcus_phage	2.7e-154	69.7
WP_088592618.1\|2474987_2475674_+	hypothetical protein	NA	NA	NA	NA
WP_025906198.1\|2475775_2476018_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_025906200.1\|2476077_2476605_-	single-stranded DNA-binding protein	A0A1W6JPL9	Staphylococcus_phage	1.5e-50	61.7
2478691:2478706	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022046

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection