CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP021981	Vibrio anguillarum strain 87-9-116 chromosome 2, complete sequence	0 crisprs	RT,DEDDh,csa3,WYL	0	0	4	0
NZ_CP021980	Vibrio anguillarum strain 87-9-116 chromosome 1, complete sequence	2 crisprs	cas3,DEDDh,csa3,DinG,RT,csx1	0	1	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

71989 : 141882

Vibrio_phage(18.18%)

transposase,plate

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011154643.1\|71989_72910_-\|transposase	IS5-like element ISVa2 family transposase	A0A1V0E8E1	Vibrio_phage	1.7e-177	100.0
WP_040122735.1\|73003_73477_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_013868294.1\|73523_75002_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_013868295.1\|75004_75442_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_013868296.1\|75448_77218_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_026028436.1\|77181_78204_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_013868297.1\|78208_79681_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_013868298.1\|79683_80163_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_017044997.1\|80167_81502_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_026028435.1\|81504_82278_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_029189701.1\|82301_84920_+	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	4.9e-89	29.9
WP_013868302.1\|84916_86485_+	AAA domain-containing protein	NA	NA	NA	NA
WP_013868303.1\|86481_87141_+	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_013868304.1\|87150_88548_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_013868305.1\|88565_92111_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_013868306.1\|92168_93464_+	type VI secretion protein	NA	NA	NA	NA
WP_040122736.1\|93631_95680_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	6.0e-34	26.5
WP_029190016.1\|95679_96477_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_013868309.1\|96473_98615_+	hypothetical protein	NA	NA	NA	NA
WP_019281429.1\|98616_99351_+	DUF2931 family protein	NA	NA	NA	NA
WP_013868310.1\|99373_100117_+	DUF2931 family protein	NA	NA	NA	NA
WP_013868311.1\|100193_100589_+	membrane protein	NA	NA	NA	NA
WP_013868312.1\|100598_101222_-	START domain-containing protein	NA	NA	NA	NA
WP_019281428.1\|101394_102144_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_013868314.1\|102201_103158_-	AEC family transporter	NA	NA	NA	NA
WP_013868315.1\|103284_103893_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013868316.1\|104040_104898_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_017043564.1\|105092_106478_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_013868318.1\|106542_107232_-	DUF2057 domain-containing protein	NA	NA	NA	NA
WP_088718030.1\|107640_110190_+	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	3.6e-145	47.4
WP_013868320.1\|110288_110756_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_013868321.1\|110752_111616_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.9e-11	28.5
WP_013868322.1\|111615_112473_+	hypothetical protein	NA	NA	NA	NA
WP_013868323.1\|112798_114685_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-16	58.7
WP_010316838.1\|114846_115581_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_013868324.1\|115587_116424_+	arginase	NA	NA	NA	NA
WP_020477131.1\|116541_118005_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-14	30.2
WP_013868326.1\|118133_118694_-	hypothetical protein	NA	NA	NA	NA
WP_013868327.1\|119136_121014_+	PhoX family phosphatase	NA	NA	NA	NA
WP_013868328.1\|121326_122082_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_013868329.1\|122171_122876_-	hypothetical protein	NA	NA	NA	NA
WP_013868330.1\|122973_124818_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-32	25.2
WP_013868332.1\|125329_126301_+	amidinotransferase	NA	NA	NA	NA
WP_026028427.1\|126290_127247_-	diguanylate cyclase	G3MA91	Bacillus_virus	5.0e-15	34.9
WP_013868336.1\|127366_127789_-	hypothetical protein	NA	NA	NA	NA
WP_029189691.1\|127977_128859_-	L-ribulose-5-phosphate 3-epimerase	NA	NA	NA	NA
WP_010316854.1\|128867_129515_-	3-keto-L-gulonate-6-phosphate decarboxylase UlaD	NA	NA	NA	NA
WP_013868338.1\|129520_130342_-	pyridoxal phosphatase	NA	NA	NA	NA
WP_013868339.1\|130347_131040_-	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
WP_013868340.1\|131047_131530_-	PTS transporter subunit EIIA	NA	NA	NA	NA
WP_026028425.1\|131604_133365_-	PTS ascorbate-specific subunit IIBC	NA	NA	NA	NA
WP_026027147.1\|133755_134511_+	HTH-type transcriptional regulator UlaR	A0A077SK06	Escherichia_phage	1.5e-14	25.5
WP_013868344.1\|134634_135702_+	L-ascorbate 6-phosphate lactonase	NA	NA	NA	NA
WP_013868345.1\|135803_137801_-	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_013868346.1\|138182_139514_+	hypothetical protein	NA	NA	NA	NA
WP_013868347.1\|139579_140425_+	maltose operon protein	NA	NA	NA	NA
WP_011154643.1\|140961_141882_-\|transposase	IS5-like element ISVa2 family transposase	A0A1V0E8E1	Vibrio_phage	1.7e-177	100.0

DBSCAN-SWA_2

379653 : 470881

102

Leptospira_phage(19.23%)

transposase,integrase,tRNA

attL 380753:380812|attR 417693:420074

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000993000.1\|379653_380394_+\|transposase	transposase	K4HZD4	Acidithiobacillus_phage	5.9e-48	43.2
380753:380812	attL	NA	NA	NA	NA
WP_011154648.1\|380833_381151_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011154649.1\|381147_381501_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154650.1\|381560_383102_+\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
WP_040122746.1\|383679_384780_-	reverse transcriptase	NA	NA	NA	NA
WP_040122893.1\|384955_387073_-	ATP-binding protein	NA	NA	NA	NA
WP_040122747.1\|387220_388021_-	TIGR02391 family protein	A0A1S5SBU1	Streptococcus_phage	5.1e-29	34.6
WP_040122748.1\|388207_388540_-	YnfA family protein	A0A218MNG8	uncultured_virus	2.0e-27	57.8
WP_040122749.1\|388939_389320_+	transcriptional regulator	NA	NA	NA	NA
WP_040122751.1\|390099_390885_-	DUF4225 domain-containing protein	NA	NA	NA	NA
WP_040122752.1\|390881_391355_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_040122753.1\|391632_391869_+	hypothetical protein	NA	NA	NA	NA
WP_040122754.1\|392167_392695_-	hypothetical protein	NA	NA	NA	NA
WP_040122755.1\|392764_393763_-	hypothetical protein	NA	NA	NA	NA
WP_040122756.1\|393837_395355_-	hypothetical protein	NA	NA	NA	NA
WP_040122757.1\|395452_396553_-\|integrase	site-specific integrase	A0A2H4JGM5	uncultured_Caudovirales_phage	1.0e-40	34.5
WP_040122758.1\|396861_397101_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157727319.1\|397730_397874_+	hypothetical protein	NA	NA	NA	NA
WP_040122760.1\|398328_399987_-	DNA (cytosine-5-)-methyltransferase	E5E3X6	Burkholderia_phage	2.2e-82	40.2
WP_040122761.1\|400061_401510_-	hypothetical protein	NA	NA	NA	NA
WP_040122762.1\|401783_402188_-	S-adenosylhomocysteine hydrolase	NA	NA	NA	NA
WP_040122763.1\|402448_402637_-	hypothetical protein	NA	NA	NA	NA
WP_040122764.1\|402646_403030_-	hypothetical protein	NA	NA	NA	NA
WP_088718034.1\|403017_404391_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_088718035.1\|404875_405553_+	MaoC family dehydratase	NA	NA	NA	NA
WP_013868539.1\|405606_406503_-	phosphate ABC transporter substrate-binding protein	H6WG65	Cyanophage	8.0e-07	28.0
WP_013868540.1\|406494_406953_+	DUF3024 domain-containing protein	NA	NA	NA	NA
WP_029189829.1\|407014_409024_-	exoribonuclease II	Q0GXV6	Lactococcus_phage	5.4e-27	23.6
WP_013868542.1\|409386_411405_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.1e-51	34.5
WP_010319593.1\|411618_413547_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.8e-123	36.6
WP_080569453.1\|413550_414102_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.2e-13	39.0
WP_010319591.1\|414205_414400_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_010319590.1\|414441_414795_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_011154650.1\|415402_416944_-\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
WP_011154649.1\|417003_417357_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154648.1\|417353_417671_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_019281443.1\|417976_418255_+	hypothetical protein	NA	NA	NA	NA
WP_011154648.1\|418438_418756_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011154649.1\|418752_419106_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154650.1\|419165_420707_+\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
417693:420074	attR	NA	NA	NA	NA
WP_011154649.1\|420954_421308_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154650.1\|421367_422909_+\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
WP_013868609.1\|422977_423457_-	hypothetical protein	NA	NA	NA	NA
WP_013868610.1\|423654_423747_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_019281478.1\|425279_425723_+	hypothetical protein	NA	NA	NA	NA
WP_013868614.1\|425915_426602_+	hypothetical protein	NA	NA	NA	NA
WP_076611895.1\|428091_429060_-\|transposase	IS30-like element ISVa6 family transposase	W5R8L2	Staphylococcus_phage	5.7e-43	37.5
WP_088718074.1\|429141_429267_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_040122766.1\|429826_430129_+	hypothetical protein	NA	NA	NA	NA
WP_088718037.1\|430160_431129_-\|transposase	IS30-like element ISVa6 family transposase	W5R8L2	Staphylococcus_phage	3.3e-43	37.5
WP_088718038.1\|431069_431270_+	hypothetical protein	NA	NA	NA	NA
WP_038149097.1\|433762_434299_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_013868623.1\|434422_435025_+	hypothetical protein	NA	NA	NA	NA
WP_080569473.1\|435232_435523_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_107489850.1\|435537_435666_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_041769299.1\|436175_436616_+	hypothetical protein	NA	NA	NA	NA
WP_013868628.1\|437220_437400_+	hypothetical protein	NA	NA	NA	NA
WP_019280979.1\|437392_438457_+	hypothetical protein	NA	NA	NA	NA
WP_013868574.1\|438431_438572_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_019281433.1\|439333_439576_-	hypothetical protein	NA	NA	NA	NA
WP_013868575.1\|439562_440012_-	hypothetical protein	NA	NA	NA	NA
WP_013868576.1\|440428_440938_+	ATPase AAA	A0A097BYE2	Leuconostoc_phage	1.4e-08	32.0
WP_013868577.1\|442088_442862_+	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
WP_020977903.1\|442852_442969_+	hypothetical protein	NA	NA	NA	NA
WP_088718075.1\|443329_443440_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868580.1\|443470_444028_+	hypothetical protein	NA	NA	NA	NA
WP_107489852.1\|444043_444160_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868584.1\|445112_445850_+	hypothetical protein	NA	NA	NA	NA
WP_026028286.1\|447009_447258_+	DUF3297 family protein	NA	NA	NA	NA
WP_013868587.1\|448044_448590_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013868588.1\|448722_449238_+	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.9e-45	49.1
WP_080749044.1\|450170_450281_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868595.1\|450786_451071_+	hypothetical protein	NA	NA	NA	NA
WP_013868596.1\|451323_451530_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_013868597.1\|451649_451880_-	hypothetical protein	NA	NA	NA	NA
WP_013868599.1\|452562_453099_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_013868601.1\|453762_454122_+	hypothetical protein	NA	NA	NA	NA
WP_013868602.1\|454276_454636_+	VOC family protein	NA	NA	NA	NA
WP_107489896.1\|455132_455243_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868604.1\|455812_456736_+	zinc dependent phospholipase C family protein	NA	NA	NA	NA
WP_013868605.1\|456732_457131_+	hypothetical protein	NA	NA	NA	NA
WP_011154650.1\|457461_459003_-\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
WP_011154649.1\|459062_459416_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154648.1\|459412_459730_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_080540813.1\|459820_459937_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013867765.1\|460024_460231_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_013867766.1\|460350_460581_-	hypothetical protein	NA	NA	NA	NA
WP_013867767.1\|460874_461111_-	hypothetical protein	NA	NA	NA	NA
WP_013867768.1\|461395_461884_+	hypothetical protein	NA	NA	NA	NA
WP_013867769.1\|462593_463091_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013867770.1\|463087_463360_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_011154643.1\|464886_465807_-\|transposase	IS5-like element ISVa2 family transposase	A0A1V0E8E1	Vibrio_phage	1.7e-177	100.0
WP_157727321.1\|465911_466199_+	hypothetical protein	NA	NA	NA	NA
WP_076611895.1\|466224_467193_-\|transposase	IS30-like element ISVa6 family transposase	W5R8L2	Staphylococcus_phage	5.7e-43	37.5
WP_088718040.1\|467133_467382_+	hypothetical protein	NA	NA	NA	NA
WP_019280976.1\|467565_467955_+	DUF1090 domain-containing protein	NA	NA	NA	NA
WP_019280977.1\|467958_468048_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_088718041.1\|468075_469226_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-51	40.8
WP_013867776.1\|469259_469523_-	Replication gene A protein	A0A0F6YPA7	Vibrio_phage	1.6e-16	49.4
WP_038148555.1\|469533_470067_-	hypothetical protein	R9TE46	Vibrio_phage	1.9e-16	45.7
WP_013867777.1\|470069_470303_-	hypothetical protein	O56843	Vibrio_virus	1.1e-11	53.1
WP_013867778.1\|470305_470881_-	3'-5' exonuclease	W6ASW5	Vibrio_phage	1.7e-50	55.5

DBSCAN-SWA_3

488660 : 540024

Leptospira_phage(27.27%)

transposase,protease,integrase

attL 484363:484378|attR 498824:498839

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
484363:484378	attL	NA	NA	NA	NA
WP_013867788.1\|488660_489620_+\|integrase	tyrosine-type recombinase/integrase	A0A2I7R1N2	Vibrio_phage	2.5e-14	23.9
WP_013867789.1\|489603_490608_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_013867790.1\|490779_491361_-	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_029189956.1\|491580_494271_+	bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013867793.1\|495862_497026_-	hypothetical protein	NA	NA	NA	NA
WP_011154650.1\|497539_499081_-\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
498824:498839	attR	NA	NA	NA	NA
WP_011154649.1\|499140_499494_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154648.1\|499490_499808_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_013867794.1\|499993_500149_-	YoaH family protein	NA	NA	NA	NA
WP_013867795.1\|500194_501385_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_013867796.1\|501445_502330_-	DUF2861 family protein	NA	NA	NA	NA
WP_013867797.1\|502326_502986_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-28	34.1
WP_013867798.1\|502960_504415_-	DUF3404 domain-containing protein	NA	NA	NA	NA
WP_013867799.1\|504566_505943_-	Re/Si-specific NAD(P)(+) transhydrogenase subunit beta	NA	NA	NA	NA
WP_020977845.1\|505954_507505_-	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_013867801.1\|507794_508109_-	hypothetical protein	NA	NA	NA	NA
WP_013867802.1\|508089_508458_-	late competence development ComFB family protein	NA	NA	NA	NA
WP_013867803.1\|508572_509937_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.0e-14	31.9
WP_013867804.1\|510112_510325_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	7.6e-17	61.2
WP_013867805.1\|510644_512657_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-17	36.7
WP_020977846.1\|512889_515241_+	fatty acid cis/trans isomerase	NA	NA	NA	NA
WP_013867807.1\|515276_515465_+	hypothetical protein	NA	NA	NA	NA
WP_013867808.1\|515524_516022_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_013867809.1\|516096_516765_-	thiol:disulfide oxidoreductase	NA	NA	NA	NA
WP_013867810.1\|516767_517388_-	glutathione S-transferase	NA	NA	NA	NA
WP_013867811.1\|517487_518072_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_013867812.1\|518068_518464_+	DUF296 domain-containing protein	NA	NA	NA	NA
WP_088718042.1\|518731_520336_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	9.5e-51	26.8
WP_017046920.1\|520488_522177_-	SgrR family transcriptional regulator	NA	NA	NA	NA
WP_013867815.1\|522256_522502_-	DUF3389 domain-containing protein	NA	NA	NA	NA
WP_013867816.1\|522491_522959_-	hotdog fold thioesterase	NA	NA	NA	NA
WP_026028966.1\|523215_524298_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_013867818.1\|524492_525068_+	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_017042819.1\|525218_525410_-	hypothetical protein	NA	NA	NA	NA
WP_011154648.1\|525999_526317_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011154649.1\|526313_526667_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154650.1\|526726_528268_+\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
WP_040122790.1\|528910_529195_-	hypothetical protein	NA	NA	NA	NA
WP_017046133.1\|529369_530026_-	QnrVC family quinolone resistance pentapeptide repeat protein	NA	NA	NA	NA
WP_011154650.1\|530883_532425_-\|transposase	IS66-like element ISVa5 family transposase	S5VTD3	Leptospira_phage	3.4e-74	35.9
WP_011154649.1\|532484_532838_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_011154648.1\|532834_533152_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_013868559.1\|533309_533966_-	hypothetical protein	NA	NA	NA	NA
WP_080749045.1\|534005_534122_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868560.1\|534118_534463_-	hypothetical protein	A0A2I7S9F9	Vibrio_phage	3.6e-08	42.6
WP_019281391.1\|534613_535162_-	hypothetical protein	NA	NA	NA	NA
WP_013868562.1\|535215_535341_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868564.1\|535848_536133_-	hypothetical protein	NA	NA	NA	NA
WP_088718077.1\|536695_536806_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_013868567.1\|536815_537349_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000179600.1\|537345_537615_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_013868571.1\|538295_538811_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013868572.1\|538848_538974_-	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_076611895.1\|539055_540024_+\|transposase	IS30-like element ISVa6 family transposase	W5R8L2	Staphylococcus_phage	5.7e-43	37.5

DBSCAN-SWA_4

809460 : 853876

Pseudomonas_phage(16.67%)

transposase,integrase,holin

attL 830055:830073|attR 864017:864035

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088718051.1\|809460_810489_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_000420717.1\|810445_810913_-	hypothetical protein	NA	NA	NA	NA
WP_088718052.1\|811830_813747_-	AAA family ATPase	NA	NA	NA	NA
WP_088718053.1\|813733_814237_-	hypothetical protein	NA	NA	NA	NA
WP_088718054.1\|814230_814782_-	hypothetical protein	NA	NA	NA	NA
WP_157727323.1\|814785_814947_-	hypothetical protein	NA	NA	NA	NA
WP_088718055.1\|815783_819893_-	hypothetical protein	NA	NA	NA	NA
WP_088718056.1\|820382_822296_-	ATP-dependent helicase	NA	NA	NA	NA
WP_088718057.1\|822277_824407_-	AAA family ATPase	NA	NA	NA	NA
WP_088718058.1\|825213_826686_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.1e-129	49.5
WP_088718059.1\|826841_828098_-	Y-family DNA polymerase	A0A1W6JNT0	Morganella_phage	6.8e-89	42.3
WP_088718080.1\|828097_828505_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1B1ITQ0	uncultured_Mediterranean_phage	6.8e-22	45.8
WP_088718060.1\|828978_829188_-	helix-turn-helix transcriptional regulator	S5M643	Brevibacillus_phage	5.0e-05	43.6
WP_088718081.1\|829287_829833_+	hypothetical protein	NA	NA	NA	NA
WP_088718061.1\|829822_831139_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
830055:830073	attL	NA	NA	NA	NA
WP_088718062.1\|831200_831404_+	hypothetical protein	NA	NA	NA	NA
WP_088718063.1\|831400_831598_+	hypothetical protein	NA	NA	NA	NA
WP_088718064.1\|831611_831974_+	transcriptional regulator	NA	NA	NA	NA
WP_088718065.1\|832072_833506_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_088718066.1\|833502_834033_-	hypothetical protein	NA	NA	NA	NA
WP_088718067.1\|834029_836495_-\|integrase	integrase	NA	NA	NA	NA
WP_088718068.1\|836488_838840_-	hypothetical protein	NA	NA	NA	NA
WP_088718069.1\|838962_839220_+	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_088718082.1\|839422_840568_+	MFS transporter	NA	NA	NA	NA
WP_013867924.1\|840584_841040_-	nitrous oxide-stimulated promoter family protein	NA	NA	NA	NA
WP_010319684.1\|841086_841287_+	DUF2986 domain-containing protein	NA	NA	NA	NA
WP_010319683.1\|841275_841749_-	NYN domain-containing protein	NA	NA	NA	NA
WP_013867926.1\|841812_842568_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_029189754.1\|842636_843449_-	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_013867928.1\|843591_843927_-	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_013867929.1\|843929_846518_-	nitrite reductase large subunit	NA	NA	NA	NA
WP_013867930.1\|847197_847986_+	lipase	Q6XLV5	Feldmannia_irregularis_virus	3.1e-07	28.0
WP_013867931.1\|848202_848796_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_013867932.1\|848817_850278_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_013867933.1\|850296_851997_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	7.1e-65	32.4
WP_019280799.1\|852033_852978_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013867935.1\|853027_853876_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
864017:864035	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP021980

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP021980_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021980_1

480830-481068

Orphan

Consensus_repeat	Method
ATCCGATGTTCATTCTCGGTTAGGATCCTAACTCGGAAATTATGAGGATGAATAT	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP021980_1

>merge|NZ_CP021980|1|480830-481068|PILER-CR
ATTCTCGGTTAGGATCCTAACTCGGAACTTATGGGGATGATTATGGTTGCTTTGAGGTGAGGAAATGGCAGCACTAATCGTCAGATGCGATGTTCATTCTCGGTTAGGATCCTAACTAGGAATTTGTAGTGTTTGACGTGGTTGCTATGAGGCAAGGGGAAATAGCAGTACTAATCGAGCCATAATCCGATGTTCATTCTCGGTTAGGATCCTAACTCAGAAATTATGATGATGAATAT

>NZ_CP021980|1|1|480830-481068|PILER-CR
ATTCTCGGTTAGGATCCTAACTCGGAACTTATGGGGATGATTATGGTTGCTTTGA	GGTGAGGAAATGGCAGCACTAATCGTCAGATGCGATGTTC
ATTCTCGGTTAGGATCCTAACTAGGAATTTGTAGTGTTTGACGTGGTTGCTATGA	GGCAAGGGGAAATAGCAGTACTAATCGAGCCATAATCCGATGTTCATTCTCGGTTAGGATCC
TAACTCAGAAATTATGATGATGAATAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021980.1\|WP_041769251.1\|483288_483879_+\|resolvase	unknown	unknown	gnl\|CDD\|239737
NZ_CP021980.1\|WP_088717975.1\|489029_490186_-\|IS3-like-element-ISVa4-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP021980.1\|WP_013857747.1\|491677_492076_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_013857761.1\|476557_476944_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|226653
NZ_CP021980.1\|WP_107489905.1\|476271_476478_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_013857745.1\|492429_492795_+\|translation-elongation-factor-Ts	unknown	unknown	unknown
NZ_CP021980.1\|WP_020977818.1\|479470_479809_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377579
NZ_CP021980.1\|WP_013857757.1\|480091_480631_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227645
NZ_CP021980.1\|WP_088717974.1\|481315_481555_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_013857752.1\|485991_486987_-\|membrane-protein	unknown	unknown	gnl\|CDD\|235264
NZ_CP021980.1\|WP_013857763.1\|474274_475807_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|226950
NZ_CP021980.1\|WP_011988345.1\|473522_474263_-\|transposase	unknown	unknown	gnl\|CDD\|366760
NZ_CP021980.1\|WP_013857766.1\|470719_472087_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP021980.1\|WP_013857751.1\|486989_488765_-\|type-I-restriction-modification-system-specificity	unknown	unknown	gnl\|CDD\|341145
NZ_CP021980.1\|WP_020977819.1\|479153_479474_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227893
NZ_CP021980.1\|WP_011154643.1\|481605_482526_+\|IS5-like-element-ISVa2-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP021980.1\|WP_013857753.1\|484251_485694_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP021980.1\|WP_020977815.1\|492205_492355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_013857765.1\|472565_473342_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277349
NZ_CP021980.1\|WP_019281019.1\|468973_469558_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021980.1\|WP_041769251.1\|483288_483879_+\|resolvase	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.45711e-43
NZ_CP021980.1\|WP_088717975.1\|489029_490186_-\|IS3-like-element-ISVa4-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	2.04955e-59
NZ_CP021980.1\|WP_013857761.1\|476557_476944_-\|transcriptional-regulator	gnl\|CDD\|226653	COG4190, COG4190, Predicted transcriptional regulator [Transcription].	1.96161e-18
NZ_CP021980.1\|WP_020977818.1\|479470_479809_-\|hypothetical-protein	gnl\|CDD\|377579	pfam05973, Gp49, Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.	6.90233e-17
NZ_CP021980.1\|WP_013857757.1\|480091_480631_-\|hypothetical-protein	gnl\|CDD\|227645	COG5340, COG5340, Predicted transcriptional regulator [Transcription].	0.00599963
NZ_CP021980.1\|WP_013857752.1\|485991_486987_-\|membrane-protein	gnl\|CDD\|235264	PRK04247, PRK04247, endonuclease NucS.	0.000223311
NZ_CP021980.1\|WP_013857763.1\|474274_475807_-\|IS21-family-transposase	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.15875e-30
NZ_CP021980.1\|WP_011988345.1\|473522_474263_-\|transposase	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	4.90299e-59
NZ_CP021980.1\|WP_013857766.1\|470719_472087_+\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	7.36094e-45
NZ_CP021980.1\|WP_013857751.1\|486989_488765_-\|type-I-restriction-modification-system-specificity	gnl\|CDD\|341145	cd17256, RMtype1_S_EcoJA65PI-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to S.EcoJA65PI TRD1-CR1, S.Fco49512ORF2615P TRD1-CR1, and S.SonIV TRD2-CR2. Escherichia coli UCD_JA65_pb S subunit (S.EcoJA65PI) recognizes 5'... AGCANNNNNNTGA ... 3' while Shewanella oneidensis MR-1 S subunit (S.SonIV) recognizes 5'... TACNNNNNNGTNGT ... 3'. The recognition sequence of Flavobacterium columnare S subunit (S.Fco49512ORF2615P) is undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example, S.EcoJA65PI TRD1 recognizes AGCA/TGCT and S.EcoJA65PI TRD2 recognizes TCA/TGA; S.SonIV TRD1 recognizes TAC/GTA and S.SonIV TRD2 recognizes ACNAC/GTNGT. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	1.06481e-27
NZ_CP021980.1\|WP_020977819.1\|479153_479474_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227893	COG5606, COG5606, Uncharacterized conserved small protein [Function unknown].	6.84611e-14
NZ_CP021980.1\|WP_011154643.1\|481605_482526_+\|IS5-like-element-ISVa2-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	1.44946e-57
NZ_CP021980.1\|WP_013857753.1\|484251_485694_-\|hypothetical-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	2.35889e-06
NZ_CP021980.1\|WP_013857765.1\|472565_473342_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|277349	cd07404, MPP_MS158, Microscilla MS158 and related proteins, metallophosphatase domain. MS158 is an uncharacterized Microscilla protein with a metallophosphatase domain. Microscilla proteins MS152, and MS153 are also included in this family. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.5789e-18

>NZ_CP021980.1|WP_013857757.1|480091_480631_-|hypothetical-protein
MSIEMNIETALERLHRFDKQGIHVYRKSDLRRLFFDDSLTAFQQSLPRLVKAGVLERVCNGVYVFSYSRQKGGYTIEYIAKCLRRGEYNYISLESALSEYSVISQVMLDRITIMTTGRKGEFRTNYGVIEFTHTKRDDIDIISNTITSDRPLRIAKKETAIRDLKRVGRNTHLIVTNHE
>NZ_CP021980.1|WP_020977818.1|479470_479809_-|hypothetical-protein
MVLKFAFVNDAAEREYKKLPEDIQDEFGKDLRKLQFGQTPTSPIQYLDSVGAGVVELKINGSPAYRCVYVTKYLDTVVVLHSFVKTTNGTDKQAMKVATQRLKELKAEIAST
>NZ_CP021980.1|WP_020977819.1|479153_479474_+|helix-turn-helix-domain-containing-protein
MALKFYDSPFHATHEERVATKMALKMDLSIMISNAIDQKGWSQKEASEALGVSRSRISELKNNKIELFTIDAMFDMLDKFGFEAKMTSPSITEAKIVITQQPAKTY
>NZ_CP021980.1|WP_013857761.1|476557_476944_-|transcriptional-regulator
MKARIGVTSEDLIRRHMINLAAGNINHNKHLPTFWFTSLDEVSKLLCNENIELMLLMSREKPESLAELAEISGHHIHELSRKIDTLSSKGFIQFEEKGNACRPIALFTDFEVLLGKELEITLQEGYLS
>NZ_CP021980.1|WP_107489905.1|476271_476478_+|hypothetical-protein
MKNEAKATRSDNEQAESKDSEVTLNGHLELLDHAISSNTDKLVEVTEALKIELEEIIDDYQVGLGGKY
>NZ_CP021980.1|WP_013857763.1|474274_475807_-|IS21-family-transposase
MAKKRTPMNKIKEVLRLKYDCGLSNRGIASCLKLGPSTISELLTRFKQSQLGWPLPESCSDADLTQALYHGKKASRDKVMPDFTQYAVELRRKGMTKMLLWQEYHEQYQEQAYAYTQFCEHFTRWFKTQKRSMRQLHVAGDKLFIDYCGPRLQVVNPDTGEVREAEVFVATLGASNYTYVEAFPSQGKSYWLEAHANAFEHFGGVPQLLVPDNLRSAVTKANRYEPRLNDSYQKLANHYQTAVMPARPYKPKDKAKAENAVLLVERWIMMRLRHQTFHTFKELNLAIRELMNDLNEREMKQYGASRKALFDKLDKPALKPLPKQRYLYTETKRAKVGPDYHIECRRHYYSVPHQLVGHHVELEASNRLVQIYHQGNLVAQHPRSQRERGNSTQPEHMPSNHQHQKWSPGRLLNWGANIGPATREVINKMLYSKPHPEQSYRSCLGLLNLSKAHGESRLEQACKDALMLTKPNYTFINNLLKNNREGQLSKDNTSTPNLVHSNVRGPNCYH
>NZ_CP021980.1|WP_011988345.1|473522_474263_-|transposase
MNALNDQLKTLRLSHAVKALEQQQEQLSTYAELDFEERLSLLLESEILNRNQTKIQRLKRQAKLRVDAQPSQLIYKEGRNLNRKQMSELLTGSYLHKHQNILITGPTGAGKTYLGCALATSACDQQHTVRYYRLTRLLDDLTAGRLDGSYQKQLQSLAKKALLILDDWGMEKLTQEHAGHLLEVLEDRYQNSSTIVISQLPVKEWYNMIGNATVADALMDRLVHNSHRIELGGESMRKLAQSDHLE
>NZ_CP021980.1|WP_013857765.1|472565_473342_-|serine/threonine-protein-phosphatase
MKFYVVSDLHLDTHGIRRDFWHDFDEEATLLVAGDTANALNGITYIKNVLCSYFKAVVLVAGNHEWYSGKSKSYRSGYLRKQDSIRSTDNRYSPIEKLKVHSDTTKNLFFLDNESIDLDGCRIYGGTLWFPIHTYSSALIDAYSELMNDTKYISHQMIEEQYKAFVNNLPEKVDLVVSHHLPSKEAFAVEENANSVYAPYYHAGLSNELISRARYWVAGHQHDAVEKVIAGGKTTFICNPKGSVRLTSELLTNKAYYL
>NZ_CP021980.1|WP_013857766.1|470719_472087_+|site-specific-integrase
MLTVIKIQSATSSKNSYYLWDQSGQRGTGRLGVKIFTSGKKQFVFRYYQQQKEKFISIGLFSGRAGGMTLAEAREQAQVFSQLLLSGRDPKLHIEQQEIEQKRIDAESKELGTLEDLFHSYTEQMKIDGKRTHETVLKSLKKECYPYIDKNIKACDVTTNDIKYVISKVIQRGAITSSNRVRSYIMAAFNHGMRFDNDPRYFSLECKFALKYNPVSLIPRQKDGERVGERFLEWRELRRFLKDLRENYEVVPVGQDLRHLLQLCIYLGGQRPYEVVTLEWWNVDWKERFVCITKERSKNKKDHIVPLNELAFEIFQKQYELSGGGRYVFPNPNDAEQPMKTSSICRAVTRYRDDVGFDKFVPRDLRRTCKTLMGSCRISKEIRDRIQNHALQDVSTRHYDRYDYFDDKLGGLESWNNKLKELIGYVPPALSVVSSAETLPFPDIKSTQSLRANLK
>NZ_CP021980.1|WP_019281019.1|468973_469558_+|hypothetical-protein
MLLAILRKLLKPLIYLRIKHKQKLYIDLILPVIIGVVLTAIVFFSPVQIKLLGQGSLVGLVNGLLQILIGFFVASLAAVATFQREGLDEVMVGKAPTLRGEKITRRQFVCYMFGYLALVSIVLYFGGGITELTVGLLKVLITEKYELFKYSAIFVYLSVLANLVLTTMLALYYLTDRIIRDNTVSPILSEPEQE
>NZ_CP021980.1|WP_088717974.1|481315_481555_+|hypothetical-protein
MSQVLVYSKRNREMSYLSTKEERETKSNRFQVVYNDISDEEALRRANSINLDEKNSVPQVRSKRQSIKEKRLCCLNRWN
>NZ_CP021980.1|WP_011154643.1|481605_482526_+|IS5-like-element-ISVa2-family-transposase
MPKPRYKTTNWKQYNKALINRGSLTFWIDEETIAEWKQNKQGKRGRPRRFSDLAITTALMVKRVFSMPLRALQGFLDSVFKLANIPLVCPHYTCISRRAKEVEVSFKTKTRGAIQHLAIDATGLKVYGEGEWKVKKHGTDGKRRVWRKLHIAVDTSTHEIVAAELSLSNVTDAEVLPNLLKQTRRKIIEISGDGAYDTRNCHDAIRIKQAVALIPPREGAAFWEQGHPRNLAVGCQKLYGSNKKWKKRYGYHKRSLSETAMYRVKQLLGGKLSLRNYNAQVGETYAMIKALNKLTGLGMPETQYIA
>NZ_CP021980.1|WP_041769251.1|483288_483879_+|resolvase
MGRTFAYCRVSTSEQTVSNQILAIRNAGYDIQEHRIVHETVSGSVPATERREFKMLIEHKLEPGDKLVVLKLDRLGRDNIDVQHTISMLLEKGVTPISLDLPTADLSSAEGRLMLQMFSAFAEFERNRIRERTLEGQARAKFEGKRIGRPEAISTTQKVQECRARGLSQSKTANALGISVPTVKRHWNKRLTESTQ
>NZ_CP021980.1|WP_013857753.1|484251_485694_-|hypothetical-protein
MAVKTAWAMRDRLIHINQLNRDTERGSKCNCICISCGSELVARMGDHKAYHFAHSLDNNCSVESIQHQLAKSIIAESISDSITTAHQNPVYPAFGYKVVLKSVELEKPLNGSQIIADCFVNQDNHPFAIEIFYSNKKDFSHIKQYQALTIPALEIDVSKMDLHLSHQDLKNFVLHDAPRKWLKKAQINQEIAHGYPEKDSTGVFDWITSGDAINALKELHEHDRLYDFVGAVGKCGESSFQRRERINVQSVDGVIESNDDYVLARGRVAKSISVDIVFPLGDYTPKDFTSPTLVVELDIWESHHRTNWHGIDKWKQKLQYQANLEAEKKEQRRVKRLASKSKELRIEHVCQMYRQSSLSDFYSTLNAHTGLDLSVLPFFQNGKIMTNWNCPRAVWRAIVLLVFIKQGKKLECDMFGDDMAMSKTFDWDYRYAESRSKEVYFWLDKHYQALGAKRERLTYQFRKSKLPKNFDSMMVDLISS
>NZ_CP021980.1|WP_013857752.1|485991_486987_-|membrane-protein
MSLYNIPNKNLTALTPTTFAAEGLQERHDLQEALKGCIDAIAPDCLVISEEFSDWEDSRRRIDLLAIDKNANLVVIELKRDEVGAHMELQALRYAAMISTMTFDKACDYYAQYLKKEGLEIEAREAILEFVDLDENSLDDFGNDVRIVLASADFGKELTTSVLWLRDKGIDISCVRLTPYRYKEDVLINAEQIIPVPEVEEYQVKFREKRAEQRTSVQKGEKDYSEYRYNGHTYKKRHLALALVTDWIEKHQPQSLNDVLNAFNEPVRRRIAILSDEIPQGRIRRFHSDEDALITLPNDEVIAITNQWSLSNITRLIHFAEQSGLNVEKAD
>NZ_CP021980.1|WP_013857751.1|486989_488765_-|type-I-restriction-modification-system-specificity
MVVENLITEHIDIWTSAVKTKSTSGRGSSKKLELYGVKKLRELILELAVRGKLVPQDSNDEPASVLLERIELEKAQLVKEKKIKKPKTLQTLSPESLPRLPESWTCSYMQDITEYVQRGKCPKYAEEGSVRVISQKCVQNSGFDIEPARYIEEESLEKYQDDRFLKENDLLWNSTGTGTVGRVNVLPSIKQKSLVADSHVTVVRPLIMNSRYIWCILMAPGVQARIDPFHEQSLVSGSTKQVELNTSSVVTLPIPVAPIAEQHRIVDKVDELMALCDQLEQQTETSIEAHQVLVTTLLDTLTNSADADELMQNWARISEHFDTLFTTEESIDQLKQTILQLAVMGKLVPQDPSDEPVSKLLERIKNHQLDRVQRKEIQKPKKASVSTILKMDIPKCWKSLLLNDLVFVTKLAGFEYTKYINLEDAGDVAVIRAQNVRPFKPDLENLKFIDNETSLSLPRSAIDRPSLLVTFIGAGIGDVCVFNEEKRWHLAPNVAKIEPYADLNLEYLCIYLNSPVGRGELFKSMKSTAQPSLSMTTIREIWVALPPVDEQKRIVTEVNKLFTLCDQLAVRLKASQVVQLHLTNVIAEQAI
>NZ_CP021980.1|WP_088717975.1|489029_490186_-|IS3-like-element-ISVa4-family-transposase
MSPKLRVQITPQQKLEYAKMMVEDGYTNQQIQDISGACSSAVVRWKRQYKEEMLGMTPTNRVALTPEQQRIQELEKQLARAKRDIDIFKKSQRLVHTKSVKPDVVRKLKKAHPKFTISELCRVLGVASSCFYYTRVVCSDETTLHDRIYRIAEDSDFTYGKRRIHRELVKSDVKIGLAKVSRLMKAIEIPVKYPKKRHRYNEVGEESIYAPNILKRQFTPETHNTHWVTDVTYIRSHQGWSYLACVLDLATKEVVGYSLSRSPDTNLTLAALDNAIQKRRADTTQLLLHSDQGCHFSSRAYRHRLQVLNITQSMSKRGCCWDNAVVERFFRSLKSERLNELSFINHQSIVMEVESYIRFYNYKRSHSGIDYLTPNEKYQQMQKVA
>NZ_CP021980.1|WP_013857747.1|491677_492076_+|hypothetical-protein
MKIECPHCQTDNDIEFAENIACKECEKSFKGFKFSKRKLVSASTALAVGLFGGYKVNGALEDERYPIEVEYAIVDTCINSAKNMASVSWYESKRETCLCALAETEKSVPYSDYKSDQQLFLSNFKLNAKGCS
>NZ_CP021980.1|WP_020977815.1|492205_492355_-|hypothetical-protein
MSKNKTPMTPEAAARIQSHEAKNNGGKVEKGTFTGRAQRAAAHNQKQGK
>NZ_CP021980.1|WP_013857745.1|492429_492795_+|translation-elongation-factor-Ts
MGTTQKQKQIRTMLDALGWSHKQLADVLYEELQCSEYEDIEDASPDEIRKFRESLKKQLQRESTPESRLEQYVKIISDHPDFVALGLDVVVPKYVDHRCLNEDSLAGLAEISSWLDEDKSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP021980_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP021980_2

1899677-1899822

Orphan

Consensus_repeat	Method
CCAACACCATCAACAATTGCTTTATCTTCATTGGTGTAGTCGTTGGTTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP021980_2

>merge|NZ_CP021980|2|1899677-1899822|CRISPRCasFinder
AATACAGACTTTACGATGTTTTTATCTTCATCGGTATAGTCGTTGGTTGAAAGTTCTTTTCCGGTAACCTTATCTACTTTCGTGTTAAGCGCATTGCCAACACCATCAACAATTGCTTTATCTTCATTGGTGTAGTCGTTGGTTGA

>NZ_CP021980|2|1|1899677-1899822|CRISPRCasFinder
AATACAGACTTTACGATGTTTTTATCTTCATCGGTATAGTCGTTGGTTGA	AAGTTCTTTTCCGGTAACCTTATCTACTTTCGTGTTAAGCGCATTG
CCAACACCATCAACAATTGCTTTATCTTCATTGGTGTAGTCGTTGGTTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP021980.1\|WP_052131881.1\|1896669_1897281_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_041946970.1\|1905036_1905636_-\|tail-assembly-protein	unknown	unknown	gnl\|CDD\|227067
NZ_CP021980.1\|WP_041946968.1\|1900405_1901500_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_041946973.1\|1908059_1908806_-\|phage-minor-tail-protein-L	unknown	unknown	gnl\|CDD\|227018
NZ_CP021980.1\|WP_013856591.1\|1889978_1890233_+\|YnjH-family-protein	unknown	unknown	gnl\|CDD\|369340
NZ_CP021980.1\|WP_088717994.1\|1894662_1895475_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_157726748.1\|1900201_1900366_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_041946969.1\|1901496_1905027_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|227076
NZ_CP021980.1\|WP_013856590.1\|1890244_1891762_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP021980.1\|WP_041946964.1\|1895477_1896428_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_157726749.1\|1912085_1912247_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_013856588.1\|1893184_1894219_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|223787
NZ_CP021980.1\|WP_041946974.1\|1908819_1909158_-\|phage-tail-protein	unknown	unknown	gnl\|CDD\|377570
NZ_CP021980.1\|WP_013856589.1\|1891847_1893188_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP021980.1\|WP_041946972.1\|1907310_1908057_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|163704
NZ_CP021980.1\|WP_041946966.1\|1897282_1897945_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_088717995.1\|1909160_1912073_-\|phage-tail-tape-measure-protein	unknown	unknown	gnl\|CDD\|377708
NZ_CP021980.1\|WP_041946965.1\|1896424_1896673_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP021980.1\|WP_041946971.1\|1905706_1906036_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|313734
NZ_CP021980.1\|WP_088718021.1\|1898032_1898509_-\|phage-tail-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP021980.1\|WP_041946970.1\|1905036_1905636_-\|tail-assembly-protein	gnl\|CDD\|227067	COG4723, COG4723, Phage-related protein, tail component [Function unknown].	1.46837e-49
NZ_CP021980.1\|WP_013856588.1\|1893184_1894219_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|223787	COG0715, TauA, ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism].	1.53632e-36
NZ_CP021980.1\|WP_041946974.1\|1908819_1909158_-\|phage-tail-protein	gnl\|CDD\|377570	pfam05939, Phage_min_tail, Phage minor tail protein. This family consists of a series of phage minor tail proteins and related sequences from several bacterial species.	1.15972e-39
NZ_CP021980.1\|WP_013856589.1\|1891847_1893188_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	9.09678e-58
NZ_CP021980.1\|WP_041946969.1\|1901496_1905027_-\|phage-tail-protein	gnl\|CDD\|227076	COG4733, COG4733, Phage-related protein, tail component [Function unknown].	0
NZ_CP021980.1\|WP_041946972.1\|1907310_1908057_-\|C40-family-peptidase	gnl\|CDD\|163704	cd08073, MPN_NLPC_P60, Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding) found in proteins also containing NlpC/P60 domains. This family contains bacterial MPN (also known as Mov34, PAD-1, JAMM, JAB, MPN+)-like domains at the N-terminus of NlpC/P60 phage tail protein domains. These domains contain the signature JAB1/MPN/Mov34 metalloenzyme (JAMM) motif, EXnHS/THX7SXXD, which is involved in zinc ion coordination and provides the active site for isopeptidase activity for the release of ubiquitin from ubiquitinated proteins (thus having deubiquitinating (DUB) activity) that are tagged for degradation. The JAMM proteins likely hydrolyze ubiquitin conjugates in a manner similar to thermolysin, in which the zinc-polarized aqua ligand serves as the nucleophile, compared with the classical DUBs that do so with a cysteine residue in the active site.	8.19851e-39
NZ_CP021980.1\|WP_041946973.1\|1908059_1908806_-\|phage-minor-tail-protein-L	gnl\|CDD\|227018	COG4672, gp18, Phage-related protein [Function unknown].	2.1191e-86
NZ_CP021980.1\|WP_013856591.1\|1889978_1890233_+\|YnjH-family-protein	gnl\|CDD\|369340	pfam07383, DUF1496, Protein of unknown function (DUF1496). This family consists of several bacterial proteins of around 90 residues in length. Members of this family seem to be found exclusively in the Orders Vibrionales and Enterobacteriales. The function of this family is unknown.	7.31678e-23
NZ_CP021980.1\|WP_041946971.1\|1905706_1906036_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|313734	pfam10571, UPF0547, Uncharacterized protein family UPF0547. This domain contains a zinc-ribbon motif.	6.49396e-05
NZ_CP021980.1\|WP_013856590.1\|1890244_1891762_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP021980.1\|WP_088717995.1\|1909160_1912073_-\|phage-tail-tape-measure-protein	gnl\|CDD\|377708	pfam06791, TMP_2, Prophage tail length tape measure protein. This family represents a conserved region located towards the N-terminal end of prophage tail length tape measure protein (TMP). TMP is important for assembly of phage tails and involved in tail length determination. Mutated forms TMP cause tail fibers to be shortened.	3.03956e-74

>NZ_CP021980.1|WP_088718021.1|1898032_1898509_-|phage-tail-protein
MLEKFDGAIEITEQQYSDALAAKIDGRKAFVRDGELIIYTGKVTAYLKADCTKQKEFNDKTLVTDDYTLNVPATRFDEWINDEWLTNQSNKYIVEYDTVDSVRRNLYLQVSDPLYNKARRLERNGEIDKANDYYAQADASVIKIEAQNPWPINPLASQ
>NZ_CP021980.1|WP_041946966.1|1897282_1897945_-|hypothetical-protein
MPKTVTVGKDWVLLSDLVPGSNENSIFKGQIQKGSIKIKESLTHPTDSTDSYVMRASDSGGNGDEVFKCGDGKLKVYVIAYLCSSATVSIEDHSSSTQRGGALLSELVEVYEIISESSVNGDHDFEVGSILKSPNIFLDEFRFLDAQGSAIVPTAGTVLVQVSSNGDFWRTLNDGSFAATTDTASESYTPPSGLAAISKLRISLSGVTGANGFKANLVRG
>NZ_CP021980.1|WP_052131881.1|1896669_1897281_-|hypothetical-protein
MSVLPRRNKFKAALITGGSADKYAPLFDGLTQYVQLSEVISIPVGVDFEISVVASGIPADAQYSIMSGPSIADFYRTRTANDGIQTSLAGTYGLNWTGANNDTLLKHKYALKRVGEDISIAVDGIERSTRSTTVGTIAIDRLMRSWTSSIYTAGVVYSLEVSIGGLITTSIAFNQRNAAVQLPAVGTISATIVNHTNAMWVKV
>NZ_CP021980.1|WP_041946965.1|1896424_1896673_-|hypothetical-protein
MKQLYALIKESSYSAFYGRFPDAVQFDGYRLGVFVDNELDGVTGLADDWAHFDGSNVVADLTVCTYEQAKLIVSEFNKESEL
>NZ_CP021980.1|WP_041946964.1|1895477_1896428_-|hypothetical-protein
MSVLPIGSGGVTPDQAEVLDKLSYNEPTDTLIADASVQTKPSTVYLGSAFGMSNAVQAVGFRLADGTDALCLVNRFDSDLGTISNPKFFALGKSSFLNVNLVDSVVMSSSIFVNYTTAGDNLTYSFDIKPATTGRLRAQYWLGADDSGAPVVDFFRDITQAEVDSGQPVLVEPNFYALTGGSQLFVRFSGVSLKGDGTLPWFRSKIMPYKEISIGGHVEVIGAAENDSEIYIGCKYVPDTTDGEVRRKVPFAFTSFFSVTDAKKNLSNSKKCIFDFTDFNQGTVVMKHSGDNLDFMHIDGDGWYLVDYVEANIVRV
>NZ_CP021980.1|WP_088717994.1|1894662_1895475_-|hypothetical-protein
MGYETTSRTDMHFGIKTNSADVIDRNGKYLLNNYTTSPEIKVTPEVDYIELGAWDSAMSITEYSTILLPQDVNGGTHLKVNYKTNNPITLFRHKNHGTESERYNWYLVYSGFEDYRVTLPTTVGGTYDINAGFKSFHVNVPLNNISNQYYVGVDDSLRLAVQRVGTSSGSHNVGLCTTAKSWGVQFTTNMTGAQSIYKGGNLLTTATAVDWPLGSAIASTNNFVAELFVNHSQNSNDKQYRRYRFLGERTVANSIVMKVECWIWPDMYSQ
>NZ_CP021980.1|WP_013856588.1|1893184_1894219_-|ABC-transporter-substrate-binding-protein
MAMVTKKHKAQTFHKVAMAIVVLVVTIAIFNRQLGHFYDASRVEERKAVRIAVSQTPLSSSFIIADSLGFFEQQGVNVELVPCSGGVACSQALFSGNVDYATASESVVMFKLFQRNDFALLTSFVESDNDLKLLTLERLGIVNLSDLEGKKVGIVKASASEFYFDSLLIASDLKEMAVEKVYLPPEALNDSLFSSQVDAISVWEPYGYKTETSAPSDVLNLGLSGIYHLSFNLLSMKATVEEAHDEIVAILRALKEANEWINLNPEQSREVIAQALNIPLPQLEWSWNDYVFRLSLGNALLSNLQLQARWAIEAGMVTGDKPDFRTVLASKPIEEVLRTKVSIK
>NZ_CP021980.1|WP_013856589.1|1891847_1893188_-|diguanylate-cyclase
MISSIVRKLTLLFASTAFLILLITFSLWGLLKEQEQTKKDLEDIMQIQLSVDLLRSQLWIFLQYSDVSSLDQVDIAQQSLSKRLLNHKMMGKHIENLQRMNTSLAVLLQQEKKLTHQDAEAKSNSLISAKGLLHSRYNMLVQNMTEELFYLQKSVLAKSIESQQMTLMLSALKILFFSILVSGIAWLILKRFKRGFASIKQGILALTYGDLESKIEPVNLDIEFVALADFFNHMKVSLKTTTVTKDELQLEVERQTSELKIQKDQLQFLSEHDSLTGLLNRRAFEKLLDNAIVKANRTKVKLALLFIDLDNFKTINDTQGHCAGDEILKQIAIRLEASIRQSDFAARLGGDEFVVCLDLIDEYDFVAEKVKQIIKCLGLPIEFEGQSLTVGVSVGISYFPLQTNSMHHLMALADEAMYQAKEVVGNTYCQNIDPLRGVFTVEDVVS
>NZ_CP021980.1|WP_013856590.1|1890244_1891762_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MNLTQFPFTLCFSSHIIARSIVMQLRDPQLFKQQCYLNGQWVCASNSLTSTVYNPYDGTLIGTVPQLDSAQVQQAIEGAELAQKLWKKQPAADKARVLRSWYELIVEHSDDLALILTNEQGKPLAEAKGEISYAASFVEWYAEEAKRAYGELVPSHKADARILVSKEPIGVVAAITPWNFPAAMVTRKCAPAIAAGCAVVLKPAPDTPFTALALAELAHRAGLPAGLLQVVTGEAIAIGQQLTSSKVVRKLSFTGSTGVGKILMAQCAHNIKKLSLELGGNAPFIVFDDADINAAVEGVMVAKFRNAGQTCVCANRIYVQEGVYDKFVKKLVDKVSKLTVGNGLESVVTMGPLINDAAVAKVKLHIADATAQGALVQYGTLPQAGSRLFEPHVLTEMTEEMLVAQEETFGPLAPLFRFSHEEEVIERANHTDSGLAAYCYTQSLARAWRLSEALEVGIVGINEGLISTTVAPFGGIKESGLGREGAKQGLDEYLEVKYTLMGGLN
>NZ_CP021980.1|WP_013856591.1|1889978_1890233_+|YnjH-family-protein
MLKYCVWLLLIAPSFGYTKVITTASLPFVVATEGKALQRVCYYKDQAYSIGAVIQVGELYMICQEANDFETNGPLRWGLLTQQK
>NZ_CP021980.1|WP_157726748.1|1900201_1900366_-|hypothetical-protein
MKTPAQEFTDILIANSGNRLTPELIAGMQARFHHVLERALKDQSNQKQSENENG
>NZ_CP021980.1|WP_041946968.1|1900405_1901500_-|hypothetical-protein
MSYGIGIYDAKGVLSLTDGWYPMSYKGTISFTVGYISAPDVVRSFSIPAGCTVVIQPAGPSVQHIAAGGGFSGYVLGSYISGGTVTIRQQLWYGYSGSPLIGQVVNFNVYAYYPSTANSGDYGAFFAGSGVSVALTNTNTLNVLRFKGEWNTASSDFTVSTGISASEPEPSIYLSDTGYNCTACYVFNSGGIWHVRILRNGGLYKIDFTVSSEPPRNGLVRLAAFSKPIQSVSGWGFALYGQDGSVAFTSSQRPEMPRGFLYSPSPSISGPPGTSAWSAIADANPQAVPSFGIIKPMIKARIIGISKISFLPFPIGTWLKSNGVFTCGVMYKGEGSMPVGSTFGYWGENSSNSPIQYINEYDYF
>NZ_CP021980.1|WP_041946969.1|1901496_1905027_-|phage-tail-protein
MNNVVISGSKAGESEQHTPVEAPNDLRSVATARILLALGEGEFEGGVNEKSIYLDGTPLMSQNGTINFPGVKWDFRSGTVDQQYIQGFPAVESETAIGVELKSDAPWTRSFNDGQISAVIIRFRWPSLQEQKDNGDVVGYSIDYRVEVSTDGGPYIVASQQGVTGKTTSNYERSVRINLPSGNGWVVKVTRLTPNMNNNRIADLMYIGAVTEVIDRKMRYPNTALLGIQFDASQFSNIPTISVLAKMRKIRVPDNYDPVTRTYSGIWSGGFKIAYSNNPAWVTYDIIIENRFSVGDKVGPQFVDKYELYKIAQYCDQQVPDGKGGTEHRYECNIYIATAAEAWQVLRDIASIYRGMIYWMQSQMTVRADMPRDTDYIFTNANVIDGTFTYSGSDERVKYTRALVSYDNPDNNFESDVTTTYDNALQRRYGDNVVELSAFGCTRESEAQRRGKWAIYTNNNDRTVAFKTGMEGEIPMIGHIVAVADDLISGVRIGGRISNVSADGKTITLDREVAAAKAGDRLLVNLPSGKAETRTVETVTGRDIKVSSVYSESPAKFLQWTLESDDITHQLFQIVSVKKADTDSIEYEFAGVSYNPSKFDFIDTGARIEDRPVSQIPVGGMEAPEEVLISQSVYVEQTMAITTMTIGWSAVKNSVAYEVEWRKDYGEWVKMPRTGQLSVDIKGVYTGQYLARVRAVSSAGVASIAKPSMLTDIVGKVGEPPSLAIFRTSSKAFSIYLDWSFGPNSEDALYTEIEYATNAQGTNPSFLGSYAYPTSDHLMMGLAAGVEFWFRARIRDRTGNVGAWTDWTYGVSSVDAEELLSYLEGQIGSGELAPGLLEEITNDVAAGIGDEIIGDVEDSILGFLTGDDENAPQDMLWYAGDDGTQESFVGNVTITSAYNDQDYSKAKQIFLLAGRVEDNKALISRVDAISVSRDEALAQSLSLISVEVGENTAKITSEQTARVTADEALAQDIQALAVTVGENTAAIATEQTVRADADTALAELVQTVSAQIGDIEAVVQQTSEAVVDLDGSIKANWQVKTEVNADGRVVQAGVGLGASIGADGTTRSEFLVMADTIGFLNSIDGQIHTPFVFDTVNDTAFLNSAIIGDATISYAKIANDLQSTNYQAGLVGWKLDKNGVFENNGSDSSGRMVQSNNRIDVYDASGALRVRIGKLI
>NZ_CP021980.1|WP_041946970.1|1905036_1905636_-|tail-assembly-protein
MSYATILLSGSLAQRFGRSHSYHLDSGTAKEAFSALKNTLEGFEQFIKEQSKRGIRYAIFRNRENVGEDDLTLRGTNEIRIVPVVQGSKKAGVLNTIIGAVMIIAGVLVTGLSYGWASPIGGAMINAGIAMMAGGVIQMLSPQQKGLSSREAAENAPSYAFGGAVNTTASGHIVGIGYGERLIGGAVISAGIYAEDIAN
>NZ_CP021980.1|WP_041946971.1|1905706_1906036_-|zinc-ribbon-domain-containing-protein
MVDEKKCPDCAELIKEEAIKCKHCGHEFKARKSKGLIFAISIFCLLLVFFIIGSNTDPQKIKERDSISICWKDYDDSGITAKKLIKQTCQSMVKDFELKHGRTPSIRRE
>NZ_CP021980.1|WP_041946972.1|1907310_1908057_-|C40-family-peptidase
MWQEEFKKNFIEHAKSQYPNECCGLLIDDGKKPFYMPCRNAAEKPDFDFSIHPVDLATCESIGEIIGICHSHPDATSRPSVADQANAYSLSTEYPKADWYIFSWPEGDLHRFSPQKESPPLIGRQFVHGVWDCYTMVMDYYKKELGIDIPDYERKDCWWEGDQELYLDNFESAGFTQVCGSAPEDLKGFEFKIGDVVLMQIRSKLVNHAAVYVGDGYMIHHLYGRLSTKEVLGGYWLRSTRAIVRYNT
>NZ_CP021980.1|WP_041946973.1|1908059_1908806_-|phage-minor-tail-protein-L
MSLSNDIQTLEPGSEIILFEVDGTDFDADILRFQSHLEPYTEQEIQAALQSGEDLQPKSITWQGEKFYTWPCQITGIEANSDGSPSSPTLIVANVDSSITALCLAYQDMSQAKVTVRRTLAKYLDAVNFPEGNDQADQDQEHVEIWYIRRKLSEDKISVTFELSSPADVGGIQVGRKMTAYCQWCLKGNYRGADCGYSGAAMFTDEDQPTDDPSKDKCSGTLTGCTLRFGQNNQLPHGGFPAVRLIRK
>NZ_CP021980.1|WP_041946974.1|1908819_1909158_-|phage-tail-protein
MAIREFTYCADKEATGTASFRVRSASFGDGYTQKAGDGINGKRQTWPLSFTKKKTEAEAIKQFFDDHKGYQSFAWKPPLEPLGLYQVEEYTLLPLGAGMYRISATFTESFHP
>NZ_CP021980.1|WP_088717995.1|1909160_1912073_-|phage-tail-tape-measure-protein
MSGYLIAGELLMASRSLGNLTVNMVMNTGSFTEGAGRAEAAVGRLNKAAQKQREELARLVGQIDPVVAEYDRIDKMEEKLRKHRKAGSLDQSDYDLYLGKLNEMRKGVEKTSIEFGKNGKSAKEMQFALRGLPAQFTDIAVSLQGGQNPLTVFLQQGGQLKDMFGGIGPAAKAMGGYVAGLVNPFTIAASAAGVLALAYYQGSEEADRYRNAILLTGNASGVTADQLSQMAKRLDDISGTQRNAAKAISEVASSAKFSADQIELVSLAAVNMEMATGKAISDTIDEFKKLSDEPSKAIAELNKTQNFLTQSVYEQITALEKQGKQQQAATLAVKAYSDAINERTTEITNNLGYIERAWKAVKDGATEAWDGILNIGRSDTDSDVLADLNSQIENLQTGLKSYRSLLESGVKSSGYGAGKVDYEALVKNQEKQLKTLISQRDELSTKVQTQEEEASKQAEFNKLQQEAIKASEAINKVRMDGLSTDEKRNKAVKEYLANVEKIRLANPESALLNPEQIKKDIKAIEESFKESNKAISDSASQQMIMRLREQEATLSKQLENNAKLGAAQQELVKFEQQIADLKEKKTLTAQQKSLIADQELIREQLNKNVAIEQELSLRDQAIRIQNMQASVTAQLSSDIERYQSSLANFGAGDETLKRLKEEQAIRNDINKQLERATSRNLAGKTSNEELEAEKRMLEQSLQDRLSAQGQYYEQLDKLESDWKNGAKAAFDNYIYEASRAAKISEGLFNSAFSAMEDAILQFALTGKASFKDFAAAVVKDIARIASQQAAAGLLSYGVSLFASAYAGSSSGASTGLNNGFGQNAYDNISFGSGSFSSGGYTGSGGKNQPAGIVHRGEVVWSQDDIAKAGGVGVVEAMRKGLLNYKEGLKGYANGGVVGLNAPAISSMSSNQNVIIQQQINIPESQNASGGTADDQMIAKAYAESAKAGAKDQIAKELMPGGLIWRAQNGR
>NZ_CP021980.1|WP_157726749.1|1912085_1912247_-|hypothetical-protein
MFLIATINKTNLKPEDLKLYRLEEDQESPPEESVSVHDIFAAIKGVAKQNKPK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581091	Vibrio phage Cla, complete genome	47805-47850	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581096	Vibrio phage pVa-5, complete genome	47806-47851	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658673	Vibrio phage H2 PGK-2017, complete genome	40728-40773	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581093	Vibrio phage Pel, complete genome	47806-47851	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581097	Vibrio phage pVa-6, complete genome	47806-47851	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658677	Vibrio phage P3, complete genome	47821-47866	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581098	Vibrio phage VaK, complete genome	47795-47840	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658674	Vibrio phage H8, complete genome	40736-40781	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658676	Vibrio phage P2, complete genome	40728-40773	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581090	Vibrio phage Her, complete genome	47805-47850	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658678	Vibrio phage pVa-3, complete genome	48923-48968	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658679	Vibrio phage pVa-4, complete genome	48874-48919	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581092	Vibrio phage Len, complete genome	47805-47850	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581094	Vibrio phage pVa-2, complete genome	47805-47850	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658680	Vibrio phage pVa-8, complete genome	47806-47851	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KY658675	Vibrio phage H20, complete genome	47803-47848	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581095	Vibrio phage pVa-1, complete genome	47806-47851	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581099	Vibrio phage Strym, complete genome	47805-47850	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	KX581100	Vibrio phage pVa-7, complete genome	48847-48892	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	MK672804	Vibrio phage Va_178/90_p41, complete genome	48773-48818	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	MK672800	Vibrio phage Va_90-11-287_p41_Ba35, complete genome	23448-23493	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	MK672799	Vibrio phage Va_90-11-287_p41, complete genome	23448-23493	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	MK672803	Vibrio phage Va_91-7-154_p41, complete genome	4893-4938	1.0
NZ_CP021980_2	2.1\|1899727\|46\|NZ_CP021980\|CRISPRCasFinder	1899727-1899772	46	MK672801	Vibrio phage Va_90-11-287_p41_T265, complete genome	23448-23493	1.0

1. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581091 (Vibrio phage Cla, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

2. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581096 (Vibrio phage pVa-5, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

3. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658673 (Vibrio phage H2 PGK-2017, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

4. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581093 (Vibrio phage Pel, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

5. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581097 (Vibrio phage pVa-6, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

6. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658677 (Vibrio phage P3, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

7. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581098 (Vibrio phage VaK, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

8. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658674 (Vibrio phage H8, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

9. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658676 (Vibrio phage P2, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

10. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581090 (Vibrio phage Her, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

11. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658678 (Vibrio phage pVa-3, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

12. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658679 (Vibrio phage pVa-4, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

13. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581092 (Vibrio phage Len, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

14. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581094 (Vibrio phage pVa-2, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

15. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658680 (Vibrio phage pVa-8, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

16. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KY658675 (Vibrio phage H20, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

17. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581095 (Vibrio phage pVa-1, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

18. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581099 (Vibrio phage Strym, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

19. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to KX581100 (Vibrio phage pVa-7, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

20. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to MK672804 (Vibrio phage Va_178/90_p41, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

21. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to MK672800 (Vibrio phage Va_90-11-287_p41_Ba35, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

22. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to MK672799 (Vibrio phage Va_90-11-287_p41, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

23. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to MK672803 (Vibrio phage Va_91-7-154_p41, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

24. spacer 2.1|1899727|46|NZ_CP021980|CRISPRCasFinder matches to MK672801 (Vibrio phage Va_90-11-287_p41_T265, complete genome) position: , mismatch: 0, identity: 1.0

aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	CRISPR spacer
aagttcttttccggtaaccttatctactttcgtgttaagcgcattg	Protospacer
**********************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

103057 : 138240

Leptospira_phage(28.57%)

transposase,tRNA,integrase,protease

attL 135781:135796|attR 144365:144380

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011154650.1\|103057_104599_-\|transposase	IS66-like element ISVa5 family transposase	S5VTP8	Leptospira_phage	1.9e-24	38.9
WP_011154649.1\|104658_105012_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.6e-14	48.6
WP_011154648.1\|105008_105326_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_013855499.1\|105377_106520_-	hypothetical protein	NA	NA	NA	NA
WP_013855498.1\|106516_106822_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011154643.1\|106935_107856_+\|transposase	IS5-like element ISVa2 family transposase	A0A1V0E8E1	Vibrio_phage	1.7e-177	100.0
WP_040122926.1\|107852_109016_-	hypothetical protein	NA	NA	NA	NA
WP_013855495.1\|109587_109854_-	DUF1145 domain-containing protein	NA	NA	NA	NA
WP_029189861.1\|109850_110450_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_088717968.1\|110656_111835_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_010316903.1\|111897_112572_+	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	3.9e-14	27.8
WP_013855492.1\|112561_113530_+	cell division protein FtsX	NA	NA	NA	NA
WP_013855491.1\|113705_114563_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.5e-42	38.7
WP_010316900.1\|114958_115279_+	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_013855489.1\|115287_116121_+\|protease	rhomboid family intramembrane serine protease GlpG	NA	NA	NA	NA
WP_013855488.1\|116153_116561_-	flagellar basal body-associated protein FliL	NA	NA	NA	NA
WP_013855487.1\|116797_117352_+	chorismate lyase	NA	NA	NA	NA
WP_013855486.1\|117348_118203_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_013855485.1\|118263_120687_-	glycerol-3-phosphate 1-O-acyltransferase PlsB	NA	NA	NA	NA
WP_026028591.1\|121006_121630_+	repressor LexA	A5LH73	Enterobacteria_phage	2.0e-09	44.0
WP_013855483.1\|121724_122543_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_013855482.1\|122605_123949_+	MATE family efflux transporter DinF	NA	NA	NA	NA
WP_017048582.1\|124052_125453_-	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_017048583.1\|125739_126381_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_013855478.1\|126380_126758_+	YijD family membrane protein	NA	NA	NA	NA
WP_013855477.1\|126917_130019_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	3.4e-307	52.4
WP_013855475.1\|130472_130664_+	hypothetical protein	NA	NA	NA	NA
WP_029189859.1\|130703_131813_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA
WP_041769208.1\|132165_133575_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_013855472.1\|133579_136039_+	hypothetical protein	NA	NA	NA	NA
135781:135796	attL	NA	NA	NA	NA
WP_013855471.1\|136050_138240_+\|integrase	integrase	NA	NA	NA	NA
WP_013855471.1\|136050_138240_+\|integrase	integrase	NA	NA	NA	NA
144365:144380	attR	NA	NA	NA	NA

DBSCAN-SWA_2

415704 : 475807

Acidithiobacillus_phage(18.18%)

transposase,integrase,tRNA,protease

attL 408099:408114|attR 482330:482345

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
408099:408114	attL	NA	NA	NA	NA
WP_013857812.1\|415704_416205_-\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA
WP_029189916.1\|416272_417427_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.2e-125	60.5
WP_088717971.1\|417756_419766_+	transketolase	NA	NA	NA	NA
WP_088717972.1\|419829_420732_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_040122941.1\|420875_422831_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	1.7e-09	28.3
WP_026027970.1\|423030_424056_+	erythrose-4-phosphate dehydrogenase	NA	NA	NA	NA
WP_026027969.1\|424204_425368_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_013857804.1\|425521_426598_+	class II fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_026028483.1\|426894_427758_+	small-conductance mechanosensitive channel MscS	NA	NA	NA	NA
WP_013857802.1\|427832_428465_-	amino acid transporter	NA	NA	NA	NA
WP_013857801.1\|428587_429484_+	LysR family transcriptional regulator ArgP	NA	NA	NA	NA
WP_013857800.1\|429568_430279_+	oxidative stress defense protein	NA	NA	NA	NA
WP_013857799.1\|430444_432310_+	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
WP_026027602.1\|432413_433826_-	pyruvate kinase PykF	NA	NA	NA	NA
WP_013857797.1\|434250_435012_+	DeoR family transcriptional regulator	NA	NA	NA	NA
WP_013857796.1\|435099_436932_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HRE7	Paramecium_bursaria_Chlorella_virus	1.8e-130	44.4
WP_052131878.1\|437968_440371_+	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_013857792.1\|440465_442223_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_017043428.1\|442608_443022_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_013857791.1\|443325_443844_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_013857790.1\|443983_446080_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.9e-31	26.4
WP_013857789.1\|446079_446967_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_013857788.1\|446963_450224_+	hypothetical protein	NA	NA	NA	NA
WP_013857787.1\|450224_450953_+	hypothetical protein	NA	NA	NA	NA
WP_010318209.1\|451131_451416_+	type VI secretion system PAAR protein	NA	NA	NA	NA
WP_013857786.1\|451557_451854_+	Dabb family protein	NA	NA	NA	NA
WP_013857785.1\|452496_452973_+	hypothetical protein	NA	NA	NA	NA
WP_013857784.1\|453077_453452_+	hypothetical protein	NA	NA	NA	NA
WP_013857782.1\|453842_455063_+	hypothetical protein	NA	NA	NA	NA
WP_013857781.1\|455342_456137_+	hypothetical protein	NA	NA	NA	NA
WP_013857780.1\|456308_457220_+	DNA polymerase I	NA	NA	NA	NA
WP_013857779.1\|457216_458656_+	hypothetical protein	NA	NA	NA	NA
WP_088717973.1\|458648_459826_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.0e-116	63.8
WP_013857777.1\|460027_460561_+	hypothetical protein	NA	NA	NA	NA
WP_013857776.1\|460709_461264_+	hypothetical protein	NA	NA	NA	NA
WP_013857775.1\|461393_461666_+	hypothetical protein	NA	NA	NA	NA
WP_013857774.1\|461729_462857_-	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	2.8e-33	33.0
WP_013857773.1\|462849_463635_-	hypothetical protein	NA	NA	NA	NA
WP_013857767.1\|464788_465859_+	type II toxin-antitoxin system RnlA family toxin	NA	NA	NA	NA
WP_013857768.1\|465859_466225_+	type II toxin-antitoxin system RnlB family antitoxin	NA	NA	NA	NA
WP_013857769.1\|466265_467468_-\|integrase	site-specific integrase	Q7Y5X7	Haemophilus_phage	3.9e-17	32.8
WP_013857770.1\|467460_467850_-	hypothetical protein	NA	NA	NA	NA
WP_013857771.1\|468012_469035_+	hypothetical protein	NA	NA	NA	NA
WP_019281019.1\|468973_469558_+	hypothetical protein	NA	NA	NA	NA
WP_013857766.1\|470719_472087_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	1.9e-39	31.3
WP_013857765.1\|472565_473342_-	serine/threonine protein phosphatase	A0A285PXQ5	Cedratvirus	3.5e-11	27.9
WP_011988345.1\|473522_474263_-\|transposase	transposase	K4HZD4	Acidithiobacillus_phage	1.3e-47	42.7
WP_013857763.1\|474274_475807_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.9e-110	42.4
482330:482345	attR	NA	NA	NA	NA

DBSCAN-SWA_3

523784 : 531007

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010320454.1\|523784_524531_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.0e-68	54.5
WP_013857716.1\|524530_525157_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.0e-38	53.9
WP_013857715.1\|525156_526095_+	murein hydrolase activator NlpD	I3PV79	Clostridium_phage	6.0e-13	32.8
WP_017046716.1\|526167_527169_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	3.5e-35	34.8
WP_029189955.1\|527285_529874_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-36	21.2
WP_026027976.1\|530116_531007_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.5e-58	41.1

DBSCAN-SWA_4

648879 : 715203

Leptospira_phage(26.67%)

transposase,integrase,tRNA,protease

attL 689111:689128|attR 710094:710111

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013857623.1\|648879_650829_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	9.2e-117	43.9
WP_013857622.1\|650887_651718_+	dihydropteroate synthase	NA	NA	NA	NA
WP_013857621.1\|651740_653081_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_010318534.1\|653344_653680_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_013857619.1\|654131_654587_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_013857618.1\|654623_656111_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_013857617.1\|656135_658844_+	translation initiation factor IF-2	NA	NA	NA	NA
WP_026028089.1\|658949_659366_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_013857615.1\|659366_660317_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_010318921.1\|660426_660696_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_010318920.1\|661012_663139_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_013857614.1\|663228_664212_+	lipoprotein NlpI	NA	NA	NA	NA
WP_013857613.1\|664331_664742_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_026029105.1\|664782_666123_+	MATE family efflux transporter	NA	NA	NA	NA
WP_026028086.1\|666161_667040_-	U32 family peptidase	NA	NA	NA	NA
WP_013857610.1\|667056_668070_-	U32 family peptidase	Q6DW11	Phage_TP	1.9e-20	32.5
WP_026027438.1\|668171_670220_-	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
WP_013857608.1\|670926_671430_+	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	4.0e-16	30.4
WP_013857607.1\|671691_672096_+	DNA polymerase III subunit psi	NA	NA	NA	NA
WP_013857606.1\|672100_672547_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_013857605.1\|672609_674661_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	2.5e-16	34.4
WP_026028084.1\|674883_676473_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	5.7e-32	25.7
WP_013857603.1\|676574_677810_-	ATP-dependent RNA helicase SrmB	A0A1B1IS59	uncultured_Mediterranean_phage	6.6e-44	31.1
WP_013857602.1\|677902_678625_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_013857601.1\|678933_680247_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_096000859.1\|680417_681515_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	4.1e-05	41.4
WP_013857598.1\|681549_683082_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	7.3e-85	36.4
WP_013857597.1\|683344_684679_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_019281125.1\|685178_685430_+	hypothetical protein	NA	NA	NA	NA
WP_013857595.1\|685467_686502_-	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
WP_026028083.1\|686636_687302_-	DNA mismatch repair endonuclease MutH	NA	NA	NA	NA
WP_010319133.1\|687907_688426_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_013857593.1\|688428_690675_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.1e-12	27.4
689111:689128	attL	NA	NA	NA	NA
WP_013857592.1\|690683_691475_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_013857591.1\|691518_692322_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_013857590.1\|692337_692769_+	thymidylate synthase	H9EB68	Vibrio_phage	1.8e-49	83.6
WP_013857589.1\|692734_694954_+	hypothetical protein	NA	NA	NA	NA
WP_013857588.1\|694967_697094_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_019281128.1\|697086_697662_+	hypothetical protein	NA	NA	NA	NA
WP_013857586.1\|697670_699020_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_013857585.1\|699182_699476_-	diacylglycerol kinase	NA	NA	NA	NA
WP_013857584.1\|699565_701215_-	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
WP_013857583.1\|701594_702134_+	cytochrome b	NA	NA	NA	NA
WP_011154650.1\|702471_704013_-\|transposase	IS66-like element ISVa5 family transposase	S5VTP8	Leptospira_phage	1.9e-24	38.9
WP_011154649.1\|704072_704426_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.6e-14	48.6
WP_011154648.1\|704422_704740_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_029189905.1\|704830_705082_-	hypothetical protein	NA	NA	NA	NA
WP_019281129.1\|705421_705604_+	YegP family protein	NA	NA	NA	NA
WP_013857579.1\|706012_706222_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013857578.1\|706321_706867_+	hypothetical protein	NA	NA	NA	NA
WP_013857577.1\|706856_708176_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_013857575.1\|708437_708638_+	hypothetical protein	NA	NA	NA	NA
WP_013857574.1\|708634_708826_+	hypothetical protein	NA	NA	NA	NA
WP_080262247.1\|709024_709120_+	hypothetical protein	NA	NA	NA	NA
WP_080749052.1\|709303_710200_+	alpha/beta hydrolase	NA	NA	NA	NA
710094:710111	attR	NA	NA	NA	NA
WP_011154648.1\|710265_710583_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011154649.1\|710579_710933_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.6e-14	48.6
WP_011154650.1\|710992_712534_+\|transposase	IS66-like element ISVa5 family transposase	S5VTP8	Leptospira_phage	1.9e-24	38.9
WP_013857570.1\|712899_713406_+	hypothetical protein	NA	NA	NA	NA
WP_088717973.1\|714026_715203_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	8.0e-116	63.8

DBSCAN-SWA_5

795778 : 802849

Faustovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013857499.1\|795778_796993_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	2.4e-30	31.4
WP_010320409.1\|797049_797433_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.8e-53	78.2
WP_010320408.1\|797495_797819_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.6e-26	53.3
WP_026028094.1\|797885_798401_+	co-chaperone HscB	NA	NA	NA	NA
WP_013857497.1\|798422_800276_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.2e-111	41.4
WP_010320405.1\|800287_800626_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_013857496.1\|800676_800871_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_026028095.1\|801055_802351_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.1e-33	34.5
WP_013857494.1\|802423_802849_+	nucleoside-diphosphate kinase	K7YW26	Megavirus	2.7e-21	41.4

DBSCAN-SWA_6

1844150 : 1955027

125

Vibrio_phage(88.64%)

transposase,lysis,terminase,capsid,protease,portal,tRNA,head,tail,integrase

attL 1928711:1928726|attR 1955004:1955019

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010319624.1\|1844150_1844831_+\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
WP_013856628.1\|1845039_1845927_+	cytidine deaminase	NA	NA	NA	NA
WP_013856627.1\|1845985_1848760_-	EAL domain-containing protein	NA	NA	NA	NA
WP_013856626.1\|1849021_1850197_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_013856625.1\|1850264_1851560_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-13	45.2
WP_013856624.1\|1851681_1852329_-	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_013856623.1\|1852676_1853450_+	RelA/SpoT domain-containing protein	NA	NA	NA	NA
WP_010319630.1\|1853521_1853818_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.6e-12	40.0
WP_088717993.1\|1854239_1856627_-\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	7.3e-07	23.9
WP_017044058.1\|1856643_1857627_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	2.1e-37	38.7
WP_013856619.1\|1857842_1858325_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_019280933.1\|1858409_1859387_-	glycoporin	NA	NA	NA	NA
WP_013856615.1\|1860831_1861389_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_013856614.1\|1861435_1863268_-	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_026028128.1\|1863267_1863912_-	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_026028129.1\|1864393_1866757_+	DNA polymerase II	A0A0N7KVW0	Yellowstone_lake_phycodnavirus	8.2e-35	25.8
WP_013856611.1\|1866781_1867549_-	nucleotidyltransferase	NA	NA	NA	NA
WP_013856610.1\|1867683_1868250_+	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_010319022.1\|1868252_1868573_+	YciU family protein	NA	NA	NA	NA
WP_010319023.1\|1868671_1869016_-	ASCH domain-containing protein	NA	NA	NA	NA
WP_038148510.1\|1869264_1869978_+	histidine utilization repressor	NA	NA	NA	NA
WP_029189799.1\|1870105_1871320_+	imidazolonepropionase	NA	NA	NA	NA
WP_029189798.1\|1871312_1872326_+	formimidoylglutamase	NA	NA	NA	NA
WP_013856604.1\|1872403_1874101_+	urocanate hydratase	NA	NA	NA	NA
WP_013856603.1\|1874112_1875645_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.6e-87	38.8
WP_026027168.1\|1875754_1876480_+	DUF3581 domain-containing protein	NA	NA	NA	NA
WP_013856601.1\|1876621_1877113_-	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_013856600.1\|1877163_1880229_-	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_026028133.1\|1880474_1881164_+	DUF3334 family protein	NA	NA	NA	NA
WP_013856598.1\|1881291_1881975_+	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_020977740.1\|1882080_1883058_+	J domain-containing protein	NA	NA	NA	NA
WP_010319035.1\|1883230_1883413_+	hypothetical protein	NA	NA	NA	NA
WP_013856596.1\|1883742_1884141_+	50S ribosomal protein L7ae	NA	NA	NA	NA
WP_026028134.1\|1884263_1885466_-	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_026028135.1\|1885643_1887926_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_013856593.1\|1887981_1888626_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_019280929.1\|1889056_1889950_+	1-aminocyclopropane-1-carboxylate deaminase/D-cysteine desulfhydrase	NA	NA	NA	NA
WP_013856591.1\|1889978_1890233_+	YnjH family protein	NA	NA	NA	NA
WP_013856590.1\|1890244_1891762_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_013856589.1\|1891847_1893188_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.7e-11	32.5
WP_013856588.1\|1893184_1894219_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_088717994.1\|1894662_1895475_-	hypothetical protein	A0A1V0E892	Vibrio_phage	7.6e-158	100.0
WP_041946964.1\|1895477_1896428_-	hypothetical protein	A0A1V0E894	Vibrio_phage	2.0e-181	100.0
WP_041946965.1\|1896424_1896673_-	hypothetical protein	A0A1V0E877	Vibrio_phage	6.8e-41	100.0
WP_052131881.1\|1896669_1897281_-	hypothetical protein	A0A1V0E8A2	Vibrio_phage	3.5e-107	100.0
WP_041946966.1\|1897282_1897945_-	hypothetical protein	A0A1V0E868	Vibrio_phage	2.0e-119	100.0
WP_088718021.1\|1898032_1898509_-\|tail	phage tail protein	A0A1V0E872	Vibrio_phage	1.6e-86	100.0
WP_157726748.1\|1900201_1900366_-	hypothetical protein	A0A1V0E896	Vibrio_phage	1.2e-22	100.0
WP_041946968.1\|1900405_1901500_-	hypothetical protein	A0A1V0E897	Vibrio_phage	6.6e-213	100.0
WP_041946969.1\|1901496_1905027_-\|tail	phage tail protein	A0A1V0E886	Vibrio_phage	0.0e+00	100.0
WP_041946970.1\|1905036_1905636_-\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	1.2e-102	100.0
WP_041946971.1\|1905706_1906036_-	zinc ribbon domain-containing protein	A0A1V0E899	Vibrio_phage	2.1e-58	100.0
WP_041946972.1\|1907310_1908057_-	C40 family peptidase	A0A1V0E882	Vibrio_phage	8.9e-153	100.0
WP_041946973.1\|1908059_1908806_-\|tail	phage minor tail protein L	A0A1V0E876	Vibrio_phage	9.8e-144	100.0
WP_041946974.1\|1908819_1909158_-\|tail	phage tail protein	A0A1V0E890	Vibrio_phage	1.4e-60	100.0
WP_088717995.1\|1909160_1912073_-\|tail	phage tail tape measure protein	A0A1V0E821	Vibrio_phage	0.0e+00	100.0
WP_157726749.1\|1912085_1912247_-	hypothetical protein	A0A1V0E8A9	Vibrio_phage	4.5e-22	100.0
WP_052131885.1\|1912339_1912783_-	hypothetical protein	A0A1V0E823	Vibrio_phage	6.4e-74	100.0
WP_041946975.1\|1912793_1913270_-\|tail	tail protein	A0A1V0E8B3	Vibrio_phage	3.0e-85	100.0
WP_041946976.1\|1913365_1913734_-	DUF3168 domain-containing protein	A0A1V0E8A7	Vibrio_phage	9.6e-68	100.0
WP_041946977.1\|1913730_1914198_-	hypothetical protein	A0A1V0E895	Vibrio_phage	7.4e-81	100.0
WP_088717996.1\|1914199_1914568_-\|head,tail	head-tail adaptor protein	A0A1V0E8B6	Vibrio_phage	1.7e-64	100.0
WP_041946978.1\|1914567_1914876_-\|head,tail	phage gp6-like head-tail connector protein	A0A1V0E887	Vibrio_phage	1.2e-50	100.0
WP_041946980.1\|1915322_1916510_-\|capsid	phage major capsid protein	A0A1V0E898	Vibrio_phage	8.5e-198	100.0
WP_052131886.1\|1916512_1917385_-\|protease	Clp protease ClpP	A0A1V0E8B8	Vibrio_phage	1.0e-160	100.0
WP_041946981.1\|1917387_1918698_-\|portal	phage portal protein	A0A1V0E8B9	Vibrio_phage	2.7e-253	100.0
WP_041946982.1\|1918697_1918904_-	hypothetical protein	A0A1V0E8A8	Vibrio_phage	1.8e-18	98.0
WP_041946983.1\|1918900_1920619_-\|terminase	terminase large subunit	A0A1V0E8C2	Vibrio_phage	0.0e+00	100.0
WP_041946984.1\|1920615_1921089_-\|terminase	phage terminase small subunit P27 family	A0A1V0E8B7	Vibrio_phage	1.1e-87	100.0
WP_088717997.1\|1921095_1921455_-	HNH endonuclease	A0A1V0E8A5	Vibrio_phage	4.8e-64	100.0
WP_052131887.1\|1921454_1921796_-	hypothetical protein	A0A1V0E8K3	Vibrio_phage	9.0e-52	100.0
WP_041946986.1\|1922083_1922296_-	hypothetical protein	A0A1V0E8A4	Vibrio_phage	6.8e-34	100.0
WP_041946987.1\|1922843_1923320_-\|lysis	lysis protein	A0A1V0E843	Vibrio_phage	2.4e-71	99.3
WP_041946988.1\|1923838_1924030_-	hypothetical protein	A0A1V1FD92	Vibrio_phage	1.9e-19	100.0
WP_041946989.1\|1924150_1924819_-	hypothetical protein	A0A1V0E841	Vibrio_phage	1.5e-122	100.0
WP_041946990.1\|1925049_1925481_+	hypothetical protein	A0A1V0E842	Vibrio_phage	2.3e-81	100.0
WP_041946991.1\|1925477_1925675_+	hypothetical protein	A0A1V0E828	Vibrio_phage	6.8e-28	100.0
WP_144245244.1\|1925729_1926005_-	hypothetical protein	A0A1U9GY50	Vibrio_phage	1.3e-45	100.0
WP_041946993.1\|1926037_1927045_-	DUF968 domain-containing protein	A0A1V0E819	Vibrio_phage	1.3e-199	100.0
WP_041946994.1\|1927038_1927329_-	DUF4406 domain-containing protein	A0A1V0E824	Vibrio_phage	3.4e-52	100.0
WP_041946995.1\|1927337_1927580_-	hypothetical protein	A0A1V0E827	Vibrio_phage	3.7e-36	100.0
WP_041946996.1\|1927576_1928068_-	hypothetical protein	A0A1V0E852	Vibrio_phage	4.6e-89	100.0
WP_041946997.1\|1928060_1928390_-	hypothetical protein	A0A1V0E853	Vibrio_phage	4.9e-55	100.0
WP_041946998.1\|1928382_1928589_-	hypothetical protein	A0A1V0E836	Vibrio_phage	9.3e-28	100.0
WP_041946999.1\|1928578_1928791_-	hypothetical protein	A0A1V0E854	Vibrio_phage	1.2e-33	100.0
1928711:1928726	attL	NA	NA	NA	NA
WP_041947000.1\|1928790_1929030_-	hypothetical protein	A0A1V0E850	Vibrio_phage	4.2e-40	100.0
WP_041947001.1\|1929026_1929722_-	DNA-binding protein	A0A1V0E838	Vibrio_phage	4.7e-124	100.0
WP_041947056.1\|1929723_1929924_-	hypothetical protein	A0A1V0E856	Vibrio_phage	1.6e-24	100.0
WP_088717998.1\|1929937_1930360_-	hypothetical protein	A0A1V0E831	Vibrio_phage	7.2e-75	99.3
WP_088717999.1\|1930400_1930919_-	hypothetical protein	A0A1V0E8B1	Vibrio_phage	3.4e-66	100.0
WP_041947002.1\|1930911_1931199_-	hypothetical protein	A0A1V0E8C9	Vibrio_phage	9.2e-50	100.0
WP_052131890.1\|1931195_1931759_-	phage N-6-adenine-methyltransferase	A0A1V0E8C8	Vibrio_phage	6.1e-106	100.0
WP_041947003.1\|1931875_1932133_-	hypothetical protein	A0A1V0E8D3	Vibrio_phage	1.1e-38	100.0
WP_041947004.1\|1932178_1932388_-	helix-turn-helix transcriptional regulator	A0A1V0E8C7	Vibrio_phage	1.3e-32	100.0
WP_041947005.1\|1932499_1933171_+	helix-turn-helix domain-containing protein	A0A1V0E8B5	Vibrio_phage	5.4e-125	100.0
WP_041947006.1\|1933186_1933600_+	hypothetical protein	A0A1V0E8D6	Vibrio_phage	1.0e-73	100.0
WP_041947007.1\|1935094_1936090_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	2.3e-188	100.0
WP_041947008.1\|1936092_1936608_+	hypothetical protein	A0A1V0E8E0	Vibrio_phage	1.6e-97	100.0
WP_141195288.1\|1936613_1936865_+	hypothetical protein	A0A1V0E8D8	Vibrio_phage	7.1e-38	100.0
WP_041947010.1\|1936896_1937148_+	hypothetical protein	A0A1V0E8D1	Vibrio_phage	3.2e-38	100.0
WP_052131891.1\|1937144_1937729_+	hypothetical protein	A0A1V0E8E4	Vibrio_phage	7.8e-112	100.0
WP_041947011.1\|1937731_1937941_+	hypothetical protein	A0A1V0E8D5	Vibrio_phage	2.4e-31	100.0
WP_041947060.1\|1937960_1938803_+	hypothetical protein	A0A1V0E8C5	Vibrio_phage	4.8e-163	99.6
WP_041947012.1\|1938795_1939065_+	hypothetical protein	A0A1V0E8E7	Vibrio_phage	1.0e-42	100.0
WP_041947013.1\|1939098_1939587_+	hypothetical protein	A0A1V0E8C4	Vibrio_phage	8.2e-91	100.0
WP_041947014.1\|1939628_1940051_+	hypothetical protein	A0A1V0E8C3	Vibrio_phage	2.3e-73	100.0
WP_041947015.1\|1940083_1940446_+	hypothetical protein	A0A1V0E8D2	Vibrio_phage	1.2e-59	100.0
WP_011154643.1\|1941272_1942193_+\|transposase	IS5-like element ISVa2 family transposase	A0A1V0E8E1	Vibrio_phage	1.7e-177	100.0
WP_052131894.1\|1942433_1943126_+	hypothetical protein	A0A1V0E8E6	Vibrio_phage	8.0e-140	100.0
WP_041947016.1\|1943136_1943571_+	hypothetical protein	A0A1V0E8D7	Vibrio_phage	1.2e-80	100.0
WP_144245245.1\|1943563_1943809_+	hypothetical protein	A0A1V0E8F5	Vibrio_phage	4.6e-42	100.0
WP_041947018.1\|1943809_1944187_+	hypothetical protein	A0A1V0E8D4	Vibrio_phage	6.2e-70	100.0
WP_041947020.1\|1944861_1945257_+	hypothetical protein	A0A1V0E8D9	Vibrio_phage	2.4e-72	100.0
WP_041947021.1\|1945258_1945474_+	hypothetical protein	A0A1V0E8G0	Vibrio_phage	2.5e-23	100.0
WP_041947063.1\|1945529_1945781_+	hypothetical protein	A0A1V0E8F8	Vibrio_phage	3.4e-40	100.0
WP_041947022.1\|1945782_1946208_+	hypothetical protein	A0A1V0E8F1	Vibrio_phage	1.6e-74	100.0
WP_052131896.1\|1946283_1946580_+	hypothetical protein	A0A1V0E8G7	Vibrio_phage	2.3e-56	100.0
WP_041947024.1\|1946792_1946990_+	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	1.0e-28	100.0
WP_041947025.1\|1946986_1948225_-\|integrase	tyrosine-type recombinase/integrase	A0A1V0E8G8	Vibrio_phage	4.2e-240	100.0
WP_013856582.1\|1948801_1949251_-	L-alanine exporter AlaE	NA	NA	NA	NA
WP_013856581.1\|1949488_1951924_-	response regulator	A0A1V0SGX0	Hokovirus	4.0e-53	33.6
WP_013856580.1\|1952073_1952655_+	UPF0149 family protein	NA	NA	NA	NA
WP_011154648.1\|1952758_1953076_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011154649.1\|1953072_1953426_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.6e-14	48.6
WP_011154650.1\|1953485_1955027_+\|transposase	IS66-like element ISVa5 family transposase	S5VTP8	Leptospira_phage	1.9e-24	38.9
1955004:1955019	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2384360 : 2390984

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026027639.1\|2384360_2384831_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	8.4e-32	48.0
WP_013856195.1\|2385039_2386149_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	9.7e-63	39.3
WP_013856194.1\|2386237_2386894_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	5.1e-35	38.5
WP_013856193.1\|2386895_2387993_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	8.7e-48	36.8
WP_010320136.1\|2387999_2388449_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_013856192.1\|2388580_2389831_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	7.3e-99	48.7
WP_041769106.1\|2389844_2390984_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	7.6e-63	42.3

DBSCAN-SWA_8

2914990 : 2921909

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019281204.1\|2914990_2916331_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-10	24.4
WP_013855749.1\|2916345_2917152_-	ABC transporter permease	NA	NA	NA	NA
WP_013855748.1\|2917308_2917854_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.5e-53	57.5
WP_013855747.1\|2917856_2918744_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.9e-37	35.7
WP_013855746.1\|2918740_2919619_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	4.9e-110	67.9
WP_013855745.1\|2919642_2920707_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-102	54.6
WP_013855744.1\|2920967_2921909_+	ADP-glyceromanno-heptose 6-epimerase	E3SL51	Synechococcus_phage	4.3e-35	36.8

DBSCAN-SWA_9

2947330 : 3007307

Leptospira_phage(26.67%)

transposase,integrase

attL 2967563:2967622|attR 3016746:3019126

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019281199.1\|2947330_2948548_+\|integrase	site-specific integrase	A0A1W6JPG6	Morganella_phage	4.6e-66	36.7
WP_088717981.1\|2949506_2950684_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.4e-115	64.5
WP_019281377.1\|2950827_2952804_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_019281376.1\|2952790_2953147_-	hypothetical protein	NA	NA	NA	NA
WP_019281375.1\|2953158_2953548_-	hypothetical protein	NA	NA	NA	NA
WP_019281374.1\|2954357_2955065_-	replication protein P	B5WZY0	Pseudomonas_phage	2.4e-38	41.2
WP_019281373.1\|2955066_2955804_-	hypothetical protein	A0A1J0GVN3	Pseudoalteromonas_phage	2.0e-08	34.5
WP_019281370.1\|2956442_2957012_-	hypothetical protein	NA	NA	NA	NA
WP_019281369.1\|2957389_2957974_+	hypothetical protein	NA	NA	NA	NA
WP_041947035.1\|2958036_2958432_+	hypothetical protein	NA	NA	NA	NA
WP_019281367.1\|2958428_2960540_+	hypothetical protein	NA	NA	NA	NA
WP_017789524.1\|2960693_2960942_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017789525.1\|2960928_2961162_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_011154648.1\|2961650_2961968_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_011154649.1\|2961964_2962318_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.6e-14	48.6
WP_011154650.1\|2962377_2963919_+\|transposase	IS66-like element ISVa5 family transposase	S5VTP8	Leptospira_phage	1.9e-24	38.9
WP_019281366.1\|2964065_2964800_+	peptidase	NA	NA	NA	NA
2967563:2967622	attL	NA	NA	NA	NA
WP_011154650.1\|2967594_2969136_-\|transposase	IS66-like element ISVa5 family transposase	S5VTP8	Leptospira_phage	1.9e-24	38.9
WP_011154649.1\|2969195_2969549_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.6e-14	48.6
WP_011154648.1\|2969545_2969863_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_040122743.1\|2971622_2973095_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	9.1e-133	52.6
WP_013855705.1\|2973530_2976419_-	hypothetical protein	NA	NA	NA	NA
WP_013855704.1\|2976756_2979549_-	insulinase family protein	NA	NA	NA	NA
WP_011154643.1\|2979644_2980565_+\|transposase	IS5-like element ISVa2 family transposase	A0A1V0E8E1	Vibrio_phage	1.7e-177	100.0
WP_013855702.1\|2981472_2983440_-	Fe(3+)-hydroxamate ABC transporter permease FhuB	NA	NA	NA	NA
WP_013855701.1\|2983436_2984363_-	iron-siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029190000.1\|2984353_2985139_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.7e-09	25.2
WP_013855699.1\|2985244_2987341_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_013855698.1\|2987484_2989317_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-29	27.5
WP_013855697.1\|2989460_2990909_-	PTS N-acetylmuramic acid transporter subunit IIBC	NA	NA	NA	NA
WP_013855696.1\|2990938_2991841_-	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_013855695.1\|2992082_2992931_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_088718015.1\|2992936_2993314_-	hypothetical protein	NA	NA	NA	NA
WP_013855693.1\|2993389_2993692_-	DUF3630 family protein	NA	NA	NA	NA
WP_041768992.1\|2993684_2995523_-	ATP-dependent DNA helicase RecQ	J2YAJ8	Acanthamoeba_polyphaga_lentillevirus	1.2e-81	36.1
WP_013855691.1\|2995774_2996692_+	EamA family transporter RarD	NA	NA	NA	NA
WP_013855690.1\|2996803_2997619_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_013855687.1\|2999134_3001309_-	DNA helicase II	A7KV33	Bacillus_phage	7.9e-117	37.2
WP_013855686.1\|3001465_3003508_-	oligopeptidase A	A0A1V0SD92	Indivirus	2.1e-42	22.7
WP_013855685.1\|3003713_3004553_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_013855683.1\|3004651_3006016_+	glutathione-disulfide reductase	NA	NA	NA	NA
WP_013855682.1\|3006092_3007307_+\|integrase	site-specific integrase	NA	NA	NA	NA
3016746:3019126	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP021981

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP021980

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection