CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022131	Lactobacillus pentosus strain SLC13 plasmid pSLC13, complete sequence	0 crisprs	NA	0	0	6	0
NZ_CP022130	Lactobacillus pentosus strain SLC13 chromosome, complete genome	4 crisprs	cas3,cas6e,cas5,cas7,cse2gr11,cas8e,DEDDh,cas1,DinG,csa3,WYL,cas14j	0	72	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4296

Staphylococcus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025025373.1\|1651_2323_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_088771309.1\|2327_3575_-	ABC transporter permease	NA	NA	NA	NA
WP_003581836.1\|3552_4296_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-27	33.5

DBSCAN-SWA_2

11119 : 13668

Planktothrix_phage(50.0%)

integrase

attL 4537:4551|attR 20117:20131

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4537:4551	attL	NA	NA	NA	NA
WP_046811108.1\|11119_11800_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-33	38.4
WP_001748272.1\|12369_12726_-	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_003586674.1\|12725_13004_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_088771312.1\|13080_13668_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	6.3e-21	33.7
20117:20131	attR	NA	NA	NA	NA

DBSCAN-SWA_3

17509 : 20314

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088771316.1\|17509_20314_-	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	5.3e-73	27.7

DBSCAN-SWA_4

23318 : 25254

Paenibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157686025.1\|23318_23933_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	5.3e-26	35.1
WP_088771317.1\|24032_24497_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_088771318.1\|24510_25254_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.8e-20	31.7

DBSCAN-SWA_5

32367 : 43167

Enterococcus_phage(28.57%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011669002.1\|32367_33153_+	ParA family protein	A0A1X9I765	Streptococcus_phage	5.9e-38	37.2
WP_011669001.1\|33156_33396_+	hypothetical protein	NA	NA	NA	NA
WP_088771322.1\|33706_34636_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.1e-24	34.8
WP_157686026.1\|35141_35888_+\|transposase	IS3 family transposase	Q716C2	Shigella_phage	6.6e-15	29.0
WP_020923860.1\|36015_36966_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	9.4e-99	54.6
WP_088771325.1\|36980_37907_-	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	1.3e-36	31.7
WP_057704821.1\|38013_40161_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	6.1e-255	60.3
WP_072533468.1\|40188_40647_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	NA	NA	NA	NA
WP_021353390.1\|41200_41290_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_020923829.1\|42612_43167_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1

DBSCAN-SWA_6

50719 : 60709

Staphylococcus_prophage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088771328.1\|50719_51640_+\|transposase	IS30-like element ISLsa1 family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-50	37.9
WP_088771329.1\|51933_52545_+	recombinase family protein	A0A219YA40	Aeromonas_phage	1.2e-17	35.0
WP_015639648.1\|52644_54681_+	KUP/HAK/KT family potassium transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	3.0e-62	33.2
WP_056986434.1\|55064_55502_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_088771330.1\|56016_56667_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	7.3e-18	31.7
WP_056986431.1\|57416_57632_+\|transposase	transposase	A0A1S5SBP9	Streptococcus_phage	1.8e-05	49.1
WP_088771332.1\|57751_58669_-	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_020923853.1\|58676_59516_-	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_027822877.1\|59515_60709_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.9e-29	36.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022130_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022130_1

299298-300363

TypeI-E

Consensus_repeat	Method
CTATTCCCCGTGTATGCGGGGGTGATCCT	CRISPRCasFinder
CTATTCCCCGTGTATGCGGGGGTGATCCT	CRT
CTATTCCCCGTGTATGCGGGGGTGATCC	PILER-CR

17 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e,DEDDh,cas1

The CRISPR arrays of NZ_CP022130_1

>merge|NZ_CP022130|1|299298-300363|CRISPRCasFinder,CRT,PILER-CR
CTATTCCCCGTGTATGCGGGGGTGATCCCATTCGAAGTGGCTGCAGGGCAATCTAAACTCACTATTCCCCGTGTATGCGGGGGTGATCCTATAACTTTTTAACTACTAGCGGTTATCAGAGTCTATTCCCCGTGTATGCGGGGGTGATCCTGTAATCGTCAGCTTTATCTTGACTAATGTCGACTATTCCCCGTGTATGCGGGGGTGATCCTTATCAAGAAATCCACTAATTACTTGCATTGGGCTATTCCCCGTGTATGCGGGGGTGATCCTCAGCCAATCAGACATTAACAACATTATCAAAGCTATTCCCCGTGTATGCGGGGGTGATCCTCAATTTCAGAAAACGAATCTTCATCTGAAATGCTATTCCCCGTGTATGCGGGGGTGATCCTAATCAGCGAATTCAGATAATTCCCTATCACTGCTATTCCCCGTGTATGCGGGGGTGATCCTTTCCGAATCCTTTTTATCGGCAATTAATACGCCTATTCCCCGTGTATGCGGGGGTGATCCTAACGGTGTGAAATTCGTTAAAGATACACCATACTATTCCCCGTGTATGCGGGGGTGATCCTATCTGATCCCTCGAACAATGTATCGATGTCACCTATTCCCCGTGTATGCGGGGGTGATCCTGATAACTGGGACATGCCATCAAATACAACTTTCTATTCCCCGTGTATGCGGGGGTGATCCTAACGATCTAGATGCAGCCGTTGCTGATCGTTTCTATTCCCCGTGTATGCGGGGGTGATCCTACTTCCGGCGCTGACATTGCCGGCGGGTAGGCCTATTCCCCGTGTATGCGGGGGTGATCCAAAGGTGCTTCGCTAAGTCAAGCAGTTGTCTTGCTATTCCCCGTGTATGCGGGGGTGATCCCGAAGAGATTCGAAAGCAAAATGCGGCTCAGGCCTATTCCCCGTGTATGCGGGGGTGATCCCTATTCCTTGGGCGATTTTATCCGTGGAATTTACTATTCCCCGTGTATACGGGGGTGATCCTATATGCATGTATGTGCCGAACAGTTTTGCAAACTATTCCCCGTGCATACGGGGGCAGTCTT

>NZ_CP022130|1|1|299298-300363|CRISPRCasFinder
CTATTCCCCGTGTATGCGGGGGTGATCCC	ATTCGAAGTGGCTGCAGGGCAATCTAAACTCA
CTATTCCCCGTGTATGCGGGGGTGATCCT	ATAACTTTTTAACTACTAGCGGTTATCAGAGT
CTATTCCCCGTGTATGCGGGGGTGATCCT	GTAATCGTCAGCTTTATCTTGACTAATGTCGA
CTATTCCCCGTGTATGCGGGGGTGATCCT	TATCAAGAAATCCACTAATTACTTGCATTGGG
CTATTCCCCGTGTATGCGGGGGTGATCCT	CAGCCAATCAGACATTAACAACATTATCAAAG
CTATTCCCCGTGTATGCGGGGGTGATCCT	CAATTTCAGAAAACGAATCTTCATCTGAAATG
CTATTCCCCGTGTATGCGGGGGTGATCCT	AATCAGCGAATTCAGATAATTCCCTATCACTG
CTATTCCCCGTGTATGCGGGGGTGATCCT	TTCCGAATCCTTTTTATCGGCAATTAATACGC
CTATTCCCCGTGTATGCGGGGGTGATCCT	AACGGTGTGAAATTCGTTAAAGATACACCATA
CTATTCCCCGTGTATGCGGGGGTGATCCT	ATCTGATCCCTCGAACAATGTATCGATGTCAC
CTATTCCCCGTGTATGCGGGGGTGATCCT	GATAACTGGGACATGCCATCAAATACAACTTT
CTATTCCCCGTGTATGCGGGGGTGATCCT	AACGATCTAGATGCAGCCGTTGCTGATCGTTT
CTATTCCCCGTGTATGCGGGGGTGATCCT	ACTTCCGGCGCTGACATTGCCGGCGGGTAGGC
CTATTCCCCGTGTATGCGGGGGTGATCCA	AAGGTGCTTCGCTAAGTCAAGCAGTTGTCTTG
CTATTCCCCGTGTATGCGGGGGTGATCCC	GAAGAGATTCGAAAGCAAAATGCGGCTCAGGC
CTATTCCCCGTGTATGCGGGGGTGATCCC	TATTCCTTGGGCGATTTTATCCGTGGAATTTA
CTATTCCCCGTGTATACGGGGGTGATCCT	ATATGCATGTATGTGCCGAACAGTTTTGCAAA
CTATTCCCCGTGCATACGGGGGCAGTCTT

>NZ_CP022130|1|1|299298-300363|CRT
CTATTCCCCGTGTATGCGGGGGTGATCCC	ATTCGAAGTGGCTGCAGGGCAATCTAAACTCA
CTATTCCCCGTGTATGCGGGGGTGATCCT	ATAACTTTTTAACTACTAGCGGTTATCAGAGT
CTATTCCCCGTGTATGCGGGGGTGATCCT	GTAATCGTCAGCTTTATCTTGACTAATGTCGA
CTATTCCCCGTGTATGCGGGGGTGATCCT	TATCAAGAAATCCACTAATTACTTGCATTGGG
CTATTCCCCGTGTATGCGGGGGTGATCCT	CAGCCAATCAGACATTAACAACATTATCAAAG
CTATTCCCCGTGTATGCGGGGGTGATCCT	CAATTTCAGAAAACGAATCTTCATCTGAAATG
CTATTCCCCGTGTATGCGGGGGTGATCCT	AATCAGCGAATTCAGATAATTCCCTATCACTG
CTATTCCCCGTGTATGCGGGGGTGATCCT	TTCCGAATCCTTTTTATCGGCAATTAATACGC
CTATTCCCCGTGTATGCGGGGGTGATCCT	AACGGTGTGAAATTCGTTAAAGATACACCATA
CTATTCCCCGTGTATGCGGGGGTGATCCT	ATCTGATCCCTCGAACAATGTATCGATGTCAC
CTATTCCCCGTGTATGCGGGGGTGATCCT	GATAACTGGGACATGCCATCAAATACAACTTT
CTATTCCCCGTGTATGCGGGGGTGATCCT	AACGATCTAGATGCAGCCGTTGCTGATCGTTT
CTATTCCCCGTGTATGCGGGGGTGATCCT	ACTTCCGGCGCTGACATTGCCGGCGGGTAGGC
CTATTCCCCGTGTATGCGGGGGTGATCCA	AAGGTGCTTCGCTAAGTCAAGCAGTTGTCTTG
CTATTCCCCGTGTATGCGGGGGTGATCCC	GAAGAGATTCGAAAGCAAAATGCGGCTCAGGC
CTATTCCCCGTGTATGCGGGGGTGATCCC	TATTCCTTGGGCGATTTTATCCGTGGAATTTA
CTATTCCCCGTGTATACGGGGGTGATCCT	ATATGCATGTATGTGCCGAACAGTTTTGCAAA
CTATTCCCCGTGCATACGGGGGCAGTCTT

>NZ_CP022130|1|1|299603-300301|PILER-CR
CTATTCCCCGTGTATGCGGGGGTGATCC	TCAATTTCAGAAAACGAATCTTCATCTGAAATG
CTATTCCCCGTGTATGCGGGGGTGATCC	TAATCAGCGAATTCAGATAATTCCCTATCACTG
CTATTCCCCGTGTATGCGGGGGTGATCC	TTTCCGAATCCTTTTTATCGGCAATTAATACGC
CTATTCCCCGTGTATGCGGGGGTGATCC	TAACGGTGTGAAATTCGTTAAAGATACACCATA
CTATTCCCCGTGTATGCGGGGGTGATCC	TATCTGATCCCTCGAACAATGTATCGATGTCAC
CTATTCCCCGTGTATGCGGGGGTGATCC	TGATAACTGGGACATGCCATCAAATACAACTTT
CTATTCCCCGTGTATGCGGGGGTGATCC	TAACGATCTAGATGCAGCCGTTGCTGATCGTTT
CTATTCCCCGTGTATGCGGGGGTGATCC	TACTTCCGGCGCTGACATTGCCGGCGGGTAGGC
CTATTCCCCGTGTATGCGGGGGTGATCC	AAAGGTGCTTCGCTAAGTCAAGCAGTTGTCTTG
CTATTCCCCGTGTATGCGGGGGTGATCC	CGAAGAGATTCGAAAGCAAAATGCGGCTCAGGC
CTATTCCCCGTGTATGCGGGGGTGATCC	CTATTCCTTGGGCGATTTTATCCGTGGAATTTA
CTATTCCCCGTGTATACGGGGGTGATCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022130.1\|WP_088769636.1\|301470_302424_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP022130.1\|WP_088769638.1\|305949_306699_-\|aspartate/glutamate-racemase-family-protein	unknown	unknown	gnl\|CDD\|376478
NZ_CP022130.1\|WP_088769630.1\|291209_291878_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
NZ_CP022130.1\|WP_088769637.1\|305203_305671_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_050338821.1\|289257_289740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_088769632.1\|292583_293663_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP022130.1\|WP_003638526.1\|307383_307578_-\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
NZ_CP022130.1\|WP_056952390.1\|308342_310307_-\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234752
NZ_CP022130.1\|WP_088769631.1\|291877_292603_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187886
NZ_CP022130.1\|WP_088771255.1\|311578_313015_-\|DnaD-domain-protein	unknown	unknown	gnl\|CDD\|226138
NZ_CP022130.1\|WP_050338825.1\|293662_294274_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP022130.1\|WP_050338820.1\|287897_288428_-\|YqeG-family-HAD-IIIA-type-phosphatase	unknown	unknown	gnl\|CDD\|225090
NZ_CP022130.1\|WP_088769634.1\|296019_298767_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP022130.1\|WP_088769639.1\|310639_311575_-\|primosomal-protein-DnaI	unknown	unknown	gnl\|CDD\|236353
NZ_CP022130.1\|WP_088769635.1\|300574_301474_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP022130.1\|WP_050338819.1\|286764_287901_-\|ribosome-biogenesis-GTPase-YqeH	unknown	unknown	gnl\|CDD\|237511
NZ_CP022130.1\|WP_088769633.1\|294263_296015_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP022130.1\|WP_031267356.1\|307599_308121_-\|translation-initiation-factor-IF-3	unknown	unknown	gnl\|CDD\|234582
NZ_CP022130.1\|WP_003638540.1\|286363_286678_-\|ribosome-assembly-RNA-binding-protein-YhbY	unknown	unknown	gnl\|CDD\|198171
NZ_CP022130.1\|WP_003638527.1\|306990_307347_-\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959

Protein	Function_ID	Function_description	E-value
NZ_CP022130.1\|WP_088769636.1\|301470_302424_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.64331e-131
NZ_CP022130.1\|WP_088769638.1\|305949_306699_-\|aspartate/glutamate-racemase-family-protein	gnl\|CDD\|376478	pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase. This family contains aspartate racemase, maleate isomerases EC:5.2.1.1, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase EC:4.1.1.76.	1.14382e-62
NZ_CP022130.1\|WP_088769630.1\|291209_291878_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	3.28944e-71
NZ_CP022130.1\|WP_088771255.1\|311578_313015_-\|DnaD-domain-protein	gnl\|CDD\|226138	COG3611, DnaB, Replication initiation/membrane attachment protein [DNA replication, recombination, and repair].	1.55356e-40
NZ_CP022130.1\|WP_088769632.1\|292583_293663_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	4.47866e-153
NZ_CP022130.1\|WP_003638526.1\|307383_307578_-\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	1.32915e-16
NZ_CP022130.1\|WP_056952390.1\|308342_310307_-\|threonine--tRNA-ligase	gnl\|CDD\|234752	PRK00413, thrS, threonyl-tRNA synthetase; Reviewed.	0
NZ_CP022130.1\|WP_088769631.1\|291877_292603_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	9.45533e-46
NZ_CP022130.1\|WP_050338825.1\|293662_294274_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.33977e-25
NZ_CP022130.1\|WP_050338820.1\|287897_288428_-\|YqeG-family-HAD-IIIA-type-phosphatase	gnl\|CDD\|225090	COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only].	2.45587e-66
NZ_CP022130.1\|WP_088769634.1\|296019_298767_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.00397e-81
NZ_CP022130.1\|WP_088769639.1\|310639_311575_-\|primosomal-protein-DnaI	gnl\|CDD\|236353	PRK08939, PRK08939, primosomal protein DnaI; Reviewed.	4.83494e-169
NZ_CP022130.1\|WP_088769635.1\|300574_301474_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	4.40134e-41
NZ_CP022130.1\|WP_050338819.1\|286764_287901_-\|ribosome-biogenesis-GTPase-YqeH	gnl\|CDD\|237511	PRK13796, PRK13796, GTPase YqeH; Provisional.	0
NZ_CP022130.1\|WP_088769633.1\|294263_296015_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.10474e-84
NZ_CP022130.1\|WP_031267356.1\|307599_308121_-\|translation-initiation-factor-IF-3	gnl\|CDD\|234582	PRK00028, infC, translation initiation factor IF-3; Reviewed.	8.45395e-91
NZ_CP022130.1\|WP_003638540.1\|286363_286678_-\|ribosome-assembly-RNA-binding-protein-YhbY	gnl\|CDD\|198171	smart01103, CRS1_YhbY, Escherichia coli YhbY is associated with pre-50S ribosomal subunits, which implies a function in ribosome assembly. GFP fused to a single-domain CRM protein from maize localises to the nucleolus, suggesting that an analogous activity may have been retained in plants. A CRM domain containing protein in plant chloroplasts has been shown to function in group I and II intron splicing. In vitro experiments with an isolated maize CRM domain have shown it to have RNA binding activity. These and other results suggest that the CRM domain evolved in the context of ribosome function prior to the divergence of Archaea and Bacteria, that this function has been maintained in extant prokaryotes, and that the domain was recruited to serve as an RNA binding module during the evolution of plant genomes. YhbY has a fold similar to that of the C-terminal domain of translation initiation factor 3 (IF3C), which binds to 16S rRNA in the 30S ribosome.	7.0603e-30
NZ_CP022130.1\|WP_003638527.1\|306990_307347_-\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	2.65787e-62

>NZ_CP022130.1|WP_088769634.1|296019_298767_-|CRISPR-associated-helicase/endonuclease-Cas3
MAEFSRLAQSLWAKKRSSDGQRLWLPLIVHLKDCENTINWLFNHWLSDGQRQQLAAATSEEDVQKLVKFLGFIHDCGKATPAFQMKPAYNGDNQLDQILIEQLMRSGFKDLDVLNLSSAQRSPHALAGEAILTAYGVDPTIGVIIGGHHGKPESEPPVHQIRDYTANYFQSDNRPELQVEWQQVQRELVEYGLHSAGYQSATEIPAINQPEAVILTGLLIMADWLASSECFDGDASKPLFPLVNTAQSVETIDVQTRFQRAIMAWRLDDEWVPAPLSQDQDPYQLRWGFHARPVQAAITRALGATTDPGMAIIEAPMGLGKTEIALIAVEQLARMTGRDGVYMGLPTQATTNAMFARVNDWLASVADEQEAHLSIKLMHGKSQFNRTYTALPNASNVNSTDEHHGAVTLNSWFSGKKSILTKFTVGTIDNLLLMGLKQKHLFLRHLGFSGKVVVIDEVHAYDAYMNAYLLRAIEWLGAYHVPIVILSATLPKIKRNQLLKAYLKGKYGRKFHQLLKLAPAGWEDTKAYPLLSVLDGPEIKQVTHFEGQSDQAPLTLAVERTNQDDQDLVATLLAQLDAGGVAGIIVNTVKRAQALAALIPADVPLMVLHSAFLAPDRAQQEEKLQAAIGKHGQRPAKLVVIGTQVLEQSLDIDFDVLYTDIAPIDLILQRAGRLHRHQTITRPKQFRQPQLKVMGINDFGDYGDGNEAVYGKYLLMKTDHFLPDKIQLPGDISTLVQRVYDAATDAEVPEIESAAEKFETDLKAEQQKAGVFQVKAPQLKQGKTLHGWLDRDHTDVVNDQQASAAVRDIQETLEVILVQHTTDGDFLLDGRKLAEVASAAIAQQTLRIPAAITPNITAAITELEDLTRPYHLRWQDDVWLNGALVLPLDQNLTATFNGWQVSYSPQLGLSYSKEE
>NZ_CP022130.1|WP_088769633.1|294263_296015_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MEKTFNLTTEPWIEVIDAQTNQQVSVSLIELFQNAQNYRQLAGDMRTQDLAVLRLLLAILTTVYTRYDADNQGYEWLTIADDFKVVSVDEDYDSDEIHDDLKKTWQDLYEGGQFTTIVTDYLKQYANRFDLFGDQPFYQVTASEYDAVVPENKSVAHGQKTGKPTGLVAIRQMNRRISESGNSVALFAPKVNETKNDLTHAELARWLIMYQNYTGVTDKTKIESDETFSNGAGWLYQLNPVYANGRSLFEILMLNLILVPMDEDVRYLVQRPVWEYTGLADYLKERRRKLVPDNLAALYTTWSRLLHIEWDDQQRPLIFTAGIPMFDNVGALIEPMTLWRQDKKTSQFKPAVASIKYTGKAMWRNFGQYVNVNRRDDIHEAGIVTWLHYLKAQGLVPDEQQLWLASTALLNDGNMSSQMPATEVYDDMQIQADVLFDESSADYWPVRIEDAINITQKIGDGYYRFAATIGQIRNIDAKQFGQRHSAQFYAELNRPFKAWLASLTGNDDREAKINEWKQTLQTITLQAANTMMATSSSRDVRGIVDHDKNNVPRQINVFTANNQLRRLVFTQLKGKQVKVADEK
>NZ_CP022130.1|WP_050338825.1|293662_294274_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MKNKIQKVTASIIRQLYNHGNLNKGVLASVRHATVLNSPQAQALWPIMMAELDDEMLSRDGRPTAAEVAVYTAVRFYAIQQQGSEVLVYGPANSQTDDTEKGIPLFQALAKLRRNEETRVALDRRMQPLLATTNVASAINALTHLVSMLKAANQQQKIDYARLAQDLYWLQQSYERASQVRLQWGQQYYRPQDATEKPEGKKN
>NZ_CP022130.1|WP_088769632.1|292583_293663_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTNNLYLDIHVIQTVPSSNINRDDTGAPKTALYGGVSRSRVSSQSWKRAVRRSFQDDTVTVGYRTKTAAQLLKDALQKLTPDLSDDDAWEQVNAVFKAASVKLDKNEETSALLMVSPGQIDQLAQYVKDNADGELDKKAIKAVLKGNQSIDLALFGRMVADNPELNVEAAAQVAHAISTHEVVPEFDYFTALDDLQPDDTTGAAMLGTLEFNSATLYRYANINMNDLIENLGETAAVDGAREFVKAFVLSMPTGKQNTFANKTLPSYVMLTLRTDTPVNLVSGFEDPVTSKQGYVKQSIEKLNAAYKQTLQFVEKPVLNVALGADASAIATPAEDLTDLLGQVTTELTKVVKDENGND
>NZ_CP022130.1|WP_088769631.1|291877_292603_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTVTIRLTAPLQSYGDEADFDRRTSYDYPSKSAIVGLIAAALGYRRTDSRIQTLNQLDYAVRIDQPAEPLTDFQIVEWKRGKRKLTYRDYLQDAVFLAAVGSEDDALIDRIDWALHHPRFQLSLGRRANVPAGPIMTEIALGSNPAQVLQSLSWHASRFYMKKTKSPTFVAELIADAALLPNHRSSMVKDNVITFDQRERQYGFRAVAFDRVPLENPYHPDRTAETDHDMMTFLWKEDQR
>NZ_CP022130.1|WP_088769630.1|291209_291878_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDRDNRYKTRDLTHLGAYHNWVEQSFPEEIENNQRGRHLWRIDRLNGQDYLLVLSADRPKLEQLEQYGVEETAITKSYDTWLDHIEAGMVLRFRLTANPTHSIIEPNHPKGRVVPHVTIEQQKQWLADRALRAGFELVARTNTPADETEKLAFDVVSHDWPTLHRRKGRSVRLSRVTFEGVLRVQNADTFKQTLTKGLGREKAFGMGLMTVIPTE
>NZ_CP022130.1|WP_050338821.1|289257_289740_+|hypothetical-protein
MEKKDVMKQYVTDKYFSKGHWWTKIWQTIVAIVAWICVAVPVYWTISSTLLANNPRFIHAWKYEEGKTLFYFFDRFFIFAFILIAIIVIISTIHNNHRVKQHISKERQYDEERLDVRKRRLNNFYTQRFGQATFRQHVKHYTVDPEQNLDVNEIHKLYED
>NZ_CP022130.1|WP_050338820.1|287897_288428_-|YqeG-family-HAD-IIIA-type-phosphatase
MINQFKPTWMIPAIYNVTPAQLRAQGIKAVFTDLDNTLIAWDNPDGTPELKKWLHALQDAGIPLVVVSNNSEARIAKALEQLDLPFVSRSLKPLPIGLNKARHDLGLHKNEVVMVGDQYITDMWSAHLAGVPSILVKPIVTTDAWNTRINRFFERFIKLRLAHVYPEMHFQEDLNK
>NZ_CP022130.1|WP_050338819.1|286764_287901_-|ribosome-biogenesis-GTPase-YqeH
MSETSEETLYCIGCGAAIQTTDPKAAGYTPNSALQKSLASDAQDLYCQRCFRLRHYNEIVPVGLTDDDFRRLLATIRDANALVVYVVDIFDLNGSIIPGLQRFVGDNPVLLVGNKEDVLPRQLRRTKLREWMNQQVRAQGIKPVDVALTSAKKGHAIDDLLAMIEKYRRGRDVYVVGVTNVGKSTLINRIIANNTGLKDLITTSRFPGTTLDKIEIPLDDGHKMVDTPGIIHPEQMAHVLSGDDLKLVSPQKEIRPKGFQLGNGQTLFLGGVARLDIVDTLKPTGTVYVDNNLTLHRTRTENADNFYTKHVGELITPPTGAAVADFPPLVRHEFKVTETSDIVFEGLGWVTVAADTRVAGWAPKGVAVLTRPAMINKR
>NZ_CP022130.1|WP_003638540.1|286363_286678_-|ribosome-assembly-RNA-binding-protein-YhbY
MENLRGKQKHYLRGEAHHMRPLFAVGKNGLTDEWLTQLTGALDKRELIKVNILQNADVTTADVKAAIEQNTAITVVQTIGRVLVLYLPASHEEDRHYSLEVAKL
>NZ_CP022130.1|WP_088769635.1|300574_301474_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLTKVPNALRGDLTKWYQEIQTGVYVGSVSARIRDSLWLRIVKNIGRGEATMVYNANNELGYQFKTTRRDHQVIDYDGIPLMMHLNAAPQAEEHGYSDAAKFHKARVMSQKAQQKRSQRSRKNNKPMVAVDIETTGLDPSKDVIISIGAVKATTNGQVAEFSRLISVTESIPEKISTLTGLTNDILAKQGVPIVEALSGLNAFIGDCAIVGYNFHFDEAFLKQAFISNNLEALRSQAIDLMPIVKRTNAFLDNYRLATVLSAYEIENLKPHHALEDARATLALAQALCKVERLKI
>NZ_CP022130.1|WP_088769636.1|301470_302424_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MEKQSGAKKPELSELGRVRDRLTFLYLEHAKLDRQDSAVRVSDVRGIVFVPAAIISVLMLGPGVDVTHRAMELMGDAGMAVVWVGERGVRQYAHGRALNHSSLLLEAQAKLFSNQRSRLAVARKMYQMRFPNDDVSGLSMQALRGKEGARVRQVYRLQSERTGVKWTRRDYNPDDFEASSPINQALTAAHQALYGLSYSVIMAMGASAGLGFVHTGHDLSFVYDFADLYKAEFSIPVAFNTVAALTEDDNISRNTRLAMRDAFVDGKLLGRMVSDLKAILGVSDDQTEISNLSLWDDQLGLQEFGVQYHEIKVGETQ
>NZ_CP022130.1|WP_088769637.1|305203_305671_+|hypothetical-protein
MPDTNTILAHTIIELILYFAFMFFVIRFFVRRHRAKHPKRPKVSPSPEQKAAAKAERQAQAKISKAIGRLDDFMVDSVYQNAFPDINTLNLILDEIFAGQVVGVKNNRRSIDLMIGSRGGAIVQIIQDSIGPAVAIDGAEIRDGEDFVEYIKKYL
>NZ_CP022130.1|WP_088769638.1|305949_306699_-|aspartate/glutamate-racemase-family-protein
MEQCFGIIGGMGTMATESFVHAVNQLTNAHCDQDYLNYVVLNDAQIPDRTAYILDHHRASPLPALKSDVRLLNRLAVQFIVMTCNTAHYFVPELTKISRVPILNMPMVAVKAVSQQHSDLPLRIGILATTGTIQSHLYQDIIHANGHVPVVPSEAEQVQLMDLIYHDIKQHNFVDQAKFHGLIAQLLNVEHCDAVILGCTELSVAQATNPFMSEKVIDAQQELAKTAVYRAQSVKTTLLWEQRTQSVNK
>NZ_CP022130.1|WP_003638527.1|306990_307347_-|50S-ribosomal-protein-L20
MARVKGGTVTRKRRKRILKLAKGYRGAKHIQFKVAKDQVMKSYQYAFRDRRRRKSDFRRLWIARINAAARINDISYSQLMHGLKVANVDVNRKMLADLAVNDADAFKALVDTAKKALA
>NZ_CP022130.1|WP_003638526.1|307383_307578_-|50S-ribosomal-protein-L35
MPKQKTNRAAAKRFKVTAKGKIKSANAFTSHRFHGKTKKQRRQLRGTAIIEKPMVKTYHKLLQK
>NZ_CP022130.1|WP_031267356.1|307599_308121_-|translation-initiation-factor-IF-3
MTIAKDSMVNDGIRAREVRLIASDGEQLGVKSRQEAMQIAEDASLDLVLVAPKAKPPVARIMDYGKYRFEQQKKEREARKKQKVVSIKEVRLSPAIDTNDFNTKLKHAEKFLSKGDKVRVSIRFKGRAITHKDIGRQVLNRMIEATKEFSTVEAYPKMDGRSMFLVLAPKTDK
>NZ_CP022130.1|WP_056952390.1|308342_310307_-|threonine--tRNA-ligase
MASINVKFPDGAVKQFDAGVTTEAIAKSISPSLAKRSVAGKFNDQIVDYRQPLTTDGSIEIIAADSEDGLNVLRQTAAQVLANAVKQLFPSIHFGSGEGNANGFFFDTDNPDEDGKQVSEDDLEAISDKMAAIIKQDLPIEREVLSKADALALVGDNPYQQDLVNERAAENDGQVVVYKQGDFVDLSDGAQLASTGKVKVFKLLSVAGAYWQGKSSNPMLQRIYGTAFLKQKDLDADLKRRQEARERDHRVIGNELDLFFVDPKVGNGLPYWMPNGATIRRQIERYIIDKEVANGYQHVYTPVLANLDVYKQSGHWDHYREDMFPPMDMGDGEQLELRPMNCPSHIQIYNHHIRSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHTFVALDQIEEEFKKILSLMVEVYEDFDISDYRFRLSYRDPENTEKYFDDDAMWERSQKMLKSAMDDMGLDYFEAEGEAAFYGPKLDVQTKTALGGEETLSTIQLDFLLPERFDLKYVGADGEEHRPVMIHRGLVSTMERFVAYLTEMYKGAFPTWLAPKQVTIIPVNNGAHGAYAETVRRRLAAEGVRVSIDDRNEKMGYKIRESQTKKVPYLLVVGDQEVANGSVSVRKYGEERTESEAVDMFIGAITQEIKRYSRGASK
>NZ_CP022130.1|WP_088769639.1|310639_311575_-|primosomal-protein-DnaI
MENISETLRTLMNRKNLNHRYEALMTTVYHDPDVRQFLAAHQDELSADALERSGAKLYEFCEEKRKLARHEPTQAPGYQPTLVMSNHLIDIAYQPTPQLQEQQAARALQQRVRSISMPKSIQTADLKSYDQDGDRATALVAALDFIDAYTQAPKRFHRGLYLYGSFGVGKTYLLGGMANELAARGFNTTLIHFPSFAVEMKRSISNNTSADKVDAIKRAPILMIDDIGADASSTWIRDDVLGVILEYRMQEELPTCFSSNFSMQELQDGYLTISQKGDKEPVKAQRIMQRVRYLSSEIEMVGRNRRLNPDG
>NZ_CP022130.1|WP_088771255.1|311578_313015_-|DnaD-domain-protein
MPNEEPLTPKSGLVVPQAPALSAAQQAVLAELYLPLIGPLAYSLYAALRSLQSSENELSNRRSHAELLGILNADLPTVLAARRKLEATGLLRSYYQQDELGTLYIYRLQAPQLALQFFADDLLSVLLLDTVGELRYQQLASDFATQPVDLTVAKDVTANILEVFHVDGHKVTTTPRPVQQVRAQLAANEPAEDQSPVLSDDDFDWQLLGQILKQNYVDLKQVASSRQLIVTESRVYGISEIEMAKLISEVASLTTGQFDENQLKLLIARRYERPTTPTRTTTNEATTDQSTKPTTTAANSSKATRQPASTAQLSKAEQQLVDVAKQAAPYDFLAAVKAEKHGFVTSGENRLVHDLISRGVLPNSVINIVIYYLLQNRELAALNRSLIETVANDWQQHGVNTPEAALAYLKQRQRPKTSAPRRKSNARPTRKEVMPKWAQKQQAGEAQPDKPNKQLSEEQRQQLAARLAKLETNSEKED

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022130_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022130_2

302981-304899

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
CTGTTCCCCGCGTATGCGGGGGTGATCC	PILER-CR
CTGTTCCCCGCGTATGCGGGGGTGATCC	CRISPRCasFinder
CTGTTCCCCGCGTATGCGGGGGTGATCC	CRT

31 spacers

cas1,DEDDh,cas3,cas8e,cse2gr11,cas7,cas5,cas6e

The CRISPR arrays of NZ_CP022130_2

>merge|NZ_CP022130|2|302981-304899|PILER-CR,CRISPRCasFinder,CRT
CTGTTCCCCGCGTATGCGGGGGTGATCCTGCTTGTGCAACTAACCGATGCACCAATTTATTCTGTTCCCCGCGTATGCGGGGGTGATCCCAACGTAGCCCGCCTGCGCTAATGCCACCCTGACTGTTCCCCGCGTATGCGGGGGTGATCCCACCGGTGATTAGATTATCTATCTGTGATTTAGCTGTTCCCCGCGTATGCGGGGGTGATCCCTAATGCATCTTATGCCGCACAATCAAAAGGGACTGTTCCCCGCGTATGCGGGGGTGATCCTATCCGACCAGACACCTTTATACGTCTCTGATTCTGTTCCCCGCGTATGCGGGGGTGATCCTTGGTAAGCCACAAAGGAATGCTGGTTCGAATCCTGTTCCCCGCGTATGCGGGGGTGATCCTTTCCATTGATAATGTCTGTAATCGTGCTCGTGCTGTTCCCCGCGTATGCGGGGGTGATCCTGAAATGGGTGCAGTTAAAGCTGGGTCGTTAAACTGTTCCCCGCGTATGCGGGGGTGATCCTACAATTATCACCTACGGAATCCCAAAAGATCACTGTTCCCCGCGTATGCGGGGGTGATCCTTAATCCCATTGTAATTCATTTGGCCGTCTTGACTGTTCCCCGCGTATGCGGGGGTGATCCTAATATACCACAGCTACAGGTTAGTTTCAACCACTGTTCCCCGCGTATGCGGGGGTGATCCTAAGATTGGTGACGAGGGCAAGGAATCTTCAAGCTGTTCCCCGCGTATGCGGGGGTGATCCCAAGTCAAATGCCACGATTGGAGATATGCAACACTGTTCCCCGCGTATGCGGGGGTGATCCCGCTATTATTGATTTAGCTAACGTAACCACTTCCTGTTCCCCGCGTATGCGGGGGTGATCCTAATTGCTTGCTTATCCGGTAAATAACGCATACCTGTTCCCCGCGTATGCGGGGGTGATCCTCAGCGCTACTAATTCTGCTATGAAATCAACATCTGTTCCCCGCGTATGCGGGGGTGATCCCCAGATTGGCAACATCAGCAATTCAAAATCTTTCTGTTCCCCGCGTATGCGGGGGTGATCCCATATCAGTAATCCCATAGTTGTTCCGCTTATACTGTTCCCCGCGTATGCGGGGGTGATCCCCATGTGCTTCTTCTTTAGTTTCTTTAGCGACACTGTTCCCCGCGTATGCGGGGGTGATCCTAACCAACTGAGGTCGCGTAATTGGTCGCGCGACTGTTCCCCGCGTATGCGGGGGTGATCCAGCTGTAGCAGCTTCTGAGATACCACCAGTTGCTGTTCCCCGCGTATGCGGGGGTGATCCCTGATTTCAGCAGCAGGATAAATAGAAGTAGCCCTGTTCCCCGCGTATGCGGGGGTGATCCTCAGATGTGATTAAATCTGTCGTTGAAATCTATCTGTTCCCCGCGTATGCGGGGGTGATCCCGCAAATCTTTCAACGGTTCGCGGCTTGTTCGACTGTTCCCCGCGTATGCGGGGGTGATCCTACTACATTTCGTTCTTTGACAATGTTTTTGAACTGTTCCCCGCGTATGCGGGGGTGATCCTTGACAATCTATCGTGCACAAATCCTAACTCAGCTGTTCCCCGCGTATGCGGGGGTGATCCCAGTTTGACGTGACCGGTAAGCGTATCGGGTACCTGTTCCCCGCGTATGCGGGGGTGATCCCGATGCTGACACATTTTTTAGGGCTAACTTCGGCTGTTCCCCGCGTATGCGGGGGTGATCCCGGTACCCATGAAATCAGTGGTACAAGCTACATGCTGTTCCCCGCGTATGCGGGGGTGATCCCGTTGTGTTCGCATGAGCCGTGTTACGTTTGAACTGTTCCCCGCGTATGCAGGGGTGATCCTACTGGCATATTCCTGGTAGTTTACCTATCAATCTATTCCCCGTGTATACGAGGGTGATTT

>NZ_CP022130|2|2|302981-304838|PILER-CR
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGCTTGTGCAACTAACCGATGCACCAATTTATT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAACGTAGCCCGCCTGCGCTAATGCCACCCTGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CACCGGTGATTAGATTATCTATCTGTGATTTAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CTAATGCATCTTATGCCGCACAATCAAAAGGGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TATCCGACCAGACACCTTTATACGTCTCTGATT
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTGGTAAGCCACAAAGGAATGCTGGTTCGAATC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTTCCATTGATAATGTCTGTAATCGTGCTCGTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGAAATGGGTGCAGTTAAAGCTGGGTCGTTAAA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TACAATTATCACCTACGGAATCCCAAAAGATCA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTAATCCCATTGTAATTCATTTGGCCGTCTTGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAATATACCACAGCTACAGGTTAGTTTCAACCA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAAGATTGGTGACGAGGGCAAGGAATCTTCAAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAAGTCAAATGCCACGATTGGAGATATGCAACA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGCTATTATTGATTTAGCTAACGTAACCACTTC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAATTGCTTGCTTATCCGGTAAATAACGCATAC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TCAGCGCTACTAATTCTGCTATGAAATCAACAT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CCAGATTGGCAACATCAGCAATTCAAAATCTTT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CATATCAGTAATCCCATAGTTGTTCCGCTTATA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CCATGTGCTTCTTCTTTAGTTTCTTTAGCGACA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAACCAACTGAGGTCGCGTAATTGGTCGCGCGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	AGCTGTAGCAGCTTCTGAGATACCACCAGTTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CTGATTTCAGCAGCAGGATAAATAGAAGTAGCC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TCAGATGTGATTAAATCTGTCGTTGAAATCTAT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGCAAATCTTTCAACGGTTCGCGGCTTGTTCGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TACTACATTTCGTTCTTTGACAATGTTTTTGAA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTGACAATCTATCGTGCACAAATCCTAACTCAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAGTTTGACGTGACCGGTAAGCGTATCGGGTAC
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGATGCTGACACATTTTTTAGGGCTAACTTCGG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGGTACCCATGAAATCAGTGGTACAAGCTACATG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGTTGTGTTCGCATGAGCCGTGTTACGTTTGAA
CTGTTCCCCGCGTATGCAGGGGTGATCC

>NZ_CP022130|2|2|302981-304899|CRISPRCasFinder
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGCTTGTGCAACTAACCGATGCACCAATTTATT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAACGTAGCCCGCCTGCGCTAATGCCACCCTGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CACCGGTGATTAGATTATCTATCTGTGATTTAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CTAATGCATCTTATGCCGCACAATCAAAAGGGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TATCCGACCAGACACCTTTATACGTCTCTGATT
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTGGTAAGCCACAAAGGAATGCTGGTTCGAATC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTTCCATTGATAATGTCTGTAATCGTGCTCGTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGAAATGGGTGCAGTTAAAGCTGGGTCGTTAAA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TACAATTATCACCTACGGAATCCCAAAAGATCA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTAATCCCATTGTAATTCATTTGGCCGTCTTGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAATATACCACAGCTACAGGTTAGTTTCAACCA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAAGATTGGTGACGAGGGCAAGGAATCTTCAAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAAGTCAAATGCCACGATTGGAGATATGCAACA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGCTATTATTGATTTAGCTAACGTAACCACTTC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAATTGCTTGCTTATCCGGTAAATAACGCATAC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TCAGCGCTACTAATTCTGCTATGAAATCAACAT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CCAGATTGGCAACATCAGCAATTCAAAATCTTT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CATATCAGTAATCCCATAGTTGTTCCGCTTATA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CCATGTGCTTCTTCTTTAGTTTCTTTAGCGACA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAACCAACTGAGGTCGCGTAATTGGTCGCGCGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	AGCTGTAGCAGCTTCTGAGATACCACCAGTTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CTGATTTCAGCAGCAGGATAAATAGAAGTAGCC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TCAGATGTGATTAAATCTGTCGTTGAAATCTAT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGCAAATCTTTCAACGGTTCGCGGCTTGTTCGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TACTACATTTCGTTCTTTGACAATGTTTTTGAA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTGACAATCTATCGTGCACAAATCCTAACTCAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAGTTTGACGTGACCGGTAAGCGTATCGGGTAC
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGATGCTGACACATTTTTTAGGGCTAACTTCGG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGGTACCCATGAAATCAGTGGTACAAGCTACATG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGTTGTGTTCGCATGAGCCGTGTTACGTTTGAA
CTGTTCCCCGCGTATGCAGGGGTGATCC	TACTGGCATATTCCTGGTAGTTTACCTATCAAT
CTATTCCCCGTGTATACGAGGGTGATTT

>NZ_CP022130|2|2|302981-304899|CRT
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGCTTGTGCAACTAACCGATGCACCAATTTATT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAACGTAGCCCGCCTGCGCTAATGCCACCCTGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CACCGGTGATTAGATTATCTATCTGTGATTTAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CTAATGCATCTTATGCCGCACAATCAAAAGGGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TATCCGACCAGACACCTTTATACGTCTCTGATT
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTGGTAAGCCACAAAGGAATGCTGGTTCGAATC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTTCCATTGATAATGTCTGTAATCGTGCTCGTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGAAATGGGTGCAGTTAAAGCTGGGTCGTTAAA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TACAATTATCACCTACGGAATCCCAAAAGATCA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTAATCCCATTGTAATTCATTTGGCCGTCTTGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAATATACCACAGCTACAGGTTAGTTTCAACCA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAAGATTGGTGACGAGGGCAAGGAATCTTCAAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAAGTCAAATGCCACGATTGGAGATATGCAACA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGCTATTATTGATTTAGCTAACGTAACCACTTC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAATTGCTTGCTTATCCGGTAAATAACGCATAC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TCAGCGCTACTAATTCTGCTATGAAATCAACAT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CCAGATTGGCAACATCAGCAATTCAAAATCTTT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CATATCAGTAATCCCATAGTTGTTCCGCTTATA
CTGTTCCCCGCGTATGCGGGGGTGATCC	CCATGTGCTTCTTCTTTAGTTTCTTTAGCGACA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TAACCAACTGAGGTCGCGTAATTGGTCGCGCGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	AGCTGTAGCAGCTTCTGAGATACCACCAGTTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CTGATTTCAGCAGCAGGATAAATAGAAGTAGCC
CTGTTCCCCGCGTATGCGGGGGTGATCC	TCAGATGTGATTAAATCTGTCGTTGAAATCTAT
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGCAAATCTTTCAACGGTTCGCGGCTTGTTCGA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TACTACATTTCGTTCTTTGACAATGTTTTTGAA
CTGTTCCCCGCGTATGCGGGGGTGATCC	TTGACAATCTATCGTGCACAAATCCTAACTCAG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CAGTTTGACGTGACCGGTAAGCGTATCGGGTAC
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGATGCTGACACATTTTTTAGGGCTAACTTCGG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGGTACCCATGAAATCAGTGGTACAAGCTACATG
CTGTTCCCCGCGTATGCGGGGGTGATCC	CGTTGTGTTCGCATGAGCCGTGTTACGTTTGAA
CTGTTCCCCGCGTATGCAGGGGTGATCC	TACTGGCATATTCCTGGTAGTTTACCTATCAAT
CTATTCCCCGTGTATACGAGGGTGATTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022130.1\|WP_088769636.1\|301470_302424_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP022130.1\|WP_088769638.1\|305949_306699_-\|aspartate/glutamate-racemase-family-protein	unknown	unknown	gnl\|CDD\|376478
NZ_CP022130.1\|WP_088769630.1\|291209_291878_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|378050
NZ_CP022130.1\|WP_088771255.1\|311578_313015_-\|DnaD-domain-protein	unknown	unknown	gnl\|CDD\|226138
NZ_CP022130.1\|WP_050338821.1\|289257_289740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_088769632.1\|292583_293663_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP022130.1\|WP_003638526.1\|307383_307578_-\|50S-ribosomal-protein-L35	unknown	unknown	gnl\|CDD\|234676
NZ_CP022130.1\|WP_056952390.1\|308342_310307_-\|threonine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234752
NZ_CP022130.1\|WP_088769631.1\|291877_292603_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187886
NZ_CP022130.1\|WP_050338834.1\|313036_313552_-\|transcriptional-repressor-NrdR	unknown	unknown	gnl\|CDD\|234774
NZ_CP022130.1\|WP_050338825.1\|293662_294274_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP022130.1\|WP_050338820.1\|287897_288428_-\|YqeG-family-HAD-IIIA-type-phosphatase	unknown	unknown	gnl\|CDD\|225090
NZ_CP022130.1\|WP_088769640.1\|313591_314185_-\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|234620
NZ_CP022130.1\|WP_088769634.1\|296019_298767_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP022130.1\|WP_088769639.1\|310639_311575_-\|primosomal-protein-DnaI	unknown	unknown	gnl\|CDD\|236353
NZ_CP022130.1\|WP_088769635.1\|300574_301474_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP022130.1\|WP_031267356.1\|307599_308121_-\|translation-initiation-factor-IF-3	unknown	unknown	gnl\|CDD\|234582
NZ_CP022130.1\|WP_088769633.1\|294263_296015_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP022130.1\|WP_088769637.1\|305203_305671_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_003638527.1\|306990_307347_-\|50S-ribosomal-protein-L20	unknown	unknown	gnl\|CDD\|179959

Protein	Function_ID	Function_description	E-value
NZ_CP022130.1\|WP_088769636.1\|301470_302424_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.64331e-131
NZ_CP022130.1\|WP_088769638.1\|305949_306699_-\|aspartate/glutamate-racemase-family-protein	gnl\|CDD\|376478	pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase. This family contains aspartate racemase, maleate isomerases EC:5.2.1.1, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase EC:4.1.1.76.	1.14382e-62
NZ_CP022130.1\|WP_088769630.1\|291209_291878_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	3.28944e-71
NZ_CP022130.1\|WP_088771255.1\|311578_313015_-\|DnaD-domain-protein	gnl\|CDD\|226138	COG3611, DnaB, Replication initiation/membrane attachment protein [DNA replication, recombination, and repair].	1.55356e-40
NZ_CP022130.1\|WP_088769632.1\|292583_293663_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	4.47866e-153
NZ_CP022130.1\|WP_003638526.1\|307383_307578_-\|50S-ribosomal-protein-L35	gnl\|CDD\|234676	PRK00172, rpmI, 50S ribosomal protein L35; Reviewed.	1.32915e-16
NZ_CP022130.1\|WP_056952390.1\|308342_310307_-\|threonine--tRNA-ligase	gnl\|CDD\|234752	PRK00413, thrS, threonyl-tRNA synthetase; Reviewed.	0
NZ_CP022130.1\|WP_088769631.1\|291877_292603_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	9.45533e-46
NZ_CP022130.1\|WP_050338834.1\|313036_313552_-\|transcriptional-repressor-NrdR	gnl\|CDD\|234774	PRK00464, nrdR, transcriptional repressor NrdR.	9.6044e-88
NZ_CP022130.1\|WP_050338825.1\|293662_294274_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	1.33977e-25
NZ_CP022130.1\|WP_050338820.1\|287897_288428_-\|YqeG-family-HAD-IIIA-type-phosphatase	gnl\|CDD\|225090	COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only].	2.45587e-66
NZ_CP022130.1\|WP_088769640.1\|313591_314185_-\|dephospho-CoA-kinase	gnl\|CDD\|234620	PRK00081, coaE, dephospho-CoA kinase; Reviewed.	1.60082e-80
NZ_CP022130.1\|WP_088769634.1\|296019_298767_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.00397e-81
NZ_CP022130.1\|WP_088769639.1\|310639_311575_-\|primosomal-protein-DnaI	gnl\|CDD\|236353	PRK08939, PRK08939, primosomal protein DnaI; Reviewed.	4.83494e-169
NZ_CP022130.1\|WP_088769635.1\|300574_301474_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	4.40134e-41
NZ_CP022130.1\|WP_031267356.1\|307599_308121_-\|translation-initiation-factor-IF-3	gnl\|CDD\|234582	PRK00028, infC, translation initiation factor IF-3; Reviewed.	8.45395e-91
NZ_CP022130.1\|WP_088769633.1\|294263_296015_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	1.10474e-84
NZ_CP022130.1\|WP_003638527.1\|306990_307347_-\|50S-ribosomal-protein-L20	gnl\|CDD\|179959	PRK05185, rplT, 50S ribosomal protein L20; Provisional.	2.65787e-62

>NZ_CP022130.1|WP_088769636.1|301470_302424_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MEKQSGAKKPELSELGRVRDRLTFLYLEHAKLDRQDSAVRVSDVRGIVFVPAAIISVLMLGPGVDVTHRAMELMGDAGMAVVWVGERGVRQYAHGRALNHSSLLLEAQAKLFSNQRSRLAVARKMYQMRFPNDDVSGLSMQALRGKEGARVRQVYRLQSERTGVKWTRRDYNPDDFEASSPINQALTAAHQALYGLSYSVIMAMGASAGLGFVHTGHDLSFVYDFADLYKAEFSIPVAFNTVAALTEDDNISRNTRLAMRDAFVDGKLLGRMVSDLKAILGVSDDQTEISNLSLWDDQLGLQEFGVQYHEIKVGETQ
>NZ_CP022130.1|WP_088769635.1|300574_301474_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MIVITLTKVPNALRGDLTKWYQEIQTGVYVGSVSARIRDSLWLRIVKNIGRGEATMVYNANNELGYQFKTTRRDHQVIDYDGIPLMMHLNAAPQAEEHGYSDAAKFHKARVMSQKAQQKRSQRSRKNNKPMVAVDIETTGLDPSKDVIISIGAVKATTNGQVAEFSRLISVTESIPEKISTLTGLTNDILAKQGVPIVEALSGLNAFIGDCAIVGYNFHFDEAFLKQAFISNNLEALRSQAIDLMPIVKRTNAFLDNYRLATVLSAYEIENLKPHHALEDARATLALAQALCKVERLKI
>NZ_CP022130.1|WP_088769634.1|296019_298767_-|CRISPR-associated-helicase/endonuclease-Cas3
MAEFSRLAQSLWAKKRSSDGQRLWLPLIVHLKDCENTINWLFNHWLSDGQRQQLAAATSEEDVQKLVKFLGFIHDCGKATPAFQMKPAYNGDNQLDQILIEQLMRSGFKDLDVLNLSSAQRSPHALAGEAILTAYGVDPTIGVIIGGHHGKPESEPPVHQIRDYTANYFQSDNRPELQVEWQQVQRELVEYGLHSAGYQSATEIPAINQPEAVILTGLLIMADWLASSECFDGDASKPLFPLVNTAQSVETIDVQTRFQRAIMAWRLDDEWVPAPLSQDQDPYQLRWGFHARPVQAAITRALGATTDPGMAIIEAPMGLGKTEIALIAVEQLARMTGRDGVYMGLPTQATTNAMFARVNDWLASVADEQEAHLSIKLMHGKSQFNRTYTALPNASNVNSTDEHHGAVTLNSWFSGKKSILTKFTVGTIDNLLLMGLKQKHLFLRHLGFSGKVVVIDEVHAYDAYMNAYLLRAIEWLGAYHVPIVILSATLPKIKRNQLLKAYLKGKYGRKFHQLLKLAPAGWEDTKAYPLLSVLDGPEIKQVTHFEGQSDQAPLTLAVERTNQDDQDLVATLLAQLDAGGVAGIIVNTVKRAQALAALIPADVPLMVLHSAFLAPDRAQQEEKLQAAIGKHGQRPAKLVVIGTQVLEQSLDIDFDVLYTDIAPIDLILQRAGRLHRHQTITRPKQFRQPQLKVMGINDFGDYGDGNEAVYGKYLLMKTDHFLPDKIQLPGDISTLVQRVYDAATDAEVPEIESAAEKFETDLKAEQQKAGVFQVKAPQLKQGKTLHGWLDRDHTDVVNDQQASAAVRDIQETLEVILVQHTTDGDFLLDGRKLAEVASAAIAQQTLRIPAAITPNITAAITELEDLTRPYHLRWQDDVWLNGALVLPLDQNLTATFNGWQVSYSPQLGLSYSKEE
>NZ_CP022130.1|WP_088769633.1|294263_296015_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MEKTFNLTTEPWIEVIDAQTNQQVSVSLIELFQNAQNYRQLAGDMRTQDLAVLRLLLAILTTVYTRYDADNQGYEWLTIADDFKVVSVDEDYDSDEIHDDLKKTWQDLYEGGQFTTIVTDYLKQYANRFDLFGDQPFYQVTASEYDAVVPENKSVAHGQKTGKPTGLVAIRQMNRRISESGNSVALFAPKVNETKNDLTHAELARWLIMYQNYTGVTDKTKIESDETFSNGAGWLYQLNPVYANGRSLFEILMLNLILVPMDEDVRYLVQRPVWEYTGLADYLKERRRKLVPDNLAALYTTWSRLLHIEWDDQQRPLIFTAGIPMFDNVGALIEPMTLWRQDKKTSQFKPAVASIKYTGKAMWRNFGQYVNVNRRDDIHEAGIVTWLHYLKAQGLVPDEQQLWLASTALLNDGNMSSQMPATEVYDDMQIQADVLFDESSADYWPVRIEDAINITQKIGDGYYRFAATIGQIRNIDAKQFGQRHSAQFYAELNRPFKAWLASLTGNDDREAKINEWKQTLQTITLQAANTMMATSSSRDVRGIVDHDKNNVPRQINVFTANNQLRRLVFTQLKGKQVKVADEK
>NZ_CP022130.1|WP_050338825.1|293662_294274_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MKNKIQKVTASIIRQLYNHGNLNKGVLASVRHATVLNSPQAQALWPIMMAELDDEMLSRDGRPTAAEVAVYTAVRFYAIQQQGSEVLVYGPANSQTDDTEKGIPLFQALAKLRRNEETRVALDRRMQPLLATTNVASAINALTHLVSMLKAANQQQKIDYARLAQDLYWLQQSYERASQVRLQWGQQYYRPQDATEKPEGKKN
>NZ_CP022130.1|WP_088769632.1|292583_293663_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTNNLYLDIHVIQTVPSSNINRDDTGAPKTALYGGVSRSRVSSQSWKRAVRRSFQDDTVTVGYRTKTAAQLLKDALQKLTPDLSDDDAWEQVNAVFKAASVKLDKNEETSALLMVSPGQIDQLAQYVKDNADGELDKKAIKAVLKGNQSIDLALFGRMVADNPELNVEAAAQVAHAISTHEVVPEFDYFTALDDLQPDDTTGAAMLGTLEFNSATLYRYANINMNDLIENLGETAAVDGAREFVKAFVLSMPTGKQNTFANKTLPSYVMLTLRTDTPVNLVSGFEDPVTSKQGYVKQSIEKLNAAYKQTLQFVEKPVLNVALGADASAIATPAEDLTDLLGQVTTELTKVVKDENGND
>NZ_CP022130.1|WP_088769631.1|291877_292603_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTVTIRLTAPLQSYGDEADFDRRTSYDYPSKSAIVGLIAAALGYRRTDSRIQTLNQLDYAVRIDQPAEPLTDFQIVEWKRGKRKLTYRDYLQDAVFLAAVGSEDDALIDRIDWALHHPRFQLSLGRRANVPAGPIMTEIALGSNPAQVLQSLSWHASRFYMKKTKSPTFVAELIADAALLPNHRSSMVKDNVITFDQRERQYGFRAVAFDRVPLENPYHPDRTAETDHDMMTFLWKEDQR
>NZ_CP022130.1|WP_088769630.1|291209_291878_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRVEIDRDNRYKTRDLTHLGAYHNWVEQSFPEEIENNQRGRHLWRIDRLNGQDYLLVLSADRPKLEQLEQYGVEETAITKSYDTWLDHIEAGMVLRFRLTANPTHSIIEPNHPKGRVVPHVTIEQQKQWLADRALRAGFELVARTNTPADETEKLAFDVVSHDWPTLHRRKGRSVRLSRVTFEGVLRVQNADTFKQTLTKGLGREKAFGMGLMTVIPTE
>NZ_CP022130.1|WP_050338821.1|289257_289740_+|hypothetical-protein
MEKKDVMKQYVTDKYFSKGHWWTKIWQTIVAIVAWICVAVPVYWTISSTLLANNPRFIHAWKYEEGKTLFYFFDRFFIFAFILIAIIVIISTIHNNHRVKQHISKERQYDEERLDVRKRRLNNFYTQRFGQATFRQHVKHYTVDPEQNLDVNEIHKLYED
>NZ_CP022130.1|WP_050338820.1|287897_288428_-|YqeG-family-HAD-IIIA-type-phosphatase
MINQFKPTWMIPAIYNVTPAQLRAQGIKAVFTDLDNTLIAWDNPDGTPELKKWLHALQDAGIPLVVVSNNSEARIAKALEQLDLPFVSRSLKPLPIGLNKARHDLGLHKNEVVMVGDQYITDMWSAHLAGVPSILVKPIVTTDAWNTRINRFFERFIKLRLAHVYPEMHFQEDLNK
>NZ_CP022130.1|WP_088769637.1|305203_305671_+|hypothetical-protein
MPDTNTILAHTIIELILYFAFMFFVIRFFVRRHRAKHPKRPKVSPSPEQKAAAKAERQAQAKISKAIGRLDDFMVDSVYQNAFPDINTLNLILDEIFAGQVVGVKNNRRSIDLMIGSRGGAIVQIIQDSIGPAVAIDGAEIRDGEDFVEYIKKYL
>NZ_CP022130.1|WP_088769638.1|305949_306699_-|aspartate/glutamate-racemase-family-protein
MEQCFGIIGGMGTMATESFVHAVNQLTNAHCDQDYLNYVVLNDAQIPDRTAYILDHHRASPLPALKSDVRLLNRLAVQFIVMTCNTAHYFVPELTKISRVPILNMPMVAVKAVSQQHSDLPLRIGILATTGTIQSHLYQDIIHANGHVPVVPSEAEQVQLMDLIYHDIKQHNFVDQAKFHGLIAQLLNVEHCDAVILGCTELSVAQATNPFMSEKVIDAQQELAKTAVYRAQSVKTTLLWEQRTQSVNK
>NZ_CP022130.1|WP_003638527.1|306990_307347_-|50S-ribosomal-protein-L20
MARVKGGTVTRKRRKRILKLAKGYRGAKHIQFKVAKDQVMKSYQYAFRDRRRRKSDFRRLWIARINAAARINDISYSQLMHGLKVANVDVNRKMLADLAVNDADAFKALVDTAKKALA
>NZ_CP022130.1|WP_003638526.1|307383_307578_-|50S-ribosomal-protein-L35
MPKQKTNRAAAKRFKVTAKGKIKSANAFTSHRFHGKTKKQRRQLRGTAIIEKPMVKTYHKLLQK
>NZ_CP022130.1|WP_031267356.1|307599_308121_-|translation-initiation-factor-IF-3
MTIAKDSMVNDGIRAREVRLIASDGEQLGVKSRQEAMQIAEDASLDLVLVAPKAKPPVARIMDYGKYRFEQQKKEREARKKQKVVSIKEVRLSPAIDTNDFNTKLKHAEKFLSKGDKVRVSIRFKGRAITHKDIGRQVLNRMIEATKEFSTVEAYPKMDGRSMFLVLAPKTDK
>NZ_CP022130.1|WP_056952390.1|308342_310307_-|threonine--tRNA-ligase
MASINVKFPDGAVKQFDAGVTTEAIAKSISPSLAKRSVAGKFNDQIVDYRQPLTTDGSIEIIAADSEDGLNVLRQTAAQVLANAVKQLFPSIHFGSGEGNANGFFFDTDNPDEDGKQVSEDDLEAISDKMAAIIKQDLPIEREVLSKADALALVGDNPYQQDLVNERAAENDGQVVVYKQGDFVDLSDGAQLASTGKVKVFKLLSVAGAYWQGKSSNPMLQRIYGTAFLKQKDLDADLKRRQEARERDHRVIGNELDLFFVDPKVGNGLPYWMPNGATIRRQIERYIIDKEVANGYQHVYTPVLANLDVYKQSGHWDHYREDMFPPMDMGDGEQLELRPMNCPSHIQIYNHHIRSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHTFVALDQIEEEFKKILSLMVEVYEDFDISDYRFRLSYRDPENTEKYFDDDAMWERSQKMLKSAMDDMGLDYFEAEGEAAFYGPKLDVQTKTALGGEETLSTIQLDFLLPERFDLKYVGADGEEHRPVMIHRGLVSTMERFVAYLTEMYKGAFPTWLAPKQVTIIPVNNGAHGAYAETVRRRLAAEGVRVSIDDRNEKMGYKIRESQTKKVPYLLVVGDQEVANGSVSVRKYGEERTESEAVDMFIGAITQEIKRYSRGASK
>NZ_CP022130.1|WP_088769639.1|310639_311575_-|primosomal-protein-DnaI
MENISETLRTLMNRKNLNHRYEALMTTVYHDPDVRQFLAAHQDELSADALERSGAKLYEFCEEKRKLARHEPTQAPGYQPTLVMSNHLIDIAYQPTPQLQEQQAARALQQRVRSISMPKSIQTADLKSYDQDGDRATALVAALDFIDAYTQAPKRFHRGLYLYGSFGVGKTYLLGGMANELAARGFNTTLIHFPSFAVEMKRSISNNTSADKVDAIKRAPILMIDDIGADASSTWIRDDVLGVILEYRMQEELPTCFSSNFSMQELQDGYLTISQKGDKEPVKAQRIMQRVRYLSSEIEMVGRNRRLNPDG
>NZ_CP022130.1|WP_088771255.1|311578_313015_-|DnaD-domain-protein
MPNEEPLTPKSGLVVPQAPALSAAQQAVLAELYLPLIGPLAYSLYAALRSLQSSENELSNRRSHAELLGILNADLPTVLAARRKLEATGLLRSYYQQDELGTLYIYRLQAPQLALQFFADDLLSVLLLDTVGELRYQQLASDFATQPVDLTVAKDVTANILEVFHVDGHKVTTTPRPVQQVRAQLAANEPAEDQSPVLSDDDFDWQLLGQILKQNYVDLKQVASSRQLIVTESRVYGISEIEMAKLISEVASLTTGQFDENQLKLLIARRYERPTTPTRTTTNEATTDQSTKPTTTAANSSKATRQPASTAQLSKAEQQLVDVAKQAAPYDFLAAVKAEKHGFVTSGENRLVHDLISRGVLPNSVINIVIYYLLQNRELAALNRSLIETVANDWQQHGVNTPEAALAYLKQRQRPKTSAPRRKSNARPTRKEVMPKWAQKQQAGEAQPDKPNKQLSEEQRQQLAARLAKLETNSEKED
>NZ_CP022130.1|WP_050338834.1|313036_313552_-|transcriptional-repressor-NrdR
MQCPHCHHNGSRVVDSRPTDDGRVIRRRRECENCGFRFTTFERVEATPLLVIKKNGAREEFNREKVLRGIIRSAEKRPVSMETMTGVVDDVENKVRSLGENEISSQVIGEYVMEQLADIDEISYIRFASVYRQFKDMHVFLNELQDMMERDKVKLAKPSAKTEHAPKRKKD
>NZ_CP022130.1|WP_088769640.1|313591_314185_-|dephospho-CoA-kinase
MTKLIGLTGGIATGKSTVSKLLAQYLPIVDADKIAWAVEGPGQPTTQKIAAKFGPDALLADGSLNRPWLGQLVFNDSAALQDLTAITSLPIQYAMFEAIVAAGQSNPTAIILDVPLLYESGWQNVCDQVVVVTAPPAIVLKRLMARNQLSKQAAQARIASQLPLAQKAAWADVVIDNGSTVDKTEAAVLKWLETMTV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022130_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022130_3

515518-522878

Orphan

Consensus_repeat	Method
TCNGANTCNGANTCNCNNTC	CRT

101 spacers

The CRISPR arrays of NZ_CP022130_3

>merge|NZ_CP022130|3|515518-522878|CRT
TCACTGTCGGAGTCGGAATCGCTGTCAGAATCCGAGTCACTATCCGAGTCAGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCTGAATCACTATCAGAATCGGAGTCGCTGTCGCTATCTGAATCACTGTCCGAGTCGGAATCACTGTCGCTATCTGAATCGCTGTCGGAATCCGAATCGCTGTCAGAGTCTGAGTCACTATCGGAATCGGAGTCGCTGTCGCTATCTGAGTCGCTGTCGGAGTCGGAATCACTGTCGGAATCGCTGTCGGAGTCGGAATCACTGTCGGAATCCGAGTCACTATCGGAATCGGAGTCGCTGTCCGAGTCAGAATCACTGTCGGAATCTGAGTCGCTGTCGCTATCTGAGTCGCTGTCGGAGTCTGAGTCACTGTCCGAATCGGAATCGCTGTCGGAATCTGAATCACTATCAGAGTCTGAATCGCTGTCGCTATCTGAATCACTATCGGAGTCGGAATCGCTGTCGGAATCCGAGTCACTATCGGAATCTGAATCAGAATCACTGTCGGAGTCGGAATCGCTGTCGGAATCCGAGTCGCTATCCGAATCGGAGTCGCTGTCCGAATCAGAATCACTATCAGAATCTGAGTCGCTGTCTGAATCTGAATCACTATCGGAGTCTGAATCGCTGTCGGAATCCGAGTCGCTGTCGCTATCTGAGTCGCTGTCAGAATCGGAATCACTATCCGAGTCTGAATCGCTGTCGCTATCTGAATCACTGTCCGAGTCTGAGTCACTGTCCGAATCCGAGTCGCTGTCAGAATCTGAATCGCTGTCGGAATCCGAGTCACTATCGGAGTCTGAGTCACTGTCCGAATCTGAATCGCTGTCGGAGTCGGAATCGCTGTCTGAATCTGAATCACTATCGGAATCTGAATCACTGTCAGAATCTGAATCACTGTCAGAGTCTGAATCGCTGTCGCTATCAGAATCCGAGTCGCTGTCGGAGTCGGAATCACTGTCCGAATCTGAATCACTATCGGAGTCGGAATCACTGTCAGAGTCGGAATCACTATCGGAATCCGAGTCGCTGTCAGAATCCGAGTCGCTATCCGAATCCGAGTCGCTATCGCTATCTGAGTCGCTGTCGGAGTCACTGTCAGAATCTGAGTCACTGTCAGAATCTGAGTCGCTGTCCGAGTCTGAATCGCTGTCGGAATCACTATCGGAATCCGAGTCGCTGTCAGAATCTGAGTCAGAGTCACTGTCGGAGTCACTGTCGGAGTCACTGTCAGAATCTGAGTCGCTGTCGGAGTCAGAATCACTGTCTGAGTCAGAATCACTATCGGAATCTGAGTCGCTGTCTGAATCGGAATCGCTGTCGCTATCTGAGTCGCTGTCCGAATCTGAATCGCTGTCGGAGTCCGAATCTGAATCGCTATCACTATCGGAGTCGCTGTCGGAATCTGAATCACTGTCGCTATCCGAGTCACTATCGGAGTCGCTGTCTGAGTCGGAATCGCTGTCCGAATCTGAATCGCTATCACTATCGGAGTCGGAATCGCTGTCCGAATCTGAGTCGCTGTCCGAATCTGAATCGCTATCACTATCGGAGTCGGAATCGCTGTCAGAGTCGGAATCACTGTCTGAGTCTGAATCGCTGTCGCTATCGGAATCTGAATCACTGTCCGAGTCTGAATCACTGTCGCTATCTGAATCGCTGTCCGAATCCGAGTCACTGTCGGAATCTGAGTCACTATCGGAGTCGGAATCACTGTCTGAGTCTGAATCGCTGTCGCTATCGGAATCACTATCAGAATCGGAATCACTATCAGAATCGGAATCGCTGTCCGAGTCGGAGTCACTGTCAGAATCGGAATCGCTGTCCGAGTCAGAATCACTGTCGCTATCTGAATCGCTGTCGGAGTCTGAGTCGCTGTCTGAATCAGAATCACTGTCTGAGTCTGAATCGCTGTCGCTATCTGAGTCACTGTCTGAGTCTGAATCGCTATCGGAATCTGAATCGCTGTCCGAATCCGAGTCACTATCTGAGTCGGAATCACTGTCTGAATCGGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTATCTGAGTCACTGTCCGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCTGAATCGGAATCGCTGTCGGAATCCGAGTCACTATCGGAATCTGAGTCGCTGTCCGAGTCGGAATCACTGTCGGAATCGGAATCGCTGTCAGAATCGGAGTCGCTGTCAGAATCGGAATCGCTGTCAGAGTCAGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCTGAATCGGAATCGCTGTCGGAGTCAGAATCGCTGTCGGAGTCAGAATCACTGTCAGAATCGGAATCGCTGTCGGAATCCGAGTCACTGTCGGAATCTGAGTCGGAGTCGCTATCTGAGGAGTCGCTATCTGAGTCGCTGTCGCTGTCGCTATCTGAATCACTGTCCGAGTCGGAATCGCTGTCGGAATCCGAGTCGCTGTCGCTATCCGAATCACTATCGGAATCTGAATCGCTGTCTGAGTCGCTGTCGCTATCCGAATCACTGTCCGAGTCGGAATCGCTGTCAGAATCGGAATCGCTGTCCGAGTCGGAATCACTGTCGGAATCCGAGTCGCTGTCTGAATCAGAATCACTATCAGAATCTGAGTCGCTGTCACTGTCGGAATCGCTGTCGGAATCGGAATCACTATCGGAATCCGAGTCGCTGTCAGAATCCGAGTCGCTATCGGAATCTGAATCGCTGTCAGAATCCGAATCGCTGTCCGAATCTGAGTCACTATCTGAGTCAGAGTCACTGTCGGAGTCGGAATCGCTGTCTGAGTCGGAGTCACTGTCCGAATCTGAGTCGCTGTCGGAATCGGAATCACTATCGGAGTCGGAATCGCTGTCCGAATCTGAGTCACTGTCGCTATCTGAATCACTGTCCGAGTCGGAATCACTATCGGAATCCGAGTCGCTGTCCGAGTCACTATCGCTGTCGGAGTCTGAATCACTATCGGAATCCGAATCACTGTCGCTATCTGAATCGCTGTCCGAATCCGAGTCGCTGTCAGAGTCAGAATCACTGTCCGAGTCGGAATCGCTGTCGCTATCTGAATCGCTGTCGGAGTCTGAGTCGCTGTCTGAATCAGAATCACTGTCTGAGTCTGAATCGCTGTCCGAATCCGAGTCGTTGTCAGAATCGGAATCACTGTCTGAGTCTGAATCGCTGTCCGAGTCGCTGTCGGAGTCTGAGTCACTATCTGAGTCTGAATCGCTGTCGCTATCTGAGTCACTGTCTGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCTGAGTCTGAATCGCTGTCGGAATCCGAGTCACTATCGGAGTCGCTATCGCTATCGGAGTCGGAGTCGCTGTCCGAGTCGGAATCGCTGTCGCTATCTGAGTCGCTGTCGGAATCCGAGTCACTGTCGGAATCCGAGTCGCTGTCGCTATCTGAGTCGCTGTCCGAGTCGGAATCACTGTCTGAATCGGAATCGCTGTCCGAGTCGGAATCACTATCCGAATCGGAGTCGCTGTCTGAATCGGAATCGCTGTCCGAGTCTGAATCACTGTCAGAATCGGAATCGCTGTCCGAGTCGGAATCACTGTCTGAATCGGAGTCGCTGTCCGAGTCGGAGTCACTGTCTGAATCGGAATCGCTGTCCGAGTCTGAATCGCTGTCCGAGTCAGAATCGCTGTCCGAGTCAGAATCGCTGTCGCTATCTGAATCGCTGTCGGAGTCGGAATCACTGTCTGAATCCGAGTCACTATCGGAATCGGAGTCGCTGTCCGAGTCAGAATCACTGTCGCTATCTGAGTCACTGTCAGAGTCTGAATCACTATCGGAATCTGAATCGCTGTCCGAGTCAGAATCGCCGTCGGAGTCAGAATCGCTGTCGGAGTCAGAATCACTGTCGGAGTCGGAATCGCTGTCTGAGTCCGAGTCGCTATCCGAATCAGAATCACTATCAGAATCTGAGTCGCTGTCAGAATCGGAATCGCTGTCGCTATCTGAATCACTATCGGAATCTGAGTCGCTATCCGAATCACTATCGGAGTCGGAATCGCTGTCGGAATCGGAGTCGCTGTCGGAATCGGAGTCGCTGTCAGAATCGGAATCACTGTCAGAGTCGGAATCGCTGTCGCTATCAGAATCTGAGTCACTGTCGGAGTCTGAGTCGCTATCGGAATCGGAATCGCTGTCCGAATCCGAGTCACTATCGGAGTCGGAATCGCTGTCTGAGTCGCTGTCGCTGTCAGAATCTGAATCGCTGTCGGAATCCGAATCGCTGTCGCTATCTGAATCACTGTCCGAGTCTGAGTCGCTGTCGGAGTCGGAATCGCTGTCGCTATCTGAGTCGCTGTCGGAATCTGAGTCACTGTCGCTATCTGAATCACTGTCGGAATCTGAATCACTATCGGAGTCGGAATCACTGTCCGAGTCGGAATCGCTGTCAGAATCCGAATCGCTGTCTGAATCTGAGTCACTATCTGAGTCACTATCTGAGTCAGAGTCACTGTCTGAGTCGGAATCGCTGTCGGAGTCGGAGTCACTGTCCGAATCTGAGTCACTGTCTGAGTCGGAATCGCTGTCGGAGTCGGAGTCACTGTCGGAGTCCGAATCACTATCGGAATCGGAATCGCTGTCTGAGTCTGAGTCGCTATCAGAGTCGGAATCGCTGTCGGAGTCCGAATCACTGTCTGAGTCTGAGTCGCTATCAGAGTCGGAATCGCTGTCGGAGTCCGAATCACTGTCCGAGTCCGAATCGGAATCGCTGTCCGAATCTGAATCACTGTCTGAATCGGAGTCGCTGTCGGAGTCGGAATCGCTGTCCGAATCTGAGTCACTGTCGCTATCTGAATCACTATCGGAATCCGAGTCGCTGTCAGAGTCACTATCGGAGTCGGAATCACTATCGGAATCTGAATCACTGTCAGAGTCACTGTCGCTATCTGAATCACTGTCAGAGTCGGAATCACTGTCGCTATCTGAATCGCTGTCGGAGTCGGAATCGCTGTCGGAGTCGGAATCGCTGTCGCTATCCGAATCACTGTCGGAGTCGGAATCGCTGTCAGAATCCGAGTCGCTGTCGGAGTCGGAATCACTATCAGAATCTGAGTCGCTGTCGCTATCTGAATCACTGTCACTATCCGAATCACTGTCAGAATCGGAATCACTATCCGAGTCTGAATCGCTGTCAGAATCTGAGTCACTGTCAGAGTCTGAATCGCTGTCACTATCCGAATCACTATCTGAGTCAGAATCGCTGTCGCTATCTGAGTCGCTGTCTGAGTCCGAATCGCTGTCCGAATCGGAATCACTGTCTGAGTCAGAGTCGCTGTCTGAGTCAGAGTCACTGTCTGAATCTGAGTCGCTGTCTGAGTCTGAATCACTATCGGAATCCGAGTCACTGTCAGAATCAGAATCGCTATCGCTATCCGAATCGGAATCGCTGTCGGAATCCGAGTCACTATCTGAGTCGGAATCACTATCGGAATCTGAATCGCTGTCCGAGTCGGAATCACTATCGGAGTCTGAGTCGCTGTCGCTATCTGAATCACTGTCGGAATCTGAGTCACTGTCGCTATCTGAATCACTGTCGGAGTCACTGTCGCTATCCGAATCACTGTCGGAATCTGAGTCAGAGTCACTATCGGAGTCGGAATCGCTATCTGAGTCACTGTCAGAATCTGAATCGCTGTCCGAGTCTGAATCACTGTCGCTATCCGAATCGCTGTCCGAATCCGAGTCGCTGTCGCTATCCGAATCACTATCGGAGTCAGAGTCACTGTCGGAATCCGAGTCGCTGTCGGAGTCGGAATCTGAATCGCTGTCAGAGTCAGAATCACTATCGGAATCCGAGTCGCTGTCCGAGTCGCTGTCTGAGTCGGAATCACTATCCGAGTCTGAGTCACTGTCAGAGTCTGAGTCACTATCCGAGTCAGAATCGCTGTCTGAGTCGGAATCACTGTCGGAATCTGAGTCGCTATCGGAATCGCTATCGGAATCCGAATCGCTGTCCGAGTCGGAATCACTGTCGCTATCTGAGTCACTGTCCGAGTCAGAATCGCTGTCGGAGTCGGAATCACTATCAGAATCTGAGTCGCTGTCGGAGTCGGAATCGCTGTCGGAGTCGGAATCGCTGTCGCTATCTGAGTCAGAGTCACTATCGGAATCTGAGTCACTGTCAGAATCGGAATCGCTGTCGGAATCTGAATCACTATCGGAATCGGAATCGGAATCGCTGTCGGAATCGGAATCGCTGTCGCTATCCGAATCACTATCGGAATCTGAATCACTGTCGGAGTCGGAATCACTGTCGCTATCCGAATCGCTGTCCGAATCGGAGTCGCTGTCCGAATCTGAATCGCTGTCGGAATCTGAATCGCTGTCAGAGTCAGAATCACTATCGGAATCCGAGTCACTGTCGGAATCACTATCGGAATCCGAGTCGCTGTCGCTGTCCGAATCACTATCGGAATCGGAGTCACTGTCAGAGTCTGAATCGCTGTCGGAGTCGGAATCACTATCGGAATCGGAGTCGGAATCGCTGTCGCTATCTGAATCACTGTCTGAGTCGGAATCGCTGTTGGAGTCGGAATCGCTGTCGCTATCTGAGTCAGAGTCACTATCGGAGTCGGAATCGCTGTCGCCATCTGAGTCAGAGTCACTATCGGAATCTGAATCGCTATCGGAATCTGAGTCACTGTCCGAGTCAGAATCGCTGTCGGAGTCCGAGTCACTGTCCGAATCCGAGTCGCTGTCGGAGTCCGAGTCGCTGTCAGAATCTGAATCGCTGTCGCTATCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCGGAGTCAGAGTCACTGTCCGAATCCGAATCGCTGTCGGAATCTGAATCGCTGTCACTATCCGAATCGCTGTCAGAATCTGAGTCACTGTCAGAATCCGAGTCACTGTCCGAATCCGAGTCACTGTCCGAATCTGAATCGCTGTCACTATCCGAATCGCTGTCAGAATCGCTGTCGGAATCGGAATCACTGTCACTATCCGAATCGCTGTCAGAATCGGAGTCGCTGTCCGAGTCGGAATCACTATCGGAATCCGAGTCACTGTCAGAATCGGAGTCTGAGTCGCTGTCTGAGTCCGAGTCACTATCGGAGTCGGAATCGCTGTCCGAGTCTGAGTCACTGTCGGAATCCGAGTCGCTGTCTGAGTCTGAATCTGAATCGCTGTCGGAATCCGAGTCACTGTCGCTATCCGAATCGCTGTCTGAATCTGAATCACTATCCGAGTCTGAATCGCTGTCGGAGTCAGAATCATCCTC

>NZ_CP022130|3|3|515518-522878|CRT
TCACTGTCGGAGTCGGAATC	GCTGTCAGAATCCGAGTCACTATCCGAGTCAGAATCGCTGTCGCTATCTGAGTCACTGTCGGAGTCTGAATCACTATCAGAATCGGAGTCGCTGTCGCTATCTGAA
TCACTGTCCGAGTCGGAATC	ACTGTCGCTATCTGAATCGCTGTCGGAATCCGAATCGCTGTCAGAGTCTGAGTCACTATCGGAATCGGAGTCGCTGTCGCTATCTGAGTCGCTGTCGGAGTCGGAATCACTGTCGGAA
TCGCTGTCGGAGTCGGAATC	ACTGTCGGAATCCGAGTCACTATCGGAATCGGAGTCGCTGTCCGAGTCAGAATCACTGTCGGAATCTGAGTCGCTGTCGCTATCTGAGTCGCTGTCGGAGTCTGAGTCACTGTCCGAATCGGAA
TCGCTGTCGGAATCTGAATC	ACTATCAGAGTCTGAATCGCTGTCGCTATCTGAATCACTATCGGAGTCGGAATCGCTGTCGGAATCCGAGTCACTATCGGAATCTGAATCAGAATCACTGTCGGAGTCGGAA
TCGCTGTCGGAATCCGAGTC	GCTATCCGAATCGGAGTCGCTGTCCGAATCAGAATCACTATCAGAATCTGAGTCGCTGTCTGAATCTGAATCACTATCGGAGTCTGAA
TCGCTGTCGGAATCCGAGTC	GCTGTCGCTATCTGAGTCGCTGTCAGAATCGGAATCACTATCCGAGTCTGAATCGCTGTCGCTATCTGAATCACTGTCCGAGTCTGAG
TCACTGTCCGAATCCGAGTC	GCTGTCAGAATCTGAATCGCTGTCGGAATCCGAGTCACTATCGGAGTCTGAG
TCACTGTCCGAATCTGAATC	GCTGTCGGAGTCGGAATCGCTGTCTGAATCTGAATCACTATCGGAATCTGAATCACTGTCAGAATCTGAA
TCACTGTCAGAGTCTGAATC	GCTGTCGCTATCAGAATCCGAGTCGCTGTCGGAGTCGGAATCACTGTCCGAATCTGAATCACTATCGGAGTCGGAA
TCACTGTCAGAGTCGGAATC	ACTATCGGAATCCGAGTCGCTGTCAGAATCCGAGTCGCTATCCGAATCCGAGTCGCTATCGCTATCTGAGTCGCTGTCGGAG
TCACTGTCAGAATCTGAGTC	ACTGTCAGAATCTGAGTCGCTGTCCGAGTCTGAATCGCTGTCGGAATCACTATCGGAATCCGAG
TCGCTGTCAGAATCTGAGTC	AGAGTCACTGTCGGAGTCACTGTCGGAGTCACTGTCAGAATCTGAGTCGCTGTCGGAGTCAGAATCACTGTCTGAGTCAGAATCACTATCGGAATCTGAG
TCGCTGTCTGAATCGGAATC	GCTGTCGCTATCTGAGTCGCTGTCCGAATCTGAATCGCTGTCGGAGTCCGAATCTGAATCGCTATCACTATCGGAG
TCGCTGTCGGAATCTGAATC	ACTGTCGCTATCCGAGTCACTATCGGAGTCGCTGTCTGAGTCGGAATCGCTGTCCGAATCTGAATCGCTATCACTATCGGAGTCGGAATCGCTGTCCGAATCTGAG
TCGCTGTCCGAATCTGAATC	GCTATCACTATCGGAGTCGGAATCGCTGTCAGAGTCGGAATCACTGTCTGAGTCTGAATCGCTGTCGCTATCGGAATCTGAA
TCACTGTCCGAGTCTGAATC	ACTGTCGCTATCTGAATCGCTGTCCGAATCCGAGTCACTGTCGGAATCTGAGTCACTATCGGAGTCGGAA
TCACTGTCTGAGTCTGAATC	GCTGTCGCTATCGGAATCACTATCAGAATCGGAATCACTATCAGAATCGGAA
TCGCTGTCCGAGTCGGAGTC	ACTGTCAGAATCGGAATCGCTGTCCGAGTCAGAATCACTGTCGCTATCTGAA
TCGCTGTCGGAGTCTGAGTC	GCTGTCTGAATCAGAATCACTGTCTGAGTCTGAA
TCGCTGTCGCTATCTGAGTC	ACTGTCTGAGTCTGAATCGCTATCGGAATCTGAATCGCTGTCCGAA
TCCGAGTCACTATCTGAGTC	GGAATCACTGTCTGAATCGGAGTCGCTGTCAGAGTCAGAA
TCGCTGTCGCTATCTGAGTC	ACTGTCCGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCTGAATCGGAA
TCGCTGTCGGAATCCGAGTC	ACTATCGGAATCTGAGTCGCTGTCCGAGTCGGAATCACTGTCGGAATCGGAA
TCGCTGTCAGAATCGGAGTC	GCTGTCAGAATCGGAATCGCTGTCAGAGTCAGAA
TCGCTGTCGCTATCTGAGTC	ACTGTCGGAGTCGGAATCACTATCCGAGTCGGAGTCACTGTCTGAA
TCGGAATCGCTGTCGGAGTC	AGAATCGCTGTCGGAGTCAGAATCACTGTCAGAA
TCGGAATCGCTGTCGGAATC	CGAGTCACTGTCGGAATCTGAGTCGGAGTCGCTATCTGAGGAGTCGCTATCTGAG
TCGCTGTCGCTGTCGCTATC	TGAATCACTGTCCGAGTCGGAATCGCTGTCGGAA
TCCGAGTCGCTGTCGCTATC	CGAATCACTATCGGAATCTGAATCGCTG
TCTGAGTCGCTGTCGCTATC	CGAATCACTGTCCGAGTCGGAATCGCTG
TCAGAATCGGAATCGCTGTC	CGAGTCGGAATCACTGTCGGAATCCGAGTCGCTGTCTGAATCAGAATCACTA
TCAGAATCTGAGTCGCTGTC	ACTGTCGGAATCGCTGTCGGAATCGGAATCACTA
TCGGAATCCGAGTCGCTGTC	AGAATCCGAGTCGCTATCGGAATCTGAATCGCTG
TCAGAATCCGAATCGCTGTC	CGAATCTGAGTCACTATCTGAGTCAGAGTCACTG
TCGGAGTCGGAATCGCTGTC	TGAGTCGGAGTCACTGTCCGAATCTGAGTCGCTGTCGGAATCGGAATCACTA
TCGGAGTCGGAATCGCTGTC	CGAATCTGAGTCACTGTCGCTATCTGAATCACTGTCCGAGTCGGAATCACTA
TCGGAATCCGAGTCGCTGTC	CGAGTCACTATCGCTGTCGGAGTCTGAATCACTA
TCGGAATCCGAATCACTGTC	GCTATCTGAATCGCTGTCCGAATCCGAGTCGCTG
TCAGAGTCAGAATCACTGTC	CGAGTCGGAATCGCTGTCGCTATCTGAATCGCTGTCGGAGTCTGAGTCGCTG
TCTGAATCAGAATCACTGTC	TGAGTCTGAATCGCTGTCCGAATCCGAGTCGTTG
TCAGAATCGGAATCACTGTC	TGAGTCTGAATCGCTGTCCGAGTCGCTG
TCGGAGTCTGAGTCACTATC	TGAGTCTGAATCGCTGTCGCTATCTGAGTCACTG
TCTGAGTCGGAATCACTATC	CGAGTCGGAGTCACTGTCTGAGTCTGAATCGCTG
TCGGAATCCGAGTCACTATC	GGAGTCGCTATCGCTATCGGAGTCGGAGTCGCTGTCCGAGTCGGAATCGCTG
TCGCTATCTGAGTCGCTGTC	GGAATCCGAGTCACTGTCGGAATCCGAGTCGCTG
TCGCTATCTGAGTCGCTGTC	CGAGTCGGAATCACTGTCTGAATCGGAATCGCTGTCCGAGTCGGAATCACTA
TCCGAATCGGAGTCGCTGTC	TGAATCGGAATCGCTGTCCGAGTCTGAATCACTGTCAGAATCGGAATCGCTGTCCGAGTCGGAATCACTG
TCTGAATCGGAGTCGCTGTC	CGAGTCGGAGTCACTGTCTGAATCGGAATCGCTG
TCCGAGTCTGAATCGCTGTC	CGAGTCAGAATCGCTGTCCGAGTCAGAATCGCTGTCGCTATCTGAATCGCTG
TCGGAGTCGGAATCACTGTC	TGAATCCGAGTCACTATCGGAATCGGAGTCGCTG
TCCGAGTCAGAATCACTGTC	GCTATCTGAGTCACTGTCAGAGTCTGAATCACTATCGGAATCTGAATCGCTG
TCCGAGTCAGAATCGCCGTC	GGAGTCAGAATCGCTGTCGGAGTCAGAATCACTG
TCGGAGTCGGAATCGCTGTC	TGAGTCCGAGTCGCTATCCGAATCAGAATCACTATCAGAATCTGAGTCGCTG
TCAGAATCGGAATCGCTGTC	GCTATCTGAATCACTATCGGAATCTGAGTCGCTATCCGAATCACTATCGGAGTCGGAATCGCTG
TCGGAATCGGAGTCGCTGTC	GGAATCGGAGTCGCTGTCAGAATCGGAATCACTG
TCAGAGTCGGAATCGCTGTC	GCTATCAGAATCTGAGTCACTGTCGGAGTCTGAGTCGCTATCGGAATCGGAATCGCTGTCCGAATCCGAGTCACTA
TCGGAGTCGGAATCGCTGTC	TGAGTCGCTGTCGCTGTCAGAATCTGAATCGCTG
TCGGAATCCGAATCGCTGTC	GCTATCTGAATCACTGTCCGAGTCTGAGTCGCTG
TCGGAGTCGGAATCGCTGTC	GCTATCTGAGTCGCTGTCGGAATCTGAGTCACTGTCGCTATCTGAATCACTG
TCGGAATCTGAATCACTATC	GGAGTCGGAATCACTGTCCGAGTCGGAATCGCTGTCAGAATCCGAATCGCTG
TCTGAATCTGAGTCACTATC	TGAGTCACTATCTGAGTCAGAGTCACTGTCTGAGTCGGAATCGCTGTCGGAGTCGGAGTCACTG
TCCGAATCTGAGTCACTGTC	TGAGTCGGAATCGCTGTCGGAGTCGGAGTCACTGTCGGAGTCCGAATCACTATCGGAATCGGAATCGCTG
TCTGAGTCTGAGTCGCTATC	AGAGTCGGAATCGCTGTCGGAGTCCGAATCACTGTCTGAGTCTGAGTCGCTA
TCAGAGTCGGAATCGCTGTC	GGAGTCCGAATCACTGTCCGAGTCCGAATCGGAATCGCTGTCCGAATCTGAATCACTGTCTGAATCGGAGTCGCTG
TCGGAGTCGGAATCGCTGTC	CGAATCTGAGTCACTGTCGCTATCTGAATCACTATCGGAATCCGAGTCGCTGTCAGAGTCACTA
TCGGAGTCGGAATCACTATC	GGAATCTGAATCACTGTCAGAGTCACTGTCGCTATCTGAATCACTG
TCAGAGTCGGAATCACTGTC	GCTATCTGAATCGCTGTCGGAGTCGGAATCGCTG
TCGGAGTCGGAATCGCTGTC	GCTATCCGAATCACTGTCGGAGTCGGAATCGCTGTCAGAATCCGAGTCGCTG
TCGGAGTCGGAATCACTATC	AGAATCTGAGTCGCTGTCGCTATCTGAATCACTGTCACTATCCGAATCACTG
TCAGAATCGGAATCACTATC	CGAGTCTGAATCGCTGTCAGAATCTGAGTCACTGTCAGAGTCTGAATCGCTG
TCACTATCCGAATCACTATC	TGAGTCAGAATCGCTGTCGCTATCTGAGTCGCTGTCTGAGTCCGAATCGCTG
TCCGAATCGGAATCACTGTC	TGAGTCAGAGTCGCTGTCTGAGTCAGAGTCACTG
TCTGAATCTGAGTCGCTGTC	TGAGTCTGAATCACTATCGGAATCCGAGTCACTG
TCAGAATCAGAATCGCTATC	GCTATCCGAATCGGAATCGCTG
TCGGAATCCGAGTCACTATC	TGAGTCGGAATCACTATCGGAATCTGAATCGCTG
TCCGAGTCGGAATCACTATC	GGAGTCTGAGTCGCTGTCGCTATCTGAATCACTG
TCGGAATCTGAGTCACTGTC	GCTATCTGAATCACTGTCGGAGTCACTGTCGCTATCCGAATCACTG
TCGGAATCTGAGTCAGAGTC	ACTATCGGAGTCGGAATCGCTATCTGAGTCACTG
TCAGAATCTGAATCGCTGTC	CGAGTCTGAATCACTGTCGCTATCCGAATCGCTG
TCCGAATCCGAGTCGCTGTC	GCTATCCGAATCACTATCGGAGTCAGAGTCACTG
TCGGAATCCGAGTCGCTGTC	GGAGTCGGAATCTGAATCGCTGTCAGAGTCAGAATCACTA
TCGGAATCCGAGTCGCTGTC	CGAGTCGCTGTCTGAGTCGGAATCACTA
TCCGAGTCTGAGTCACTGTC	AGAGTCTGAGTCACTATCCGAGTCAGAATCGCTG
TCTGAGTCGGAATCACTGTC	GGAATCTGAGTCGCTATCGGAATCGCTATCGGAATCCGAATCGCTG
TCCGAGTCGGAATCACTGTC	GCTATCTGAGTCACTGTCCGAGTCAGAATCGCTG
TCGGAGTCGGAATCACTATC	AGAATCTGAGTCGCTGTCGGAGTCGGAATCGCTG
TCGGAGTCGGAATCGCTGTC	GCTATCTGAGTCAGAGTCACTATCGGAATCTGAGTCACTG
TCAGAATCGGAATCGCTGTC	GGAATCTGAATCACTATCGGAATCGGAATCGGAATCGCTG
TCGGAATCGGAATCGCTGTC	GCTATCCGAATCACTATCGGAATCTGAATCACTG
TCGGAGTCGGAATCACTGTC	GCTATCCGAATCGCTGTCCGAATCGGAGTCGCTGTCCGAATCTGAATCGCTG
TCGGAATCTGAATCGCTGTC	AGAGTCAGAATCACTATCGGAATCCGAGTCACTGTCGGAATCACTA
TCGGAATCCGAGTCGCTGTC	GCTGTCCGAATCACTATCGGAATCGGAGTCACTGTCAGAGTCTGAATCGCTGTCGGAGTCGGAATCACTA
TCGGAATCGGAGTCGGAATC	GCTGTCGCTATCTGAATCACTGTCTGAGTCGGAATCGCTGTTGGAGTCGGAATCGCTGTCGCTATCTGAGTCAGAGTCACTA
TCGGAGTCGGAATCGCTGTC	GCCATCTGAGTCAGAGTCACTATCGGAATCTGAATCGCTATCGGAATCTGAGTCACTG
TCCGAGTCAGAATCGCTGTC	GGAGTCCGAGTCACTGTCCGAATCCGAGTCGCTGTCGGAGTCCGAGTCGCTG
TCAGAATCTGAATCGCTGTC	GCTATCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCGGAGTCAGAGTCACTGTCCGAATCCGAATCGCTG
TCGGAATCTGAATCGCTGTC	ACTATCCGAATCGCTGTCAGAATCTGAGTCACTGTCAGAATCCGAGTCACTGTCCGAATCCGAGTCACTG
TCCGAATCTGAATCGCTGTC	ACTATCCGAATCGCTGTCAGAATCGCTGTCGGAATCGGAATCACTGTCACTATCCGAATCGCTG
TCAGAATCGGAGTCGCTGTC	CGAGTCGGAATCACTATCGGAATCCGAGTCACTGTCAGAATCGGAGTCTGAGTCGCTGTCTGAGTCCGAGTCACTA
TCGGAGTCGGAATCGCTGTC	CGAGTCTGAGTCACTGTCGGAATCCGAGTCGCTGTCTGAGTCTGAATCTGAATCGCTG
TCGGAATCCGAGTCACTGTC	GCTATCCGAATCGCTGTCTGAATCTGAATCACTATCCGAGTCTGAATCGCTG
TCGGAGTCAGAATCATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022130.1\|WP_088769740.1\|511491_513000_-\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP022130.1\|WP_088769739.1\|509728_509926_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_088769748.1\|537901_539227_+\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP022130.1\|WP_088769737.1\|500697_501540_+\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP022130.1\|WP_088769749.1\|539569_540472_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP022130.1\|WP_088769746.1\|535003_536395_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|236904
NZ_CP022130.1\|WP_050340227.1\|502535_504206_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP022130.1\|WP_088769744.1\|531945_533454_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP022130.1\|WP_088769741.1\|513026_514661_-\|glycosyl-transferase-family-1	unknown	unknown	unknown
NZ_CP022130.1\|WP_050340212.1\|531158_531878_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_050340224.1\|508224_508875_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP022130.1\|WP_088769750.1\|540464_541679_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341026
NZ_CP022130.1\|WP_003638377.1\|501787_502528_-\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP022130.1\|WP_088769743.1\|528115_529624_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP022130.1\|WP_050340225.1\|505318_507745_-\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP022130.1\|WP_021336284.1\|499036_500440_-\|dipeptidase-PepV	unknown	unknown	gnl\|CDD\|235988
NZ_CP022130.1\|WP_191982850.1\|508943_509471_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|377744
NZ_CP022130.1\|WP_175365135.1\|529760_530951_-\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP022130.1\|WP_088769747.1\|536955_537915_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NZ_CP022130.1\|WP_088769745.1\|533975_534890_-\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899

Protein	Function_ID	Function_description	E-value
NZ_CP022130.1\|WP_088769740.1\|511491_513000_-\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	4.39626e-72
NZ_CP022130.1\|WP_088769747.1\|536955_537915_+\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	4.4698e-117
NZ_CP022130.1\|WP_088769748.1\|537901_539227_+\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	1.53986e-151
NZ_CP022130.1\|WP_088769737.1\|500697_501540_+\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	5.64643e-81
NZ_CP022130.1\|WP_088769749.1\|539569_540472_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	6.88793e-49
NZ_CP022130.1\|WP_088769746.1\|535003_536395_+\|amino-acid-permease	gnl\|CDD\|236904	PRK11387, PRK11387, S-methylmethionine permease.	0
NZ_CP022130.1\|WP_191982850.1\|508943_509471_+\|SAM-dependent-methyltransferase	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	2.45406e-68
NZ_CP022130.1\|WP_088769744.1\|531945_533454_-\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.601e-95
NZ_CP022130.1\|WP_088769750.1\|540464_541679_-\|MFS-transporter	gnl\|CDD\|341026	cd17473, MFS_arabinose_efflux_permease_like, Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily. This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.16868e-61
NZ_CP022130.1\|WP_050340224.1\|508224_508875_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	7.83062e-44
NZ_CP022130.1\|WP_003638377.1\|501787_502528_-\|rRNA-pseudouridine-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	1.20583e-85
NZ_CP022130.1\|WP_088769743.1\|528115_529624_-\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.82338e-73
NZ_CP022130.1\|WP_050340225.1\|505318_507745_-\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP022130.1\|WP_021336284.1\|499036_500440_-\|dipeptidase-PepV	gnl\|CDD\|235988	PRK07318, PRK07318, dipeptidase PepV; Reviewed.	0
NZ_CP022130.1\|WP_050340227.1\|502535_504206_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	5.8073e-131
NZ_CP022130.1\|WP_175365135.1\|529760_530951_-\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP022130.1\|WP_088769745.1\|533975_534890_-\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	5.12604e-158

>NZ_CP022130.1|WP_088769741.1|513026_514661_-|glycosyl-transferase-family-1
MQKSVVKKLKQALIDIGNLQNDASQKVTLALSVSDKRHRASVKFYRGDTFNDVWQSIATVLGATSNNSWVRLDIVQGVQVLARKLFEEKLFKITKMNFWRYGVSFDADFRTALLETEINGQAFFKPSKASRVGDGHANSWADYDRIADYLKTREPDLDVDIAQVSHVWSFTTSGVFFDGQQIHTLETDGYLEKGIRKITNERETINQVISEGESYLMRQLDEAGKFVYGYFPALQRVLTSYNYLRHFSTVYALLEAAEQTKRSADFPRIKRALQWGINHSLLKVDDAVYLSDKDELKLGSQAMLILALCKYQELSLDRTFAPVLQQAFNGIKEFWNSETGFIHVLNEDLTLKSGFRIIYYDGEAVFALCRLYELQPNDETKQLVREMLDRMVANDYGQFHDHWIAYAINEALSVFPDNQDYMKLGIKNVFTHFNYIKNRVHASPTLLELLDASQKMVDRIQRSGNDELLADYEVPVLHQLMHRRALYEIQAGAWLPEIAMYLYRPEKFVGGFYARDDNFRTRIDDSEHFLSGLVNYYNYTYRQA
>NZ_CP022130.1|WP_088769740.1|511491_513000_-|accessory-Sec-system-glycosyltransferase-Asp1
MFYFINEYILGKNSSVEHAAINRVKLFNHHKAPAKIVTKMYDRLLHQTMGTFGLANEQVLNMFDYFQGTTDVPVKVLHTEDMRLPKEYAVEVGANFSKVFNGDDLVSNVGFIPGTIGRVFYQEFFDNQGNLTATDLWDWRGFKSSTQYFGQNGKLVLERYYNLQGQTVMEQYFVPDTNGNPLASRLILKNYRGQVERFFQDANQLFRFFLAELSHEDQDTTTFISDRPGTSVLPLLELQDDSHKYVTVPIYHAKDINDPVHAPLDGFLTPAFDNLQHFDGFITSTESQAQHLKTRFSKANVTVLPAVTTSPMAQSKLRPILERPKELLYVGRIAPDRQLDQLIRVIALVKQQLQDVQCDFYGYGDPEYIKTLTKLIEELKLTNNVHLLDYHPDLEKRYDDYQVLLNTDLVDGGPMSMPEAMSHGIPVVSYRFNYGPKDFINDGQDGFVVDAGNQLAMRDRVLELMTDTKKLTAFSEAAFKKMHTSQTELKVWHRWQQLLGLK
>NZ_CP022130.1|WP_088769739.1|509728_509926_-|hypothetical-protein
MLMIMTIYGTVKMFTRLIVYCGIGGIVLIIRHHNRKKRRQEMEEGTKKIMRETPKDENGKYPWEK
>NZ_CP022130.1|WP_191982850.1|508943_509471_+|SAM-dependent-methyltransferase
MNQVVNPGDHVIDATVGNGHDTVYLAKLVGTTGHVDGFDIQPAAIAATTKALTAAGFNRQATLWQTGHEHIADKIAADEPIKCAVFNLGYLPGGDKSIITKPTTTLTAIKAIQERLVTNGLIILLVYAGHPGGAAEAKAVLDYATSLDQHQFQVLQYQFVNQVHVPPYLLAIQKR
>NZ_CP022130.1|WP_050340224.1|508224_508875_+|phosphatase-PAP2-family-protein
MKQRAWRHSDWVMAVIFLIWLGWTAAVWQRATWLVQFDTHVANFWHASPQWFQRIMVGYTQLGNPHAITLITLLIGATIWLRHDQRATLFFWGNTWILAGYGNYLVKQVIQRPRPTAWRLLEIGGYSYPSGHSTTTTVLIGSLLVLAFDYWHRQPKTNLLAVLGCAAILLMMISRVVVGVHYPSDTIGGLLLGSVLLYISTRLSGPYRHGPLKRPS
>NZ_CP022130.1|WP_050340225.1|505318_507745_-|leucine--tRNA-ligase
MAYNHKVIERKWQHYWKENKTFKTLDTTDKKKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRFKRMQGYNVLHPMGWDAFGLPAEQYALKTGHNPKDFTAKNIKNFKRQIRSLGFSYDWDREVNTTDPSYYKWTQWIFEQLYKKGLAYESETLVNWAPDMMGGTVVSNEEVVDGKTERGGYDVYRVPMKQWSLKITAYADRLIDDLDDIDWPENIKEQQRNWIGRSVGASIRFKVADQPEDTEIEVFSTRPDTLFGASYMVLAPEHDLVEQLTTPEQADAIEAYKQKIASKSDLERTDLNKDKTGVFTGSYGINPVNGEKLPIWIADYVLASYGTGAIMAVPAHDDRDFEFAKKFDLPIKPVIAGDNDYDQQAYTGDGEHINSGFVDGLAKQPAIDKMIDWLGEHHAGEKKVNYRLRDWIFSRQRYWGEPIPVIHWEDGETTLVPEDELPLRLPATKNLEPSGTGESPLANIDDWVNVVDENGRKGKRETNTMPQWAGSSWYFLRYVDPHNREALADYDKLKYWSPVDLYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLVNQGMILGDNHEKMSKSRGNVVNPDDIVDQYGADTLRLYEMFMGPLEASIPWSTDGLHGANKWIERVWRLMIDENNRVRDRVTTINDGKLTKVYNETVKKVTEDYEAMRFNVAISQMMVFVNEAYKVDDLPIIYIEGFVKLLSPIAPHLCEELWSLLGHDDTITYAAWPTYDESKLVEDTVEVVLQVNGKVRSHAKVAKDMGKDELEKLALADDKIQEFTAGKTVRKVIAIPGKLVNVVAN
>NZ_CP022130.1|WP_050340227.1|502535_504206_-|polysaccharide-biosynthesis-protein
MSEESKANQPKTTHVNSEAEAHQKMVRGSAWMTAGSLFSRVLGAIYIIPWVIWMGADYTQGNALYAKGYNIYSFFLLIAIGGIPSAISKQLSEYNAMNEYAVGQRLFKRGLLLTSAFGIVGAIILWFGAGAISTAFGGYDANLIPVLHALAIALVILPSMSLTRGFFQGYQQMAPSAISQFVEQVFRVIYMLGATYFIMRVAHGDWVDAVTQSTFAAFVGAAASFLLLGWYYFRKRPELNALAAQSENQLVIPVWQLFRDIIIQAIPFIVIDTATTVFNLLDQATFQPMMRLIFHLGTKQIDTLYAYFAFNANKLVMIIVSLASAIAVTVVPILSESLASHNMRNIRKQLEDSIILFLFIMIPGALGMAAVAQPLNTLFYSYDQIGTLILQISAFTAIALGFFTVISALMQGLSRNRDIIRYYLIGLLVKIIIQFPCIYFLSTAGPLVATAIGMMVASLMAMYDLEVNFGIRYVKLLPKINRILVYSILTYATARLVVYGLNFILNEHSKTQSFLIVALAVIAGGAVYVYLALRSRMADLMIGTKAAGLRRKLRIK
>NZ_CP022130.1|WP_003638377.1|501787_502528_-|rRNA-pseudouridine-synthase
MRVDKFLHAMRIGTRTQVRRLIKDGHITANGEPVISGKQQIDPGNDAVFLDDAPVRYQQYFYYVMNKPVGVITATTDASAKTVMDLFNTTDFRDDLFPVGRLDKDTEGILVITNDGALSHDLLSPNHHVTKVYQAEVTGEITAAQLAAFNDGITLKDGTELQPAQAEIIQFHEIENFTTIEIKIHEGKYHQVKRMVGTLGERVVGLRRIKFGSLTLPVGLLAGNYRALTDDEVAALKADAHQPVGE
>NZ_CP022130.1|WP_088769737.1|500697_501540_+|NAD(P)H-hydrate-dehydratase
MQPITTEIVSRTIIKRPADSYKGTYGRVMLIGGNQNFGGAIIMAATAATYSGAGLVTVATDPTNFTSLHAQLPEAMVMDYHQTDALLQLLAGMDVIVIGPGLGTDTVADQLLSTVLTAAHAPQRLVLDGSALTLLAQHSRALPATDIVVTPHQMEWQRLSGIAIKDQTPTANHDAQQRLGVTAVVKAHRTTVYTNERVWFNPGGTPAMATGGMGDTLAGMIGGFVGQFDNFTNAILSAVYLHSAIADDLAATRYVVLPHQISAQIPRYMHRFSQETPAES
>NZ_CP022130.1|WP_021336284.1|499036_500440_-|dipeptidase-PepV
MSVDWKNEATKHQEDYLADLTTMLRVPSFRDDSQATDDAPLGPGPKQALTTFLAIAERDGFKTKNIDNLVGYAEIGEGDETLAILAHVDEMPAGNGWDTDPFEPTIKDGKMYARGVSDDKGPGMAAYYGLKIVKELGLKLNKKIRFIVGTDEESNWTGMKRYFEVEPAPTLGFSPDAMFPLINGEKGNVSLQLQFGHEDGGDFNLVSFDAGLRENMVPRDAEAIVSTSDNEQFAADFTAFLDQQPVTGELTVVPEGVKLEVVGKAAHGMEPRNGINAGTYLATFLTNYAFGDDAAAFLDFIAHKLHDDSRAKELGLAFTDDVMGDLTMNVGLLSFDHQKGGQVTLNFRYPKGIEPADLTAKVQAQLPAGATVSQGDFMVPHYVDPEDPIVKDLMDVYRRQTGDTASQPQIVGGGTYGRMMARGVAFGALFPDTEDTMHQANEFQPIDELMAAMAIYAESIAVLATDK
>NZ_CP022130.1|WP_088769743.1|528115_529624_-|MFS-transporter
MQQRKTNVVAVTIAIYVATFMSAIEGTIVSTALPTIVGDLHGVSLMNWVFSIYLLTNAMMTPIYGKLTDLVGRKPVMQAGLIIFIIGSMMSGLSNSMPVLIFWRAIQGIGAGALMPVSMTIIADIYSFERRAKVLGFNSSAWGIASVLAPLIGGLIVDKLSWHWIFFINVPVGLITLFLFQFYLREPKRHNDVKIDYLGSWWLMLFLLCLMLSFQLLGNATISWTAVIAAWVISALSLWLFIRRESRTDEPVISMDLFKNRTFVIQNAVAALVSGFLMAVEVYIPTWTQGILGVPASLAGFAVTPSSLMWIVGSFVTGRLLAKWAPRRILYLSLAFILVTSICLAWLPVTTAFPWFFLITAIGGIGFGITITATTVTSQHLVPAKNVGVATSFNTLSRTIGQTLMISIFGIALNVGMNQGIQQHPATNMAMLNKLINPQTATELPQHLLPTLHRILYTGLHWVYLIGLGLVILALLVNSLDRGVQKTAAEHAADLNHNHGEL
>NZ_CP022130.1|WP_175365135.1|529760_530951_-|methionine-adenosyltransferase
MVSERHLFTSESVSEGHPDKIADQISDAILDAMLAQDPQARVAVETSVTTGLVLVFGEVSTKAYVDIQKVVRDTIKSIGYVDGQYGFDGDNCAVLVSLDEQSPDIAQGVDDSLETRTGDADPLDQIGAGDQGMMFGYAINETPELMPLPIALSHRLMRKIAALRKAGTIKWLRPDAKAQVTVEYDEANQPQRIDTVVLSTQHDPDVDLDTIRQTVIEQVIKAELPAELLDDKTKYLVNPTGRFVIGGPQGDAGLTGRKVIVDTYGGFAHHGGGAFSGKDATKVDRSASYAARYIAKNVVAAGLADQVEVQLAYAIGVAEPVSIAVDTAGTGKVSDEALIAAIRKNFDLRPAGIIKMLDLQRPIYRQTAAYGHFGRTDIDLPWEHTDKVDALKAEFK
>NZ_CP022130.1|WP_050340212.1|531158_531878_+|hypothetical-protein
MIRIGKLHLKRDYVALAVYAIAQSIISWWAALDYGRSFQTATFSAAQLPLIGYTLAVAAAVFIILDRRIAPQWSLIAIGITVALAFTNIIAKESELLYLLLTCSAWLLIMAVPRFGMQNYFGLVVFGVIMTYTIPVAVFDLQNNYLSTTFLWKLVPMLASYVFLYVPSFSHQRQINQLISAITGALLVITIFLQPLTWQTILAILITIAVWFSQQSYGRTRRHLMINVGVQLILMFLLY
>NZ_CP022130.1|WP_088769744.1|531945_533454_-|glycosyltransferase
MYYFVGTGLGQKLTGIEKAQLNRLSLFEAAGLQAKCVYVDYNPRLNEHAKRFGALGKCFSLYDFFQETMPEMVEATTHDWRNYWQSTCHFKLVRVSEANDYRIFDVDGRYLMYAHFVDSNFQQLDYVNYFDSHGVKVRREFYDNRGFLSRTSFLVKHQEVHTEVYYNPQGQIKLIKQYDISQPEPRLRLITLKDYHHRDFFFDSEQALQTFFFDELANAEDVYFCDRNRQTAAALSQTRSEVRVCSVLHSTHLRAGADVVTGPLKSVYRYVLTHPDQFYRIIVSTEHQKRDLLKRYDNLPPVVVIPVGYTNEHPIQRAGRKPNRIISVARYSPEKQLPHQLELVRRLVPEFPDLTLQLFGHGSKIERQMRQFIHTNHLEQHIFIRGFLPDLAAEYQQASLALMTSVEEGFSLATMEAESYGVPVIGYRIAYGPEDIIEDGINGYLITPDDIDELTDKVRHYLQHPEIHEQFLENAYRSSQRFSKQSVIEKWRQFTQNLQTKA
>NZ_CP022130.1|WP_088769745.1|533975_534890_-|homocysteine-S-methyltransferase
MISLTDLLTKGPVVSDGAMATELEKRGVETNSALWSATAMLDHPAAIQAVHQSYLDAGAQIMTTNTYQANVPAFEQAGIPAEQARQLIQKAVTVAHDARDASAATGAVIAGSIGPYGAYLADGSEYTGDYQLSPAAYQAFHQERLELMIDAGVDVLALETMPRLDEVQALVDLVTTQWPKQPYWVSFSIRDLQRLCDGTSLATAAQWVAAQPNVVAVGVNCTALENIEPALATLRAAVTIPLIVYPNSGDQYDPVTKTWQPTDLSHQFASFVPKWLAAGAQIIGGCCRTTPADIATVAQVVAHR
>NZ_CP022130.1|WP_088769746.1|535003_536395_+|amino-acid-permease
MSKQTHLSRQMESRHVLMISLGGVIGTGLFLSSGYTIHQAGPIGTLIAYTIGAVLVYLVMLCLGELSVAMPYTGAFHVYAKKYIGPGTGFTVAILYWLTWTIALGSEFTAAGLIMQTWFPHIATWIWSLVFMVVIFTVNALSVRWFAEAEFWFASIKVVAIVVFIVLGALAMIGLLPLHGHASAPLLTNYTRNGWFPNGFGGVFTTMLTVNFAFSGTELIGITAGETKDPAHTIPTAIKTTLWRLIIFFVGSMFVMAALIPYKQAGVTQSPFVLVFKEIGIPYAADLMNFVVLTAIMSAANSGLYASTRMLWSLANEGTIPQVFKKTTKRDVPLVALITSMLGSILALLSSVYAAGSVYLVLVSISGLAVVIVWMAIALSEINFRKAYLKSGQSLDKLAYKTPGYPVVPWLAFILSGLSCLLIWFDPNQRIALYYTVPFVAICYLGYYLSRKFKQHPATNTEK
>NZ_CP022130.1|WP_088769747.1|536955_537915_+|ferrochelatase
MHPGLLLVNLGSPASPTTQDVKTYLQEFLSDPSVIEMPAALWQPLLRGIILPTRSWRSATFYQDSWLPAGSPLIVYSEKICEQVQADLPDWDVRLAMTYGQPDIGETLQAMVADGCEQPIVLPLFPQYTQSTHGGIHRQVEATGLPHTFIDHFYDNATYIQLLAAKVWESYQQHDFDAVIFSYHSIPTAMVRHGDPYQKECEATTAAVLAQLPELPADKVVTAYQSKFGPMPWLKPYLRNELMQLVELGKRNVLIATPSFVVDCLETLEEDYVQNYQTFKSSGGDRFELVSPMNTDPQFSQLLADLAVQKWEARAHATT
>NZ_CP022130.1|WP_088769748.1|537901_539227_+|Nramp-family-divalent-metal-transporter
MQPRSHQSLEEINQSVAVPDVHQTAFWRKFLAYSGPGALVAVGYMDPGNWLTSLAGGGQFQYRLLTVLALAIIVAMFMQALAIKLGVVARQDLAQAIAAKLPRPIRYALWILNEIAMMATDMTGVIGTAIALKLLFGLPLLAGILLTIADVLVVLLFLRFGIRRVEFLVLAAIISVGIIFGLEVGRAHVQVGQMMLGLVPNSLIIKNHTALVLSLGILGATIMPHNLYLHSSLAQSRRYDYHDPLQVNEALRFANWDSTVHLIAAFLINALLLVLGGTLFFGHTTALASLQAVFNGLKNPAIVGALASPFMSWLFALALLITGLISSITSTLAGQIVMEGYLHIRLPLWQRRLLTRAVTLIPILIIGFMVGFSDAAFENLIIYAQVALSVALPFTLLPLVALTNNRQLMGSHVNRPAVTWLGYGLAGIITILNIYLVYSLF
>NZ_CP022130.1|WP_088769749.1|539569_540472_-|ROK-family-protein
MTNQYLCFDIGGTNLKAGLLDANGGQIQPATSIPMAQDLAAFWQQLFTIADQYVGQIAGIAVSVPGQVDPQTGIVYHGGALPFLDQCPLQQTLAMRYQLPVAVENDGKAAALAENWRGSLQGCQNGLVLVLGTGVGGGLIIHNQLYRGSHFQAGELSMMLAASTSAPIKITGQTGSAVGMISAIAHELQLPDEHDGRQVFAALAAGDPKALEMFNAYGHQVAQIILNVQAVMDLNVVAIGGGISAQPSVVPMIQRQYAELLEQLPMIRDTLSQPQIVAAKFHNQANLIGALAALLGMATV
>NZ_CP022130.1|WP_088769750.1|540464_541679_-|MFS-transporter
MKAKQDRFIFKASLLSISLFLMMAPQIASALPLMYHAFKGVQAAGVQTLSTIPNFGIVAGLLISPFMVRWFHEKATIIIGLLVTLIAGTFPMYASAYVPILISRFLIGLGIGLFNSLAVSLIPQFYKRDEDELARMIGYQNVMGSVGAAIASFLVSYLVTISWHAAFAIYLLVIPVLILFALFVPLPHTAAPRQTNQTETKATGSHQINRPVVVISILMFLVFTFYMPFSYELPSLIVNEGLGNASTAALIAGLSTLVSIPIGASFGFFFKRLHDRIFPLGFVLVAAGFLLIAVATNIIFLFIAVVILGFGFGLGVPYLYNWLDWAAPEQSLNLATTIVLVLVNIGCFVSPTIMDALAGAVGHGTPRGMMVLSGVAFICIAIYAVGHYLHVHRTQANAAGDSRD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022130_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022130_4

547578-548888

Orphan

Consensus_repeat	Method
CTGTTCCCCGTGTATGCGGGGGTGATCC	CRISPRCasFinder
CTGTTCCCCGTGTATGCGGGGGTGATCC	CRT
CTGTTCCCCGTGTATGCGGGGGTGATCC	PILER-CR

21 spacers

The CRISPR arrays of NZ_CP022130_4

>merge|NZ_CP022130|4|547578-548888|CRISPRCasFinder,CRT,PILER-CR
CTGTTCCCCGTGTATGCGGGGGTGATCCTTGATGATGATTATCAGTGATAAAGCCAACGTTCTGTTCCCCGTGTATGCGGGGGTGATCCTAGGCGGGAATGCGTCTTTGATGTCTTTGACGCCTGTTCCCCGTGTATGCGGGGGTGATCCTTAATGGCGATGTGAAGGTTAGCGAGGTATGAACTGTTCCCCGTGTATGCGGGGGTGATCCCTATTAATGCACATCGTTTTGGATATGGCAGTGCTGTTCCCCGTGTATGCGGGGGTGATCCTATCATCTTTGGTCAAATAATTTGCATCAGGGCCTGTTCCCCGTGTATGCGGGGGTGATCCTAAATCCTGTGACTTTAAAGAATAAGCTTGATCCTGTTCCCCGTGTATGCGGGGGTGATCCCACTGAATGCAGTGGCGTTGTTAGATACACCATCTGTTCCCCGTGTATGCGGGGGTGATCCTGAGGTATAATGATCGAGTAACGTTGGTTTATTCTGTTCCCCGTGTATGCGGGGGTGATCCTCTTGCTAAATGGATCTTCAGGATCACCAAGCACTGTTCCCCGTGTATGCGGGGGTGATCCCTAAGCAGTATGACGCGGCTGGCTGGTCAACGTCTGTTCCCCGTGTATGCGGGGGTGATCCCGATTAACGTATTTTTTAGTGTTCATTCTTTTTCTGTTCCCCGTGTATGCGGGGGTGATCCCACATACGTTTATGATAAGGATAAAGAAGGCAACTGTTCCCCGTGTATGCGGGGGTGATCCCAACTGCAACAGGGTGTGAAGAACAGTATGAGACTGTTCCCCGTGTATGCGGGGGTGATCCTATTGTTCTCTGGTACATAATAATAATAAGTACCTGTTCCCCGTGTATGCGGGGGTGATCCCAAGCCAATTATCAAAGATGACGGAGGTGATGACTGTTCCCCGTGTATGCGGGGGTGATCCCCGAAAAGTTACGGCTAATCGTTCCGATAAGTTCTGTTCCCCGTGTATGCGGGGGTGATCCTGTTAAGTGAACTTGGTCAAGCGACAAGTGATACTGTTCCCCGTGTATGCGGGGGTGATCCCATAACGCTATTGAATCGGCAATGTTTGAAAAGGCTGTTCCCCGTGTATGCGGGGGTGATCCTTTTGGTAAGACGGGGTTAGCCACCAGTGTGGTCTGTTCCCCGTGTATGCGGGGGTGATCCTCTTCTTGGACGGAAGCCGGTAAAATATTCTTTGCTGTTCCCCGCGTATGCGGGGGTGATCCTGCCATCATGGGGACCACCGGCTAACAAAATTGCTGTTCCCCGCGTATGCAGGGATGATCC

>NZ_CP022130|4|3|547578-548888|CRISPRCasFinder
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTGATGATGATTATCAGTGATAAAGCCAACGTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TAGGCGGGAATGCGTCTTTGATGTCTTTGACGC
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTAATGGCGATGTGAAGGTTAGCGAGGTATGAA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CTATTAATGCACATCGTTTTGGATATGGCAGTG
CTGTTCCCCGTGTATGCGGGGGTGATCC	TATCATCTTTGGTCAAATAATTTGCATCAGGGC
CTGTTCCCCGTGTATGCGGGGGTGATCC	TAAATCCTGTGACTTTAAAGAATAAGCTTGATC
CTGTTCCCCGTGTATGCGGGGGTGATCC	CACTGAATGCAGTGGCGTTGTTAGATACACCAT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TGAGGTATAATGATCGAGTAACGTTGGTTTATT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TCTTGCTAAATGGATCTTCAGGATCACCAAGCA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CTAAGCAGTATGACGCGGCTGGCTGGTCAACGT
CTGTTCCCCGTGTATGCGGGGGTGATCC	CGATTAACGTATTTTTTAGTGTTCATTCTTTTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	CACATACGTTTATGATAAGGATAAAGAAGGCAA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CAACTGCAACAGGGTGTGAAGAACAGTATGAGA
CTGTTCCCCGTGTATGCGGGGGTGATCC	TATTGTTCTCTGGTACATAATAATAATAAGTAC
CTGTTCCCCGTGTATGCGGGGGTGATCC	CAAGCCAATTATCAAAGATGACGGAGGTGATGA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CCGAAAAGTTACGGCTAATCGTTCCGATAAGTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TGTTAAGTGAACTTGGTCAAGCGACAAGTGATA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CATAACGCTATTGAATCGGCAATGTTTGAAAAGG
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTTTGGTAAGACGGGGTTAGCCACCAGTGTGGT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TCTTCTTGGACGGAAGCCGGTAAAATATTCTTTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGCCATCATGGGGACCACCGGCTAACAAAATTG
CTGTTCCCCGCGTATGCAGGGATGATCC

>NZ_CP022130|4|4|547578-548888|CRT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTGATGATGATTATCAGTGATAAAGCCAACGTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TAGGCGGGAATGCGTCTTTGATGTCTTTGACGC
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTAATGGCGATGTGAAGGTTAGCGAGGTATGAA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CTATTAATGCACATCGTTTTGGATATGGCAGTG
CTGTTCCCCGTGTATGCGGGGGTGATCC	TATCATCTTTGGTCAAATAATTTGCATCAGGGC
CTGTTCCCCGTGTATGCGGGGGTGATCC	TAAATCCTGTGACTTTAAAGAATAAGCTTGATC
CTGTTCCCCGTGTATGCGGGGGTGATCC	CACTGAATGCAGTGGCGTTGTTAGATACACCAT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TGAGGTATAATGATCGAGTAACGTTGGTTTATT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TCTTGCTAAATGGATCTTCAGGATCACCAAGCA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CTAAGCAGTATGACGCGGCTGGCTGGTCAACGT
CTGTTCCCCGTGTATGCGGGGGTGATCC	CGATTAACGTATTTTTTAGTGTTCATTCTTTTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	CACATACGTTTATGATAAGGATAAAGAAGGCAA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CAACTGCAACAGGGTGTGAAGAACAGTATGAGA
CTGTTCCCCGTGTATGCGGGGGTGATCC	TATTGTTCTCTGGTACATAATAATAATAAGTAC
CTGTTCCCCGTGTATGCGGGGGTGATCC	CAAGCCAATTATCAAAGATGACGGAGGTGATGA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CCGAAAAGTTACGGCTAATCGTTCCGATAAGTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TGTTAAGTGAACTTGGTCAAGCGACAAGTGATA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CATAACGCTATTGAATCGGCAATGTTTGAAAAGG
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTTTGGTAAGACGGGGTTAGCCACCAGTGTGGT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TCTTCTTGGACGGAAGCCGGTAAAATATTCTTTG
CTGTTCCCCGCGTATGCGGGGGTGATCC	TGCCATCATGGGGACCACCGGCTAACAAAATTG
CTGTTCCCCGCGTATGCAGGGATGATCC

>NZ_CP022130|4|3|548249-548827|PILER-CR
CTGTTCCCCGTGTATGCGGGGGTGATCC	CACATACGTTTATGATAAGGATAAAGAAGGCAA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CAACTGCAACAGGGTGTGAAGAACAGTATGAGA
CTGTTCCCCGTGTATGCGGGGGTGATCC	TATTGTTCTCTGGTACATAATAATAATAAGTAC
CTGTTCCCCGTGTATGCGGGGGTGATCC	CAAGCCAATTATCAAAGATGACGGAGGTGATGA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CCGAAAAGTTACGGCTAATCGTTCCGATAAGTT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TGTTAAGTGAACTTGGTCAAGCGACAAGTGATA
CTGTTCCCCGTGTATGCGGGGGTGATCC	CATAACGCTATTGAATCGGCAATGTTTGAAAAGG
CTGTTCCCCGTGTATGCGGGGGTGATCC	TTTTGGTAAGACGGGGTTAGCCACCAGTGTGGT
CTGTTCCCCGTGTATGCGGGGGTGATCC	TCTTCTTGGACGGAAGCCGGTAAAATATTCTTTG
CTGTTCCCCGCGTATGCGGGGGTGATCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022130.1\|WP_088769760.1\|567652_569383_-\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP022130.1\|WP_088769754.1\|549137_549623_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_050340202.1\|545803_546325_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_088769748.1\|537901_539227_+\|Nramp-family-divalent-metal-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP022130.1\|WP_003638289.1\|559487_559724_-\|YkuJ-family-protein	unknown	unknown	gnl\|CDD\|370128
NZ_CP022130.1\|WP_003638352.1\|545086_545605_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP022130.1\|WP_088769749.1\|539569_540472_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP022130.1\|WP_088769750.1\|540464_541679_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341026
NZ_CP022130.1\|WP_088769758.1\|561224_562466_-\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP022130.1\|WP_088769753.1\|544136_544973_+\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|277320
NZ_CP022130.1\|WP_088769755.1\|549693_549888_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022130.1\|WP_088769752.1\|542871_543744_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP022130.1\|WP_088769756.1\|557222_559331_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP022130.1\|WP_088769757.1\|559916_561104_+\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|235985
NZ_CP022130.1\|WP_088769751.1\|541691_542582_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP022130.1\|WP_088769747.1\|536955_537915_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
NZ_CP022130.1\|WP_050340345.1\|562536_563586_-\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP022130.1\|WP_050340201.1\|546652_547210_+\|adenine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|180928
NZ_CP022130.1\|WP_003638285.1\|563589_564612_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP022130.1\|WP_088769759.1\|564664_565843_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340844

Protein	Function_ID	Function_description	E-value
NZ_CP022130.1\|WP_088769760.1\|567652_569383_-\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP022130.1\|WP_088769756.1\|557222_559331_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	1.25314e-166
NZ_CP022130.1\|WP_088769748.1\|537901_539227_+\|Nramp-family-divalent-metal-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	1.53986e-151
NZ_CP022130.1\|WP_003638289.1\|559487_559724_-\|YkuJ-family-protein	gnl\|CDD\|370128	pfam08796, DUF1797, Protein of unknown function (DUF1797). This is a domain of unknown function. It forms a central anti-parallel beta sheet with flanking alpha helical regions.	8.98362e-32
NZ_CP022130.1\|WP_003638352.1\|545086_545605_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.27122e-08
NZ_CP022130.1\|WP_088769749.1\|539569_540472_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	6.88793e-49
NZ_CP022130.1\|WP_088769750.1\|540464_541679_-\|MFS-transporter	gnl\|CDD\|341026	cd17473, MFS_arabinose_efflux_permease_like, Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily. This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.16868e-61
NZ_CP022130.1\|WP_088769758.1\|561224_562466_-\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	5.19811e-65
NZ_CP022130.1\|WP_088769753.1\|544136_544973_+\|metallophosphoesterase-family-protein	gnl\|CDD\|277320	cd00841, MPP_YfcE, Escherichia coli YfcE and related proteins, metallophosphatase domain. YfcE is a manganase-dependent metallophosphatase, found in bacteria and archaea, that cleaves bis-p-nitrophenyl phosphate, thymidine 5'-monophosphate-p-nitrophenyl ester, and p-nitrophenyl phosphorylcholine, but is unable to hydrolyze 2',3 ' or 3',5' cyclic nucleic phosphodiesters, and various phosphomonoesters, including p-nitrophenyl phosphate. This family also includes the Bacilus subtilis YsnB and Methanococcus jannaschii MJ0936 proteins. This domain family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	7.20811e-13
NZ_CP022130.1\|WP_088769752.1\|542871_543744_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.01251e-17
NZ_CP022130.1\|WP_003638285.1\|563589_564612_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.11313e-28
NZ_CP022130.1\|WP_088769757.1\|559916_561104_+\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|235985	PRK07309, PRK07309, pyridoxal phosphate-dependent aminotransferase.	0
NZ_CP022130.1\|WP_088769751.1\|541691_542582_-\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	6.15416e-32
NZ_CP022130.1\|WP_088769747.1\|536955_537915_+\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	4.4698e-117
NZ_CP022130.1\|WP_050340345.1\|562536_563586_-\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	7.59025e-32
NZ_CP022130.1\|WP_050340201.1\|546652_547210_+\|adenine-phosphoribosyltransferase	gnl\|CDD\|180928	PRK07322, PRK07322, adenine phosphoribosyltransferase; Provisional.	1.62864e-81
NZ_CP022130.1\|WP_088769759.1\|564664_565843_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340844	cd03817, GT4_UGDG-like, UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.	2.0117e-133

>NZ_CP022130.1|WP_050340201.1|546652_547210_+|adenine-phosphoribosyltransferase
MQQYQLRLGPLTRNLPLIQIAPNTRIASFVLLGDAELTQYAAQQLAQRLTHTPFDYLVTMESKGIPLAQALSQLTHHPRFIVLRKSVKPYMTHPHTIAVTAITTHTPQQLVLDDADATLLRGKRVVIVDDVISTGGSLEAANRLLQQVGAQVVAQTAILAEGAAGTRTDIEFLAKLPLFDGNSSE
>NZ_CP022130.1|WP_050340202.1|545803_546325_-|hypothetical-protein
MSTVADFYLHDRPTLLFSLHPEPTQAIIDGSKLLEYRRRFFSEPFQAFVYTSGPNGGIRLYLRCDKGLQLSPDQLALVGALIQHDSPDVTAAYFKDAAQGVALPITAFTTLPNIPLAQLQQQFTNFVAPRSYVFLDRPARQAQLDWLLQQPCQPLQLIDWTRRYAALATLLAR
>NZ_CP022130.1|WP_003638352.1|545086_545605_+|GNAT-family-N-acetyltransferase
MYFKRATLDDLDQIIDILSDGRNQLAEAGVNQWQGDYPSRKQITADIMQGSAYLFNADDNATVGAVAVVPSPDETYDTANANWLNTTDPYVVIHRVAIHSSHAGHGYATQLFEKIIAHIAAEHPEIKSIRIDTHADNLAMQHLIAKMNFERVGDMVGVYHVDDVCYVYEKLL
>NZ_CP022130.1|WP_088769753.1|544136_544973_+|metallophosphoesterase-family-protein
MVKIAVLSDVHGNATALEAVLADARAQQVDEYWTVGDMTVRGPESERVLSLLDAVAPTAYVLGNHEENYQKVLTANPNTFTKPKQVMATVLTAFDRRQLSPEHFERCLNLPMTVTKQVGPLTIRLQHVLPTVASGHALAPTASQANFDEATTGDVDIVIYAHTHTPIMRYGTGGKLILNAGTVGLPTALNPNLRQPRASYLVLTIDASGLQQIDYRSVDFDWKQAITIAHQAHLPYVEFYEQTLRTNAYQYAPSAVAAYNTQHDMAQEARKILLENRR
>NZ_CP022130.1|WP_088769752.1|542871_543744_-|AraC-family-transcriptional-regulator
MATSFQHEIVTRTQPLSAWIHYHDQHAPSEIAAHWHQGIELSYTISGHIDDFTINGRHFRTSAGQLLVVNSQLIHSIHTHNTPESRALSVIYPYDYVRRLYPKIETEIIAVNDPHQFTSAQQAMYLNLQGHFDQLYLALQRPSAVTNLRLEAETVQILAELLTYFTSAKASTGVMYGKDALAVERIQKISTYVAQHYTEPISLTDVAQQINVTKEYLTRFFKKQMAMTVGQYVNLVRAQHAYEDLLGERGNLTTIASMNGFASTRALNRAFQTVYHQSAAEIYKTKHTWD
>NZ_CP022130.1|WP_088769751.1|541691_542582_-|alpha/beta-hydrolase
MTGKDLKQAIIELRTAFKTNDDARDAGLPREVAGVERLDDLSYGPDPKWHLLDLYRPTDAPRPLPVIINIHGGGWCYGTKETYQFYGLNWAQRGFAFVNPNYRLAPDAVFPDELDDVDRYIHWVADHADEYGLDRNNVFLLGDSAGGQMAEQYAAILTNPDYRDLFGYQLTDLHFRAVVLNSAAAFPLDEGMVTGAVAAYFTPEAIQKQRDQIEAERYIQANYLPTFICTATEDFIRNNSAKLDGFLTAKGIEHVFKMYGDEKHPRGHVFLVSQKDDIAKQATDDEMAFLNAHLSK
>NZ_CP022130.1|WP_088769750.1|540464_541679_-|MFS-transporter
MKAKQDRFIFKASLLSISLFLMMAPQIASALPLMYHAFKGVQAAGVQTLSTIPNFGIVAGLLISPFMVRWFHEKATIIIGLLVTLIAGTFPMYASAYVPILISRFLIGLGIGLFNSLAVSLIPQFYKRDEDELARMIGYQNVMGSVGAAIASFLVSYLVTISWHAAFAIYLLVIPVLILFALFVPLPHTAAPRQTNQTETKATGSHQINRPVVVISILMFLVFTFYMPFSYELPSLIVNEGLGNASTAALIAGLSTLVSIPIGASFGFFFKRLHDRIFPLGFVLVAAGFLLIAVATNIIFLFIAVVILGFGFGLGVPYLYNWLDWAAPEQSLNLATTIVLVLVNIGCFVSPTIMDALAGAVGHGTPRGMMVLSGVAFICIAIYAVGHYLHVHRTQANAAGDSRD
>NZ_CP022130.1|WP_088769749.1|539569_540472_-|ROK-family-protein
MTNQYLCFDIGGTNLKAGLLDANGGQIQPATSIPMAQDLAAFWQQLFTIADQYVGQIAGIAVSVPGQVDPQTGIVYHGGALPFLDQCPLQQTLAMRYQLPVAVENDGKAAALAENWRGSLQGCQNGLVLVLGTGVGGGLIIHNQLYRGSHFQAGELSMMLAASTSAPIKITGQTGSAVGMISAIAHELQLPDEHDGRQVFAALAAGDPKALEMFNAYGHQVAQIILNVQAVMDLNVVAIGGGISAQPSVVPMIQRQYAELLEQLPMIRDTLSQPQIVAAKFHNQANLIGALAALLGMATV
>NZ_CP022130.1|WP_088769748.1|537901_539227_+|Nramp-family-divalent-metal-transporter
MQPRSHQSLEEINQSVAVPDVHQTAFWRKFLAYSGPGALVAVGYMDPGNWLTSLAGGGQFQYRLLTVLALAIIVAMFMQALAIKLGVVARQDLAQAIAAKLPRPIRYALWILNEIAMMATDMTGVIGTAIALKLLFGLPLLAGILLTIADVLVVLLFLRFGIRRVEFLVLAAIISVGIIFGLEVGRAHVQVGQMMLGLVPNSLIIKNHTALVLSLGILGATIMPHNLYLHSSLAQSRRYDYHDPLQVNEALRFANWDSTVHLIAAFLINALLLVLGGTLFFGHTTALASLQAVFNGLKNPAIVGALASPFMSWLFALALLITGLISSITSTLAGQIVMEGYLHIRLPLWQRRLLTRAVTLIPILIIGFMVGFSDAAFENLIIYAQVALSVALPFTLLPLVALTNNRQLMGSHVNRPAVTWLGYGLAGIITILNIYLVYSLF
>NZ_CP022130.1|WP_088769747.1|536955_537915_+|ferrochelatase
MHPGLLLVNLGSPASPTTQDVKTYLQEFLSDPSVIEMPAALWQPLLRGIILPTRSWRSATFYQDSWLPAGSPLIVYSEKICEQVQADLPDWDVRLAMTYGQPDIGETLQAMVADGCEQPIVLPLFPQYTQSTHGGIHRQVEATGLPHTFIDHFYDNATYIQLLAAKVWESYQQHDFDAVIFSYHSIPTAMVRHGDPYQKECEATTAAVLAQLPELPADKVVTAYQSKFGPMPWLKPYLRNELMQLVELGKRNVLIATPSFVVDCLETLEEDYVQNYQTFKSSGGDRFELVSPMNTDPQFSQLLADLAVQKWEARAHATT
>NZ_CP022130.1|WP_088769754.1|549137_549623_-|hypothetical-protein
MKTKALEDESNNTRSTTVYYDEKQLVSYYTTSTSIIEVKTAYDRKIFNGLRSLPEDNNQSIVLPAVEISWFGVAKNYQAKHIGASMILDIFRTVIKMRHVFNIGLIGIVVSSLPDALEFYTHYNFRYLHYNYDDEQAMMIPETYPLFVDIDSIVEIVGYLD
>NZ_CP022130.1|WP_088769755.1|549693_549888_-|hypothetical-protein
MAVMNDKKSLKQVITVSEHKDLYNVMNNLLPTTMGQHDTISRRKSINRAVTSLRKATLRFDTQK
>NZ_CP022130.1|WP_088769756.1|557222_559331_-|LTA-synthase-family-protein
MPKFIKNTVGKVNTTLGFYLLTVVLFWLKTYIAYKSEFTLGVKGPVQEFILFLNPFPTAIVLLGIALYFRGRLKYWIMMIIDAIQTTWLFANILYYREFSDFMSAGVIKSSGAASNNLGKSLGQIIHGTDFLVYADVVLLILLLAFKVIRIDPRPFKIRYAATLTMIGVALFAVDLGMSEHDRSDLLTRTFDNNYIVKYLGLNTYAGYSFYQTEKESATRAQASSSDMKSVLAYLKKNQAGENVKYFGKAKGKNVFVIHLESFQQFLIDYKVDGKEVTPNLNKFYHDKSTLSFDNFYHQVAQGKTSDAEMMMENSLFGLPTGSAMTQYGTSNTFQAAPAILAQKGYTTAAFHGDVASFWNRDNAYKSWGYDYFFYSSYYKEKADYNIGYGLKDKIFFKDSVKYLEQLPQPFYAKLITLTNHYPYELDKKNQSIDKTKTGDSTVDGYVQTAHYLDQAFAEFISYLKKAGLYKNSMIVLYGDHYGISNNHKAAIAQLLGKKSVTSFDLAQFQKVPFMIHSEGIKGGVNHTYGGEIDALPTIFDLLGIKNKGYIQFGTDLLSKQHNQTVAFRNGDFVSPTYTKISGTVYDSKTGKKLTNMTTKQKDTVKQMQNHVTTELSLSDRVIQGDLLRFYTPKGFKKVDKSKYSYKITKTLKSLKEIQAEKNTSLLSKRKGKSSESLYKTDAPELSSSSDSSSSSSSSSSD
>NZ_CP022130.1|WP_003638289.1|559487_559724_-|YkuJ-family-protein
MDKSELSAILKRLEAMRTTDATEVQSRRFEKEGVQRGQVAYDPATSTYTLQEFNPDQTFEFDNIDLVAIELYDLLTDN
>NZ_CP022130.1|WP_088769757.1|559916_561104_+|pyridoxal-phosphate-dependent-aminotransferase
MTLFRDDLNETISQIQVSTIRQFDEEVSAIPDMVKLTLGEPDFNTPEHVKAAAKKAIDDNFSHYTGMAGLLELRQAAANFQATKYGVHYDAEDQVLVTVGATEAIATALTTICNPGDAIIVPSPIFPAYIPIIQEAHARPLFMDTGINDFIITPKMVDDFIAAHPDEHFKGIILNYPNNPTGVTYVADEVKALAECFQRHNLWVVSDEIYSELTYGSDHVSIAKYIPDEVILINGLSKSHAMTGWRIGFLFASKEMTAQLKKVHQYYVTAATTIAQKAGVEALTNGMDDALPMRKKYQARRDFVYQTMSKLGFKIARPTGAFYIFAKIPAGFEQDSMVFCKDLARKNQLAIIPGTGFGAEGEGYVRLSYAASMEKLQLAMDRLTAYMQTPANRVD
>NZ_CP022130.1|WP_088769758.1|561224_562466_-|D-alanyl-D-alanine-carboxypeptidase
MLKLIKHRLATGLVLAAGMVGLLMGTPAVHAANKADEVKAAYIMDAQSGQVVYAQNADQKLPIASLSKLMTLYLVESAIQRGQIKWTDTVPIDKNVRKMATSATLSVMPMPAKEHFTVKELFAATLVGSSNSGAIALGEYVAGSNAKFIKLMNQQAAKWQLDAHFISASGLDNTDLTNYDLKIAGTGEQGQNMVSARAVTTIARHLINDYPDVIKVADQRSVKIHKYTVPTSVQILKGEKYYDYRVPVDGLKTGYTNQAGACLVATFRQNGRRMIATTLGGAWKFTANNNLRLMLKQTERYQQVAPKTIQYQIPGTTTKLQLETDSQTTMWQNTDHPMTQTKIELWPLHRTKPNYLAAGTAVLKLRLTDPLSGTVHNVIYRTPKALTMLGPVQWATQVKKSTTVSAAAFAMAK
>NZ_CP022130.1|WP_050340345.1|562536_563586_-|flippase-like-domain-containing-protein
MTRKNIWSLLIMVALGVGISWYSLRNVKLSNLMDDIVTLNWWWLLVALGCVGLYFGLEAVVVQKFVRHRYRHYTFRNALRVPLAEQLFNGITPFSSGGQPAQIFVMAQSGIDAGRASSVALMKFVVFQAMVVLNFLFSMLIGFHYLAEKLSYLSLYVLLGFLIHFGVIVGLLLVMYWYNFTKRAVKIVLIPVGWFMKAERFAKFEQNISDKIDSFYEESLRMTKDWRMLLEVSIVTFLQLFFYYLIPYFIMRAMGVDDVNLIMVTSLNVLIFLVTSLFPIPGGAGGAEFGFTALFAKFIPTHSKLILAMLIWRILTYYLGLFLGMIAMAMHPEKAEEIPMTEDSQETEL
>NZ_CP022130.1|WP_003638285.1|563589_564612_-|glycosyltransferase-family-4-protein
MLDITMFSKADSVKGQGVGSAYLELMRLLQTHWQDEFNIKVNRYGRSAISHYHTVNPMFYLSTFMPNRGRKIGYVHFLPETLEGSLKLPRPFQVIFNRYLISFYKRMDHIVVVNPTFIPKLEAYHIKRADVTYIPNFVSKREFYEMTKSKQLRLRQQYGYDQHKFMIIGTGQIQDRKGVPDFITLAKRNPDIQFVWAGGFSFGRITDGYQDLKQVVDNPPANLSFPGIVAREKLVDYYNMADLFLLPSYNELFPMSVLEAFSCGTPVLLRDLDLYRAIIDGYYQAATDVDDMQKQIDHLRNNPAGMQFLHDKAVLAAQDYSEERLASVWHDFYLQQAKEG
>NZ_CP022130.1|WP_088769759.1|564664_565843_-|glycosyltransferase-family-4-protein
MNIGIFTDTYYPQVSGVATSIKVLRNQLERAGHQVYIFTTTDPHVDKNIYERNIFRFTSIPFVSFTDRRIAVRGLFKAYQVAKDLGLDIVHTQTEFSMGMIGKFVAKQLKVPCIHTYHTMYEDYLHYIANGKLLKPYHVKEATRAYCYHLNGIVAPSDRVAKTLTGYGVKAPIRIIPTGIDINQYEQQSTADYRKQLGYQPDTPVLLSLSRLAYEKNIHEVIAALPAVLDQVPAAQLLIVGDGPARETLENQVEAAGLSDHVQFTGEIDNDAVYNYYQMADLFVSASNSESQGLTYIEAMAAGLKTVVASSPYTDQLLDDPSLGTTFTSEAGLVKDVVRYLQHPTTFDDPKPRQKKLYQISAEYFGKQVINYYQDVQLAYSESTDKSANISN
>NZ_CP022130.1|WP_088769760.1|567652_569383_-|phosphoenolpyruvate--protein-phosphotransferase
MAEKVLKGIAASDGIAIAKAYMLVDPDLSFEKTTVSDTDAEVARLHDAFDASKAELKVIKDKAVENLGEEEAEVFEAHITILSDPEMLGQIEGKIKDDKVNAEEALKEVTDTFISMFEAMTDNAYMQERAGDIRDVTKRVLSHLLGVTLPSPALIDSEVIVVAHDLTPSDTAQLDRKYVKGFITDIGGRTSHSAIMSRTLEIPAVVGSESATTDIKAGDTVVLDGINGDALVEPTDAEVTDYEQKAKDFVAQKAEWAKLKNEATVSKDGKHFELASNIGTPDDMDGVLDAGSEAIGLFRSEFLYMNSSELPDEETQFQAYKKVVEGMNGKPVIVRTMDIGGDKELPYLPLPDEMNPFLGYRAIRISLDRDDIFRTQLRALLRASHFGQLRIMFPMIATLDEFRKAKAIFEEEKAKLVAAGTPVADDIKLGIMIEIPAAAILADQFAKEVDFFSIGTNDLIQYSFAADRGNEQVSYLYQPYNPSLLRLIKHVIDAAHANGRFTGMCGEVAGDQIAVPLLMGLGLDEFSMSSTSVLKTRSLMKKLDTKEMAKLADKALNECVTNEEVKELVEKNVFDK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP022130_1	1.9\|299815\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299815-299846	32	NC_006936	Lactobacillus phage phiJL-1, complete genome	13761-13792	0	1.0
NZ_CP022130_1	1.9\|299815\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299815-299846	32	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	13761-13792	0	1.0
NZ_CP022130_1	1.21\|299814\|33\|NZ_CP022130\|PILER-CR	299814-299846	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	13760-13792	0	1.0
NZ_CP022130_1	1.21\|299814\|33\|NZ_CP022130\|PILER-CR	299814-299846	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	13760-13792	0	1.0
NZ_CP022130_2	2.5\|303253\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303253-303285	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	31404-31436	0	1.0
NZ_CP022130_2	2.5\|303253\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303253-303285	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	31404-31436	0	1.0
NZ_CP022130_2	2.18\|304046\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304046-304078	33	NC_019489	Lactobacillus phage Sha1, complete genome	3016-3048	0	1.0
NZ_CP022130_4	4.3\|547728\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	547728-547760	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	28056-28088	0	1.0
NZ_CP022130_4	4.3\|547728\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	547728-547760	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	28056-28088	0	1.0
NZ_CP022130_2	2.8\|303436\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303436-303468	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	32017-32049	1	0.97
NZ_CP022130_2	2.8\|303436\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303436-303468	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	32017-32049	1	0.97
NZ_CP022130_2	2.27\|304594\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304594-304626	33	MG788324	Lactobacillus phage PM411, complete genome	43634-43666	1	0.97
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3718-3757	1	0.975
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154477-154504	1	0.964
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155515-155542	1	0.964
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156295-156322	1	0.964
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154687-154720	1	0.971
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154705-154738	1	0.971
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154903-154936	1	0.971
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155101-155134	1	0.971
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155335-155368	1	0.971
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1330-1363	1	0.971
NZ_CP022130_3	3.74\|521001\|22\|NZ_CP022130\|CRT	521001-521022	22	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157171-157192	1	0.955
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156976	1	0.971
NZ_CP022130_1	1.6\|299632\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299632-299663	32	NC_006936	Lactobacillus phage phiJL-1, complete genome	14144-14175	2	0.938
NZ_CP022130_1	1.6\|299632\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299632-299663	32	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	14144-14175	2	0.938
NZ_CP022130_1	1.18\|299631\|33\|NZ_CP022130\|PILER-CR	299631-299663	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	14144-14176	2	0.939
NZ_CP022130_1	1.18\|299631\|33\|NZ_CP022130\|PILER-CR	299631-299663	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	14144-14176	2	0.939
NZ_CP022130_2	2.6\|303314\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303314-303346	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	36472-36504	2	0.939
NZ_CP022130_2	2.6\|303314\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303314-303346	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	36472-36504	2	0.939
NZ_CP022130_2	2.12\|303680\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303680-303712	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	12582-12614	2	0.939
NZ_CP022130_2	2.12\|303680\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303680-303712	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	12582-12614	2	0.939
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16085-16118	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16217-16250	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16349-16382	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16625-16658	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16937-16970	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17375-17408	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18293-18326	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18689-18722	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19793-19826	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21229-21262	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15850-15883	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9787-9820	2	0.941
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9931-9964	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154375-154408	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154429-154462	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151780-151813	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153115-153148	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154393-154426	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156481-156514	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156499-156532	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157549-157582	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3430-3463	2	0.941
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1108-1141	2	0.941
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21259-21286	2	0.929
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	994-1021	2	0.929
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15880-15907	2	0.929
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1624-1651	2	0.929
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1966-1993	2	0.929
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3556-3583	2	0.929
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9817-9844	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154105-154132	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154141-154168	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155839-155866	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157147-157174	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157489-157516	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	994-1021	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1498-1525	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1570-1597	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1858-1885	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1966-1993	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3370-3397	2	0.929
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3682-3709	2	0.929
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154864	2	0.941
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155830	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153937-153970	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154045-154078	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155905-155938	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154327-154360	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154759-154792	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155155-155188	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155389-155422	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2170-2203	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2188-2221	2	0.941
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3190-3223	2	0.941
NZ_CP022130_3	3.50\|519321\|34\|NZ_CP022130\|CRT	519321-519354	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1330-1363	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151864-151897	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154723-154756	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154777-154810	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154921-154954	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155119-155152	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155173-155206	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155227-155260	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155353-155386	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155407-155440	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157609-157642	2	0.941
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1834-1867	2	0.941
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154132	2	0.941
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154168	2	0.941
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16661-16694	2	0.941
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17021-17054	2	0.941
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17519-17552	2	0.941
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16061-16094	2	0.941
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16193-16226	2	0.941
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16325-16358	2	0.941
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17351-17384	2	0.941
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18665-18698	2	0.941
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19769-19802	2	0.941
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154351-154378	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154783-154810	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154999-155026	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155179-155206	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155233-155260	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155413-155440	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155449-155476	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156001-156028	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156229-156256	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15502-15529	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15628-15655	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3124-3151	2	0.929
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3286-3313	2	0.929
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151549	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151585	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151621	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154096	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153529-153562	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153991-154024	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155047-155080	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155281-155314	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2257	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	988-1021	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1222-1255	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1885	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2392-2425	2	0.941
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1060-1093	2	0.941
NZ_CP022130_4	4.4\|547789\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	547789-547821	33	MH809528	Lactobacillus phage Sabazios, complete genome	17354-17386	2	0.939
NZ_CP022130_4	4.7\|547972\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	547972-548004	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	11314-11346	2	0.939
NZ_CP022130_4	4.7\|547972\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	547972-548004	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	11314-11346	2	0.939
NZ_CP022130_4	4.8\|548033\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	548033-548065	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	12733-12765	2	0.939
NZ_CP022130_4	4.8\|548033\|33\|NZ_CP022130\|CRISPRCasFinder,CRT	548033-548065	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	12733-12765	2	0.939
NZ_CP022130_4	4.12\|548277\|33\|NZ_CP022130\|CRISPRCasFinder,CRT,PILER-CR	548277-548309	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	8038-8070	2	0.939
NZ_CP022130_4	4.12\|548277\|33\|NZ_CP022130\|CRISPRCasFinder,CRT,PILER-CR	548277-548309	33	MG765275	Lactobacillus phage Bassarid, complete genome	1778-1810	2	0.939
NZ_CP022130_4	4.12\|548277\|33\|NZ_CP022130\|CRISPRCasFinder,CRT,PILER-CR	548277-548309	33	MG765278	Lactobacillus phage Silenus, complete genome	1820-1852	2	0.939
NZ_CP022130_4	4.12\|548277\|33\|NZ_CP022130\|CRISPRCasFinder,CRT,PILER-CR	548277-548309	33	MH809528	Lactobacillus phage Sabazios, complete genome	1820-1852	2	0.939
NZ_CP022130_4	4.12\|548277\|33\|NZ_CP022130\|CRISPRCasFinder,CRT,PILER-CR	548277-548309	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	8038-8070	2	0.939
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	MG765278	Lactobacillus phage Silenus, complete genome	16090-16121	3	0.906
NZ_CP022130_1	1.11\|299937\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299937-299968	32	NZ_CP025693	Lactobacillus plantarum strain IRG1 plasmid pIRG103, complete sequence	9941-9972	3	0.906
NZ_CP022130_1	1.11\|299937\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299937-299968	32	NZ_CP024062	Lactobacillus plantarum strain KACC 92189 plasmid unnamed4	11919-11950	3	0.906
NZ_CP022130_2	2.14\|303802\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303802-303834	33	NC_006936	Lactobacillus phage phiJL-1, complete genome	11750-11782	3	0.909
NZ_CP022130_2	2.14\|303802\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303802-303834	33	AY236756	Lactobacillus plantarum bacteriophage phiJL-1, complete genome	11750-11782	3	0.909
NZ_CP022130_2	2.27\|304594\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304594-304626	33	NZ_CP018210	Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_1, complete sequence	24681-24713	3	0.909
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18593-18626	3	0.912
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21031-21064	3	0.912
NZ_CP022130_3	3.19\|517416\|34\|NZ_CP022130\|CRT	517416-517449	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15418-15451	3	0.912
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157597-157636	3	0.925
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156463-156496	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157027-157060	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157639-157672	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	25-58	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1288-1321	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2422-2455	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3724-3757	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1000-1033	3	0.912
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1018-1051	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153247-153280	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153727-153760	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153901-153934	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156439-156472	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-34	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	37-70	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1012-1045	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1858-1891	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2266-2299	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2662-2695	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2698-2731	3	0.912
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3286-3319	3	0.912
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155515-155548	3	0.912
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155839-155872	3	0.912
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157489-157522	3	0.912
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152965-152992	3	0.893
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3142-3169	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153865-153892	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153997-154024	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154369-154396	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154387-154414	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154531-154558	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154801-154828	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155017-155044	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155251-155278	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156421-156448	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156439-156466	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156457-156484	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156727-156754	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156877-156904	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157165-157192	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2794-2821	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3406-3433	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3718-3745	3	0.893
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3754-3781	3	0.893
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151390-151423	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151426-151459	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151498-151531	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151639	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153457-153490	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153877-153910	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154042	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154186	3	0.912
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155560	3	0.912
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19637-19670	3	0.912
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20015-20048	3	0.912
NZ_CP022130_3	3.43\|518853\|34\|NZ_CP022130\|CRT	518853-518886	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155731-155764	3	0.912
NZ_CP022130_3	3.43\|518853\|34\|NZ_CP022130\|CRT	518853-518886	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2788-2821	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151239-151272	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151879	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-152005	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152008-152041	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153157-153190	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153385-153418	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153475-153508	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153493-153526	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153511-153544	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154702	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154918	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154975-155008	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155116	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155209-155242	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155350	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155545-155578	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156031-156064	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156205-156238	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156343-156376	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156379-156412	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1258-1291	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1618-1651	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1888-1921	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2860-2893	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3100-3133	3	0.912
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3550-3583	3	0.912
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154363-154396	3	0.912
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156451-156484	3	0.912
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2638-2671	3	0.912
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2788-2821	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151624-151657	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154993-155026	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156469-156502	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156487-156520	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156505-156538	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157177-157210	3	0.912
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15496-15529	3	0.912
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18509-18542	3	0.912
NZ_CP022130_3	3.68\|520605\|52\|NZ_CP022130\|CRT	520605-520656	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154186	3	0.942
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17831-17864	3	0.912
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19313-19346	3	0.912
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157051-157084	3	0.912
NZ_CP022130_3	3.75\|521043\|34\|NZ_CP022130\|CRT	521043-521076	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3169	3	0.912
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16439-16472	3	0.912
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17117-17150	3	0.912
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154543-154576	3	0.912
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154813-154846	3	0.912
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153847-153874	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156121-156148	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156595-156622	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151522-151549	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151558-151585	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151594-151621	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151630-151657	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151684-151711	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151870-151897	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153319-153346	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153901-153928	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154069-154096	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154513-154540	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154729-154756	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154927-154954	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155125-155152	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155359-155386	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156175-156202	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156403-156430	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156631-156658	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156781-156808	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156949-156976	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157345-157372	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157417-157444	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	994-1021	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1048-1075	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3388-3415	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3700-3727	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16079-16106	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16211-16238	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16343-16370	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17369-17396	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17519-17546	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17585-17612	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18245-18272	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18683-18710	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18833-18860	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19727-19754	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19787-19814	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21025-21052	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1120-1147	3	0.893
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9547-9574	3	0.893
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151408-151441	3	0.912
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156721-156754	3	0.912
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156811-156844	3	0.912
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156871-156904	3	0.912
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156979-157012	3	0.912
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157609-157642	3	0.912
NZ_CP022130_3	3.95\|522297\|52\|NZ_CP022130\|CRT	522297-522348	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156187-156238	3	0.942
NZ_CP022130_1	1.23\|299936\|33\|NZ_CP022130\|PILER-CR	299936-299968	33	NZ_CP024062	Lactobacillus plantarum strain KACC 92189 plasmid unnamed4	11919-11951	4	0.879
NZ_CP022130_1	1.23\|299936\|33\|NZ_CP022130\|PILER-CR	299936-299968	33	NZ_CP025693	Lactobacillus plantarum strain IRG1 plasmid pIRG103, complete sequence	9940-9972	4	0.879
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1336-1375	4	0.9
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157309-157348	4	0.9
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21097-21136	4	0.9
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9655-9694	4	0.9
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157081-157114	4	0.882
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1072-1105	4	0.882
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1342-1375	4	0.882
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1900-1933	4	0.882
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1972-2005	4	0.882
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2686-2719	4	0.882
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2968-3001	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154441-154474	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154513-154546	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155497-155530	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156277-156310	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156835-156868	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157003-157036	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157039-157072	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157507-157540	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1120-1153	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1744-1777	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2776-2809	4	0.882
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2434-2467	4	0.882
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156295-156328	4	0.882
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156421-156454	4	0.882
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2794-2827	4	0.882
NZ_CP022130_3	3.29\|518043\|28\|NZ_CP022130\|CRT	518043-518070	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9583-9610	4	0.857
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21241-21268	4	0.857
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15862-15889	4	0.857
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9799-9826	4	0.857
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9943-9970	4	0.857
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153841-153874	4	0.882
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156115-156148	4	0.882
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156589-156622	4	0.882
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3115	4	0.882
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3226-3259	4	0.882
NZ_CP022130_3	3.33\|518265\|34\|NZ_CP022130\|CRT	518265-518298	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152959-152992	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151462-151495	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151936-151969	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151390-151423	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151426-151459	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151639	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154042	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154186	4	0.882
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153331-153364	4	0.882
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153013-153046	4	0.882
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156013-156046	4	0.882
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155713-155740	4	0.857
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156013-156040	4	0.857
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3748-3775	4	0.857
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18155-18188	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18539-18572	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17447-17480	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17501-17534	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17567-17600	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17879-17912	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17951-17984	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18083-18116	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18227-18260	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18359-18392	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18761-18794	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18815-18848	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19079-19112	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19361-19394	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19433-19466	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19565-19598	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19709-19742	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19889-19922	4	0.882
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20075-20108	4	0.882
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153841-153874	4	0.882
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156115-156148	4	0.882
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156589-156622	4	0.882
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151552-151585	4	0.882
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151588-151621	4	0.882
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153670	4	0.882
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154063-154096	4	0.882
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1885	4	0.882
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2257	4	0.882
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17003-17036	4	0.882
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18569-18602	4	0.882
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18539-18572	4	0.882
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155779-155812	4	0.882
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153247-153274	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153727-153754	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155479-155506	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156259-156286	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157291-157318	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157615-157642	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15448-15475	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15556-15583	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15682-15709	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15844-15871	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1534-1561	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1948-1975	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2230-2257	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16751-16778	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17747-17774	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19229-19256	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19907-19934	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20033-20060	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21061-21088	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21223-21250	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	976-1003	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9619-9646	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9781-9808	4	0.857
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9925-9952	4	0.857
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154132	4	0.882
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154168	4	0.882
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	MH809528	Lactobacillus phage Sabazios, complete genome	16892-16923	5	0.844
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153235-153268	5	0.853
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153715-153748	5	0.853
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154183-154216	5	0.853
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154105-154138	5	0.853
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154477-154510	5	0.853
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154531-154564	5	0.853
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154801-154834	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157501-157534	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151678-151711	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153274	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153754	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157159-157192	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157339-157372	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157627-157660	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21019-21052	5	0.853
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9541-9574	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151498-151531	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153457-153490	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153877-153910	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155560	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151879	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-152005	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153475-153508	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153493-153526	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154651-154684	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154702	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154918	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155116	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155350	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155545-155578	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151534-151567	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151570-151603	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153175-153208	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154957-154990	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155065-155098	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155299-155332	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156961-156994	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2374-2407	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3628-3661	5	0.853
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9829-9862	5	0.853
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153139-153172	5	0.853
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156325-156358	5	0.853
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1903	5	0.853
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2086-2119	5	0.853
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3046-3079	5	0.853
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154261-154288	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19913-19940	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17837-17864	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18575-18602	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19319-19346	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1402-1429	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1510-1537	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2560-2587	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1924-1951	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3592-3619	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1078-1105	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21271-21298	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21289-21316	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21307-21334	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21361-21388	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15748-15775	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15766-15793	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15892-15919	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15910-15937	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9595-9622	5	0.821
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9991-10018	5	0.821
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20099-20132	5	0.853
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16733-16766	5	0.853
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17729-17762	5	0.853
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18491-18524	5	0.853
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19211-19244	5	0.853
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2296-2329	5	0.853
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153841-153874	5	0.853
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156115-156148	5	0.853
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156589-156622	5	0.853
NZ_CP022130_3	3.50\|519321\|34\|NZ_CP022130\|CRT	519321-519354	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2296-2329	5	0.853
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155473-155506	5	0.853
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156253-156286	5	0.853
NZ_CP022130_3	3.58\|519861\|34\|NZ_CP022130\|CRT	519861-519894	34	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21271-21304	5	0.853
NZ_CP022130_3	3.58\|519861\|34\|NZ_CP022130\|CRT	519861-519894	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15892-15925	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151516-151549	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154414	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155866	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156943-156976	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153688	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153706	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156862	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157030	5	0.853
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1738-1771	5	0.853
NZ_CP022130_3	3.68\|520605\|52\|NZ_CP022130\|CRT	520605-520656	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155560	5	0.904
NZ_CP022130_3	3.68\|520605\|52\|NZ_CP022130\|CRT	520605-520656	52	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1903	5	0.904
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151257-151290	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16103-16136	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16175-16208	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16235-16268	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16307-16340	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16367-16400	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16547-16580	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16733-16766	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17045-17078	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17225-17258	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17393-17426	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17447-17480	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17501-17534	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17567-17600	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17729-17762	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18029-18062	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18083-18116	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18227-18260	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18491-18524	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18707-18740	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18761-18794	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18815-18848	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18971-19004	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19211-19244	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19511-19544	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19565-19598	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19709-19742	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19889-19922	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19961-19994	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19985-20018	5	0.853
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20075-20108	5	0.853
NZ_CP022130_3	3.78\|521217\|34\|NZ_CP022130\|CRT	521217-521250	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9589-9622	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16733-16766	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17501-17534	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17567-17600	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17729-17762	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18083-18116	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18227-18260	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18491-18524	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18815-18848	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19211-19244	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19565-19598	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19709-19742	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19889-19922	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20075-20108	5	0.853
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151804-151837	5	0.853
NZ_CP022130_3	3.80\|521325\|34\|NZ_CP022130\|CRT	521325-521358	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151299-151332	5	0.853
NZ_CP022130_3	3.80\|521325\|34\|NZ_CP022130\|CRT	521325-521358	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151900-151933	5	0.853
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16619-16646	5	0.821
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16931-16958	5	0.821
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18287-18314	5	0.821
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20093-20120	5	0.821
NZ_CP022130_3	3.85\|521607\|34\|NZ_CP022130\|CRT	521607-521640	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2068-2101	5	0.853
NZ_CP022130_3	3.90\|521889\|52\|NZ_CP022130\|CRT	521889-521940	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151426-151477	5	0.904
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	AP014119	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C36-MedDCM-OCT-S41-C69, * SEQUENCING IN PROGRESS *	8679-8710	6	0.812
NZ_CP022130_2	2.1\|303009\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303009-303041	33	NC_003907	Vibrio phage VpV262, complete genome	16148-16180	6	0.818
NZ_CP022130_2	2.1\|303009\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303009-303041	33	AY095314	Vibriophage VpV262, complete genome	16148-16180	6	0.818
NZ_CP022130_2	2.9\|303497\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303497-303529	33	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	910808-910840	6	0.818
NZ_CP022130_2	2.9\|303497\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303497-303529	33	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1111538-1111570	6	0.818
NZ_CP022130_2	2.9\|303497\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303497-303529	33	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	909150-909182	6	0.818
NZ_CP022130_2	2.9\|303497\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303497-303529	33	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	1169987-1170019	6	0.818
NZ_CP022130_2	2.9\|303497\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303497-303529	33	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	1075637-1075669	6	0.818
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155455-155488	6	0.824
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156235-156268	6	0.824
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1786-1819	6	0.824
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19901-19934	6	0.824
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154105-154138	6	0.824
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154213-154240	6	0.786
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157177-157210	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153313-153346	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156013-156046	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156397-156430	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156433-156466	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156469-156502	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156487-156520	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156505-156538	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156556	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2656-2689	6	0.824
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15496-15529	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH590593	Mycobacterium phage Rabinovish, complete genome	33438-33471	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KX781992	Mycobacterium phage Gabriel, complete genome	32436-32469	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH697579	Mycobacterium phage Cane17, complete genome	29337-29370	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359314	Mycobacterium phage Ewok, complete genome	33200-33233	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359337	Mycobacterium phage Flabslab, complete genome	31375-31408	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN234193	Mycobacterium phage Kboogie, complete genome	32149-32182	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK450432	Mycobacterium phage ValleyTerrace, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH051261	Mycobacterium phage Tyke, complete genome	33963-33996	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH779502	Mycobacterium phage FudgeTart, complete genome	32366-32399	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359365	Mycobacterium phage Loanshark, complete genome	33198-33231	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359311	Mycobacterium phage SmallFry, complete genome	32157-32190	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359364	Mycobacterium phage ChickenPhender, complete genome	31638-31671	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359303	Mycobacterium phage Shnickers, complete genome	32158-32191	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH697586	Mycobacterium phage InigoMontoya, complete genome	32164-32197	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK112549	Mycobacterium phage Morizzled23, complete genome	32277-32310	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359347	Mycobacterium phage Ading, complete genome	32140-32173	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_023714	Mycobacterium phage LinStu, complete genome	33565-33598	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359358	Mycobacterium phage Essence, complete genome	31953-31986	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MG812493	Mycobacterium phage NuevoMundo, complete genome	35159-35192	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359339	Mycobacterium phage Naija, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359333	Mycobacterium phage JustHall, complete genome	32480-32513	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KT321476	Mycobacterium phage Zeenon, complete genome	33185-33218	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN428065	Mycobacterium phage Cactojaque, complete genome	31514-31547	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359306	Mycobacterium phage Norm, complete genome	33200-33233	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN735434	Mycobacterium phage Mangeria, complete genome	33157-33190	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	EU826471	Mycobacterium phage Cali, complete genome	33031-33064	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KX721255	Mycobacterium phage Yucca, complete genome	33120-33153	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359366	Mycobacterium phage Basquiat, complete genome	31590-31623	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359346	Mycobacterium phage NoodleTree, complete genome	34229-34262	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	JN699013	Mycobacterium phage Pio, complete genome	34127-34160	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359361	Mycobacterium phage Darko, complete genome	33128-33161	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_023725	Mycobacterium phage Nappy, complete genome	33500-33533	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359348	Mycobacterium phage Rahel, complete genome	31759-31792	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK450427	Mycobacterium phage Adlitam, complete genome	32157-32190	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MG812494	Mycobacterium phage Pier, complete genome	33391-33424	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	GQ303262	Mycobacterium phage LRRHood, complete genome	32501-32534	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MT818423	Mycobacterium phage Janiyra, complete genome	32867-32900	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	AY129337	Mycobacteriophage Bxz1, complete genome	34509-34542	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH051260	Mycobacterium phage InterFolia, complete genome	35606-35639	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359328	Mycobacterium phage EmmaElysia, complete genome	31773-31806	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359335	Mycobacterium phage Patter, complete genome	32220-32253	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MT889395	Mycobacterium phage Shifa, complete genome	30805-30838	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MT723944	Mycobacterium phage ChaylaJr, complete genome	31305-31338	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KR080196	Mycobacterium phage Momo, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH910040	Mycobacterium phage Sauce, complete genome	32048-32081	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359318	Mycobacterium phage Specks, complete genome	34992-35025	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359308	Mycobacterium phage Shaqnato, complete genome	30923-30956	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH825697	Mycobacterium phage Bangla1971, complete genome	32654-32687	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359338	Mycobacterium phage Amataga, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MT723945	Mycobacterium phage Quasimodo, complete genome	33126-33159	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	32598-32631	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH316561	Mycobacterium phage Derek, complete genome	32492-32525	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK112533	Mycobacterium phage Bonray, complete genome	33302-33335	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK450422	Mycobacterium phage RoMag, complete genome	32553-32586	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359327	Mycobacterium phage EmToTheThree, complete genome	34670-34703	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH727543	Mycobacterium phage CharlieB, complete genome	31029-31062	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	JF704116	Mycobacterium phage Drazdys, complete genome	32998-33031	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359336	Mycobacterium phage Chargie21, complete genome	31590-31623	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359355	Mycobacterium phage Sprinklers, complete genome	31420-31453	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK112534	Mycobacterium phage Burrough, complete genome	33458-33491	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_023696	Mycobacterium phage Dandelion, complete genome	35869-35902	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN276192	Mycobacterium phage Trinitium, complete genome	31623-31656	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359324	Mycobacterium phage Tortoise16, complete genome	33059-33092	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359349	Mycobacterium phage FoxtrotP1, complete genome	33600-33633	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	JF704096	Mycobacterium phage Ghost, complete sequence	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN062707	Mycobacterium phage Grungle, complete genome	29581-29614	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH727558	Mycobacterium phage Salacia, complete genome	33315-33348	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359363	Mycobacterium phage Fludd, complete genome	32037-32070	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KX831080	Mycobacterium phage Lukilu, complete genome	32413-32446	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359329	Mycobacterium phage Kamryn, complete genome	33722-33755	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	JQ911768	Mycobacterium phage Ava3, complete genome	33257-33290	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_004687	Mycobacterium phage Bxz1, complete genome	34509-34542	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_011270	Mycobacterium phage Spud, complete genome	33513-33546	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN183280	Mycobacteriophage LolaVinca, complete genome	34358-34391	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359345	Mycobacterium phage QBert, complete genome	32694-32727	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	GQ303260	Mycobacterium phage ET08, complete genome	30897-30930	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH744422	Mycobacterium phage Roots515, complete genome	32620-32653	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359321	Mycobacterium phage Phusco, complete genome	32971-33004	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359362	Mycobacterium phage Atlantean, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	EU826469	Mycobacterium phage ScottMcG, complete genome	32552-32585	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK310143	Mycobacterium phage Dietrick, complete genome	31316-31349	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_029044	Mycobacterium phage Breeniome, complete genome	32027-32060	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK878897	Mycobacterium phage Blackbrain, complete genome	31407-31440	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359359	Mycobacterium phage Colt, complete genome	30399-30432	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MF919527	Mycobacterium phage Phox, complete genome	33088-33121	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MT818416	Mycobacterium phage BackyardAgain, complete genome	32092-32125	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359330	Mycobacterium phage Iota, complete genome	31940-31973	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KT365398	Mycobacterium phage DTDevon, complete genome	33367-33400	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KX369583	Mycobacterium phage Littleton, complete genome	32161-32194	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MF919494	Mycobacterium phage BeanWater, complete genome	31794-31827	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_028869	Mycobacterium phage HyRo, complete genome	31766-31799	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KT365400	Mycobacterium phage ErnieJ, complete genome	31594-31627	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KC691257	Mycobacterium phage Astraea, complete genome	32385-32418	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MG872839	Mycobacterium phage LifeSavor, complete genome	31923-31956	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KC748968	Mycobacterium phage Gizmo, complete genome	32881-32914	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	KC748970	Mycobacterium phage ArcherS7, complete genome	32524-32557	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359353	Mycobacterium phage BadAgartude, complete genome	33258-33291	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MH697590	Mycobacterium phage Phlegm, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359317	Mycobacterium phage FrayBell, complete genome	34643-34676	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MT553335	Mycobacterium phage Ronan, complete genome	30000-30033	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN428066	Mycobacterium phage JPickles, complete genome	30630-30663	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359305	Mycobacterium phage Teardrop, complete genome	32316-32349	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	DQ398053	Mycobacteriophage Catera, complete genome	31654-31687	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MF919513	Mycobacterium phage Koguma, complete genome	30682-30715	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	JN699626	Mycobacterium phage MoMoMixon, complete genome	33311-33344	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_028986	Mycobacterium phage Alice, complete sequence	30842-30875	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK450424	Mycobacterium phage Melpomini, complete genome	30757-30790	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	JN204348	Mycobacterium phage Sebata, complete genome	33684-33717	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	31954-31987	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK450423	Mycobacterium phage Stubby, complete genome	31480-31513	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MF919493	Mycobacterium phage Audrick, complete genome	32182-32215	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NC_008207	Mycobacterium phage Catera, complete genome	31654-31687	6	0.824
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	MK359326	Mycobacterium phage Pivoine, complete genome	32203-32236	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153013-153046	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153367-153400	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154597-154630	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154633-154666	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154867-154900	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155029-155062	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155263-155296	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155581-155614	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155617-155650	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155653-155686	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155851-155884	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156793-156826	6	0.824
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1024-1057	6	0.824
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156334	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157483-157510	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153268	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153748	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157168	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157159-157186	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151390-151417	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151426-151453	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151498-151525	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151633	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151900-151927	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153013-153040	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153457-153484	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153718	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153877-153904	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154036	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154180	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155554	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157033-157060	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157087-157114	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2251	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3382-3409	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3694-3721	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1159	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1294-1321	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1660-1687	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1978-2005	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2332-2359	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2806-2833	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3400-3427	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3766-3793	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1024-1051	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21073-21100	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21181-21208	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15460-15487	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15568-15595	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15694-15721	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15802-15829	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9631-9658	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9739-9766	6	0.786
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9883-9910	6	0.786
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16175-16208	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16307-16340	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16547-16580	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17225-17258	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17975-18008	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18029-18062	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18107-18140	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18179-18212	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18437-18470	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18971-19004	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19457-19490	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19511-19544	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19589-19622	6	0.824
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19661-19694	6	0.824
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2728-2761	6	0.824
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2932-2965	6	0.824
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151954-151987	6	0.824
NZ_CP022130_3	3.58\|519861\|34\|NZ_CP022130\|CRT	519861-519894	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15424-15457	6	0.824
NZ_CP022130_3	3.58\|519861\|34\|NZ_CP022130\|CRT	519861-519894	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3400-3433	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154471-154504	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155713-155746	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157141-157174	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	988-1021	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21181-21214	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15802-15835	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9739-9772	6	0.824
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9883-9916	6	0.824
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16157-16190	6	0.824
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16289-16322	6	0.824
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16421-16454	6	0.824
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17099-17132	6	0.824
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19637-19670	6	0.824
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19751-19784	6	0.824
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16175-16208	6	0.824
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16307-16340	6	0.824
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18539-18572	6	0.824
NZ_CP022130_3	3.81\|521379\|40\|NZ_CP022130\|CRT	521379-521418	40	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3148-3187	6	0.85
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2626-2653	6	0.786
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3652-3679	6	0.786
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18101-18128	6	0.786
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19583-19610	6	0.786
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18509-18536	6	0.786
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18569-18596	6	0.786
NZ_CP022130_3	3.89\|521835\|34\|NZ_CP022130\|CRT	521835-521868	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1579	6	0.824
NZ_CP022130_1	1.5\|299571\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299571-299602	32	MH383160	Escherichia phage UB, complete genome	178189-178220	7	0.781
NZ_CP022130_1	1.5\|299571\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299571-299602	32	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	111454-111485	7	0.781
NZ_CP022130_1	1.5\|299571\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299571-299602	32	KM507819	Escherichia phage 121Q, complete genome	168437-168468	7	0.781
NZ_CP022130_1	1.13\|300059\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	300059-300090	32	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	830614-830645	7	0.781
NZ_CP022130_1	1.13\|300059\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	300059-300090	32	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	832339-832370	7	0.781
NZ_CP022130_1	1.16\|300242\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	300242-300273	32	NZ_CP047347	Proteus vulgaris strain ZN3 plasmid pZN3-6kb, complete sequence	1347-1378	7	0.781
NZ_CP022130_1	1.16\|300242\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	300242-300273	32	NZ_CP048323	Escherichia coli strain 64 plasmid p64-A, complete sequence	9169-9200	7	0.781
NZ_CP022130_1	1.16\|300242\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	300242-300273	32	NZ_CP049754	Proteus mirabilis strain PmBR607 plasmid unnamed1, complete sequence	654-685	7	0.781
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN694646	Marine virus AFVG_250M1067, complete genome	26971-27003	7	0.788
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN694813	Marine virus AFVG_250M1071, complete genome	25756-25788	7	0.788
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN694492	Marine virus AFVG_250M1068, complete genome	26315-26347	7	0.788
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN694318	Marine virus AFVG_250M1065, complete genome	25520-25552	7	0.788
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN693657	Marine virus AFVG_250M1069, complete genome	26063-26095	7	0.788
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN694441	Marine virus AFVG_250M1066, complete genome	13038-13070	7	0.788
NZ_CP022130_2	2.19\|304107\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304107-304139	33	MN693639	Marine virus AFVG_250M1070, complete genome	13066-13098	7	0.788
NZ_CP022130_2	2.27\|304594\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304594-304626	33	NZ_AP022578	Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence	179694-179726	7	0.788
NZ_CP022130_3	3.21\|517536\|40\|NZ_CP022130\|CRT	517536-517575	40	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1156-1195	7	0.825
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153823-153856	7	0.794
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156097-156130	7	0.794
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156571-156604	7	0.794
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151798-151831	7	0.794
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1162-1195	7	0.794
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1762-1795	7	0.794
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KX781992	Mycobacterium phage Gabriel, complete genome	32436-32463	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH697579	Mycobacterium phage Cane17, complete genome	29337-29364	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359314	Mycobacterium phage Ewok, complete genome	33200-33227	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN234193	Mycobacterium phage Kboogie, complete genome	32149-32176	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK450432	Mycobacterium phage ValleyTerrace, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH051261	Mycobacterium phage Tyke, complete genome	33963-33990	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359365	Mycobacterium phage Loanshark, complete genome	33198-33225	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359311	Mycobacterium phage SmallFry, complete genome	32157-32184	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359364	Mycobacterium phage ChickenPhender, complete genome	31638-31665	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359303	Mycobacterium phage Shnickers, complete genome	32158-32185	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH697586	Mycobacterium phage InigoMontoya, complete genome	32164-32191	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359347	Mycobacterium phage Ading, complete genome	32140-32167	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NC_023714	Mycobacterium phage LinStu, complete genome	33565-33592	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359358	Mycobacterium phage Essence, complete genome	31953-31980	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MG812493	Mycobacterium phage NuevoMundo, complete genome	35159-35186	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359339	Mycobacterium phage Naija, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KT321476	Mycobacterium phage Zeenon, complete genome	33185-33212	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN428065	Mycobacterium phage Cactojaque, complete genome	31514-31541	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359306	Mycobacterium phage Norm, complete genome	33200-33227	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN735434	Mycobacterium phage Mangeria, complete genome	33157-33184	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	EU826471	Mycobacterium phage Cali, complete genome	33031-33058	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359366	Mycobacterium phage Basquiat, complete genome	31590-31617	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359346	Mycobacterium phage NoodleTree, complete genome	34229-34256	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	JN699013	Mycobacterium phage Pio, complete genome	34127-34154	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359361	Mycobacterium phage Darko, complete genome	33128-33155	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NC_023725	Mycobacterium phage Nappy, complete genome	33500-33527	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359348	Mycobacterium phage Rahel, complete genome	31759-31786	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK450427	Mycobacterium phage Adlitam, complete genome	32157-32184	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MG812494	Mycobacterium phage Pier, complete genome	33391-33418	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	GQ303262	Mycobacterium phage LRRHood, complete genome	32501-32528	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MT818423	Mycobacterium phage Janiyra, complete genome	32867-32894	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	AY129337	Mycobacteriophage Bxz1, complete genome	34509-34536	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH051260	Mycobacterium phage InterFolia, complete genome	35606-35633	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359328	Mycobacterium phage EmmaElysia, complete genome	31773-31800	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359335	Mycobacterium phage Patter, complete genome	32220-32247	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MT889395	Mycobacterium phage Shifa, complete genome	30805-30832	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MT723944	Mycobacterium phage ChaylaJr, complete genome	31305-31332	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KR080196	Mycobacterium phage Momo, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH910040	Mycobacterium phage Sauce, complete genome	32048-32075	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359318	Mycobacterium phage Specks, complete genome	34992-35019	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359308	Mycobacterium phage Shaqnato, complete genome	30923-30950	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH825697	Mycobacterium phage Bangla1971, complete genome	32654-32681	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359338	Mycobacterium phage Amataga, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MT723945	Mycobacterium phage Quasimodo, complete genome	33126-33153	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	32598-32625	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH316561	Mycobacterium phage Derek, complete genome	32492-32519	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK112533	Mycobacterium phage Bonray, complete genome	33302-33329	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK450422	Mycobacterium phage RoMag, complete genome	32553-32580	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH727543	Mycobacterium phage CharlieB, complete genome	31029-31056	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	JF704116	Mycobacterium phage Drazdys, complete genome	32998-33025	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359336	Mycobacterium phage Chargie21, complete genome	31590-31617	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359355	Mycobacterium phage Sprinklers, complete genome	31420-31447	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK112534	Mycobacterium phage Burrough, complete genome	33458-33485	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN276192	Mycobacterium phage Trinitium, complete genome	31623-31650	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359324	Mycobacterium phage Tortoise16, complete genome	33059-33086	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	JF704096	Mycobacterium phage Ghost, complete sequence	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN062707	Mycobacterium phage Grungle, complete genome	29581-29608	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH727558	Mycobacterium phage Salacia, complete genome	33315-33342	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359363	Mycobacterium phage Fludd, complete genome	32037-32064	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KX831080	Mycobacterium phage Lukilu, complete genome	32413-32440	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359329	Mycobacterium phage Kamryn, complete genome	33722-33749	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	JQ911768	Mycobacterium phage Ava3, complete genome	33257-33284	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NC_004687	Mycobacterium phage Bxz1, complete genome	34509-34536	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN183280	Mycobacteriophage LolaVinca, complete genome	34358-34385	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359345	Mycobacterium phage QBert, complete genome	32694-32721	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	GQ303260	Mycobacterium phage ET08, complete genome	30897-30924	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH744422	Mycobacterium phage Roots515, complete genome	32620-32647	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359321	Mycobacterium phage Phusco, complete genome	32971-32998	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359362	Mycobacterium phage Atlantean, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NC_029044	Mycobacterium phage Breeniome, complete genome	32027-32054	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK878897	Mycobacterium phage Blackbrain, complete genome	31407-31434	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359359	Mycobacterium phage Colt, complete genome	30399-30426	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MF919527	Mycobacterium phage Phox, complete genome	33088-33115	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MT818416	Mycobacterium phage BackyardAgain, complete genome	32092-32119	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359330	Mycobacterium phage Iota, complete genome	31940-31967	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KT365398	Mycobacterium phage DTDevon, complete genome	33367-33394	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KX369583	Mycobacterium phage Littleton, complete genome	32161-32188	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MF919494	Mycobacterium phage BeanWater, complete genome	31794-31821	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NC_028869	Mycobacterium phage HyRo, complete genome	31766-31793	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KC691257	Mycobacterium phage Astraea, complete genome	32385-32412	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MG872839	Mycobacterium phage LifeSavor, complete genome	31923-31950	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KC748968	Mycobacterium phage Gizmo, complete genome	32881-32908	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	KC748970	Mycobacterium phage ArcherS7, complete genome	32524-32551	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359353	Mycobacterium phage BadAgartude, complete genome	33258-33285	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MH697590	Mycobacterium phage Phlegm, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359317	Mycobacterium phage FrayBell, complete genome	34643-34670	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MT553335	Mycobacterium phage Ronan, complete genome	30000-30027	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN428066	Mycobacterium phage JPickles, complete genome	30630-30657	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359305	Mycobacterium phage Teardrop, complete genome	32316-32343	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MF919513	Mycobacterium phage Koguma, complete genome	30682-30709	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	NC_028986	Mycobacterium phage Alice, complete sequence	30842-30869	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	JN204348	Mycobacterium phage Sebata, complete genome	33684-33711	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	31954-31981	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK450423	Mycobacterium phage Stubby, complete genome	31480-31507	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MF919493	Mycobacterium phage Audrick, complete genome	32182-32209	7	0.75
NZ_CP022130_3	3.30\|518091\|28\|NZ_CP022130\|CRT	518091-518118	28	MK359326	Mycobacterium phage Pivoine, complete genome	32203-32230	7	0.75
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151624-151657	7	0.794
NZ_CP022130_3	3.32\|518211\|34\|NZ_CP022130\|CRT	518211-518244	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156448	7	0.794
NZ_CP022130_3	3.33\|518265\|34\|NZ_CP022130\|CRT	518265-518298	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155695-155728	7	0.794
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15802-15835	7	0.794
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21181-21214	7	0.794
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9739-9772	7	0.794
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9883-9916	7	0.794
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3316-3349	7	0.794
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1636-1669	7	0.794
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3568-3601	7	0.794
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3115	7	0.794
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3226-3259	7	0.794
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153655-153682	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153673-153700	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154225-154252	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154243-154270	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154399-154426	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154633-154660	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154867-154894	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155065-155092	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155299-155326	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156829-156856	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156847-156874	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156997-157024	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157015-157042	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157123-157150	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157438	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157573-157600	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1006-1033	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1528-1555	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1756-1783	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2260-2287	7	0.75
NZ_CP022130_3	3.41\|518751\|28\|NZ_CP022130\|CRT	518751-518778	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3514-3541	7	0.75
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16157-16190	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16289-16322	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16421-16454	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17099-17132	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17303-17336	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17333-17366	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17675-17708	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19157-19190	7	0.794
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19751-19784	7	0.794
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154207-154240	7	0.794
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1186-1219	7	0.794
NZ_CP022130_3	3.52\|519447\|34\|NZ_CP022130\|CRT	519447-519480	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18101-18134	7	0.794
NZ_CP022130_3	3.52\|519447\|34\|NZ_CP022130\|CRT	519447-519480	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19583-19616	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16751-16784	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17747-17780	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19229-19262	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151750-151783	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151768-151801	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151444-151477	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153193-153226	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153385-153418	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153439-153472	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153511-153544	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153955-153988	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154171-154204	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154615-154648	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154849-154882	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154975-155008	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155599-155632	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155635-155668	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155815-155848	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155923-155956	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	13-46	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1888-1921	7	0.794
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9829-9862	7	0.794
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16844	7	0.794
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17678	7	0.794
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18101-18134	7	0.794
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19583-19616	7	0.794
NZ_CP022130_3	3.72\|520893\|34\|NZ_CP022130\|CRT	520893-520926	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19838	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17303-17336	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17675-17708	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17975-18008	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18179-18212	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18437-18470	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19157-19190	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19457-19490	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19661-19694	7	0.794
NZ_CP022130_3	3.76\|521097\|34\|NZ_CP022130\|CRT	521097-521130	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18611-18644	7	0.794
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16457-16484	7	0.75
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17003-17030	7	0.75
NZ_CP022130_3	3.82\|521439\|28\|NZ_CP022130\|CRT	521439-521466	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17135-17162	7	0.75
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	HM559717	Synechococcus phage S-CBP4 genomic sequence	19899-19930	8	0.75
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	NC_025464	Synechococcus phage S-CBP4, complete genome	23761-23792	8	0.75
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18095-18128	8	0.765
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19577-19610	8	0.765
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153229-153262	8	0.765
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153709-153742	8	0.765
NZ_CP022130_3	3.33\|518265\|34\|NZ_CP022130\|CRT	518265-518298	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19655-19688	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1852-1885	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2260-2293	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2656-2689	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2770-2803	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3154-3187	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153637-153670	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155524	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156304	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156448	8	0.765
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1147	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16769-16802	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16811-16844	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17603-17636	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17645-17678	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17765-17798	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18851-18884	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19247-19280	8	0.765
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19805-19838	8	0.765
NZ_CP022130_3	3.40\|518697\|34\|NZ_CP022130\|CRT	518697-518730	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154561-154594	8	0.765
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18647-18680	8	0.765
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16877-16910	8	0.765
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18611-18644	8	0.765
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15598-15631	8	0.765
NZ_CP022130_3	3.42\|518799\|34\|NZ_CP022130\|CRT	518799-518832	34	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15724-15757	8	0.765
NZ_CP022130_3	3.45\|518979\|34\|NZ_CP022130\|CRT	518979-519012	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2134-2167	8	0.765
NZ_CP022130_3	3.52\|519447\|34\|NZ_CP022130\|CRT	519447-519480	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155782	8	0.765
NZ_CP022130_3	3.52\|519447\|34\|NZ_CP022130\|CRT	519447-519480	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20093-20126	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155473-155506	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156253-156286	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151786-151819	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153619-153652	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154651-154684	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155866	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156592	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157555-157588	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2374-2407	8	0.765
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3628-3661	8	0.765
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1154374-1154407	8	0.765
NZ_CP022130_3	3.78\|521217\|34\|NZ_CP022130\|CRT	521217-521250	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154483-154516	8	0.765
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16547-16580	8	0.765
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17225-17258	8	0.765
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18029-18062	8	0.765
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18971-19004	8	0.765
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19511-19544	8	0.765
NZ_CP022130_3	3.81\|521379\|40\|NZ_CP022130\|CRT	521379-521418	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154501-154540	8	0.8
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	183563-183594	9	0.719
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	215779-215810	9	0.719
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	220005-220036	9	0.719
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	664784-664815	9	0.719
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	180944-180975	9	0.719
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	259979-260010	9	0.719
NZ_CP022130_1	1.2\|299388\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299388-299419	32	MK448459	Streptococcus satellite phage Javan375, complete genome	8544-8575	9	0.719
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	MH001451	Mycobacterium phage Nairb, complete genome	23277-23308	9	0.719
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	MF155936	Mycobacterium phage ZenTime222, complete genome	23277-23308	9	0.719
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	MK494089	Mycobacterium phage Ibrahim, complete genome	23277-23308	9	0.719
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	NC_024135	Mycobacterium phage Bernal13, complete genome	23277-23308	9	0.719
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	KM591905	Mycobacterium phage RonRayGun, complete genome	23277-23308	9	0.719
NZ_CP022130_1	1.3\|299449\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299449-299480	32	MN735432	Mycobacteriophage Whitty, complete genome	23277-23308	9	0.719
NZ_CP022130_1	1.6\|299632\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299632-299663	32	NZ_LR134403	Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence	287780-287811	9	0.719
NZ_CP022130_1	1.6\|299632\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299632-299663	32	NC_048206	Escherichia virus vB_Eco_mar001J1 genome assembly, chromosome: 1	29013-29044	9	0.719
NZ_CP022130_1	1.6\|299632\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299632-299663	32	LR027385	Escherichia virus vB_Eco_mar001J1 strain vB_Eco_mar002J2 genome assembly, chromosome: 1	38-69	9	0.719
NZ_CP022130_1	1.6\|299632\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299632-299663	32	LR027385	Escherichia virus vB_Eco_mar001J1 strain vB_Eco_mar002J2 genome assembly, chromosome: 1	50254-50285	9	0.719
NZ_CP022130_1	1.8\|299754\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299754-299785	32	NZ_CP053379	Serratia marcescens strain FY plasmid p1, complete sequence	28045-28076	9	0.719
NZ_CP022130_1	1.8\|299754\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299754-299785	32	NZ_CP041127	Serratia marcescens strain WVU-005 plasmid pWVU-005-1, complete sequence	37335-37366	9	0.719
NZ_CP022130_1	1.8\|299754\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299754-299785	32	NZ_CP018920	Serratia marcescens strain UMH7 plasmid unnamed3, complete sequence	53745-53776	9	0.719
NZ_CP022130_1	1.8\|299754\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299754-299785	32	NZ_CP018916	Serratia marcescens strain UMH1 plasmid unnamed1, complete sequence	635-666	9	0.719
NZ_CP022130_1	1.8\|299754\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299754-299785	32	NZ_CP018918	Serratia marcescens strain UMH5 plasmid unnamed2, complete sequence	98755-98786	9	0.719
NZ_CP022130_1	1.12\|299998\|32\|NZ_CP022130\|CRISPRCasFinder,CRT	299998-300029	32	NZ_CP022993	Paraburkholderia aromaticivorans strain BN5 plasmid pBN3, complete sequence	67333-67364	9	0.719
NZ_CP022130_2	2.1\|303009\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303009-303041	33	NZ_CP028385	Providencia heimbachae strain 99101 plasmid unnamed, complete sequence	50590-50622	9	0.727
NZ_CP022130_2	2.21\|304229\|32\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304229-304260	32	KX397371	Erwinia phage vB_EamM_Parshik, complete genome	35742-35773	9	0.719
NZ_CP022130_2	2.26\|304533\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304533-304565	33	MN961670	Pseudomonas putida strain 420352 plasmid p420352-IMP, complete sequence	1993-2025	9	0.727
NZ_CP022130_2	2.26\|304533\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304533-304565	33	MK496050	Pseudomonas sp. strain FFUP_PS_41 plasmid pJBCL41, complete sequence	495762-495794	9	0.727
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157651-157684	9	0.735
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18503-18536	9	0.735
NZ_CP022130_3	3.26\|517860\|34\|NZ_CP022130\|CRT	517860-517893	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20087-20120	9	0.735
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1738-1771	9	0.735
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3061	9	0.735
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3070-3103	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16097-16130	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16229-16262	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16361-16394	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16637-16670	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16949-16982	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17039-17072	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17387-17420	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17807-17840	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18305-18338	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18701-18734	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18893-18926	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19049-19082	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19289-19322	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19979-20012	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17273-17306	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17441-17474	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18407-18440	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18605-18638	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18755-18788	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19127-19160	9	0.735
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19853-19886	9	0.735
NZ_CP022130_3	3.48\|519195\|34\|NZ_CP022130\|CRT	519195-519228	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154279-154312	9	0.735
NZ_CP022130_3	3.50\|519321\|34\|NZ_CP022130\|CRT	519321-519354	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2134-2167	9	0.735
NZ_CP022130_3	3.52\|519447\|34\|NZ_CP022130\|CRT	519447-519480	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	9	0.735
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-34	9	0.735
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1201	9	0.735
NZ_CP022130_3	3.58\|519861\|34\|NZ_CP022130\|CRT	519861-519894	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17849-17882	9	0.735
NZ_CP022130_3	3.58\|519861\|34\|NZ_CP022130\|CRT	519861-519894	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19331-19364	9	0.735
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1780-1813	9	0.735
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2620-2653	9	0.735
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-28	9	0.735
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887847	9	0.735
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16157-16190	9	0.735
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16289-16322	9	0.735
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16421-16454	9	0.735
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17099-17132	9	0.735
NZ_CP022130_3	3.79\|521271\|34\|NZ_CP022130\|CRT	521271-521304	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19751-19784	9	0.735
NZ_CP022130_3	3.85\|521607\|34\|NZ_CP022130\|CRT	521607-521640	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154207-154240	9	0.735
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153829-153862	9	0.735
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156103-156136	9	0.735
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156577-156610	9	0.735
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1154374-1154407	9	0.735
NZ_CP022130_3	3.88\|521775\|40\|NZ_CP022130\|CRT	521775-521814	40	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15514-15553	9	0.775
NZ_CP022130_3	3.88\|521775\|40\|NZ_CP022130\|CRT	521775-521814	40	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15640-15679	9	0.775
NZ_CP022130_3	3.88\|521775\|40\|NZ_CP022130\|CRT	521775-521814	40	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9559-9598	9	0.775
NZ_CP022130_3	3.95\|522297\|52\|NZ_CP022130\|CRT	522297-522348	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153811-153862	9	0.827
NZ_CP022130_3	3.95\|522297\|52\|NZ_CP022130\|CRT	522297-522348	52	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156085-156136	9	0.827
NZ_CP022130_2	2.22\|304289\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304289-304321	33	MN693806	Marine virus AFVG_250M575, complete genome	12659-12691	10	0.697
NZ_CP022130_3	3.28\|517989\|34\|NZ_CP022130\|CRT	517989-518022	34	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	498744-498777	10	0.706
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154099-154132	10	0.706
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154135-154168	10	0.706
NZ_CP022130_3	3.37\|518517\|34\|NZ_CP022130\|CRT	518517-518550	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154540	10	0.706
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16847-16880	10	0.706
NZ_CP022130_3	3.38\|518571\|34\|NZ_CP022130\|CRT	518571-518604	34	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18917-18950	10	0.706
NZ_CP022130_3	3.52\|519447\|34\|NZ_CP022130\|CRT	519447-519480	34	NZ_CP014964	Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence	94723-94756	10	0.706
NZ_CP022130_3	3.55\|519657\|34\|NZ_CP022130\|CRT	519657-519690	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1174-1207	10	0.706
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154831-154864	10	0.706
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155797-155830	10	0.706
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP046724	Pantoea agglomerans strain ASB05 plasmid pASB05p2, complete sequence	153272-153305	10	0.706
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP034471	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_2, complete sequence	85199-85232	10	0.706
NZ_CP022130_3	3.57\|519807\|34\|NZ_CP022130\|CRT	519807-519840	34	NZ_CP034476	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_2, complete sequence	110606-110639	10	0.706
NZ_CP022130_3	3.67\|520551\|34\|NZ_CP022130\|CRT	520551-520584	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154207-154240	10	0.706
NZ_CP022130_3	3.75\|521043\|34\|NZ_CP022130\|CRT	521043-521076	34	MN693980	Marine virus AFVG_250M1182, complete genome	40452-40485	10	0.706
NZ_CP022130_3	3.80\|521325\|34\|NZ_CP022130\|CRT	521325-521358	34	NZ_CP044300	Escherichia coli strain P59A plasmid pP59A-2, complete sequence	88003-88036	10	0.706
NZ_CP022130_3	3.80\|521325\|34\|NZ_CP022130\|CRT	521325-521358	34	MG516909	Escherichia coli plasmid pEc1675, complete sequence	69949-69982	10	0.706
NZ_CP022130_3	3.80\|521325\|34\|NZ_CP022130\|CRT	521325-521358	34	NZ_CP046008	Escherichia coli strain 1919D62 plasmid p1919D62-2, complete sequence	40729-40762	10	0.706
NZ_CP022130_3	3.80\|521325\|34\|NZ_CP022130\|CRT	521325-521358	34	NZ_CP033252	Escherichia coli strain ECCHD184 plasmid pTB212, complete sequence	14091-14124	10	0.706
NZ_CP022130_3	3.86\|521661\|34\|NZ_CP022130\|CRT	521661-521694	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887814-2887847	10	0.706
NZ_CP022130_3	3.89\|521835\|34\|NZ_CP022130\|CRT	521835-521868	34	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	514822-514855	10	0.706
NZ_CP022130_3	3.89\|521835\|34\|NZ_CP022130\|CRT	521835-521868	34	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	488291-488324	10	0.706
NZ_CP022130_3	3.89\|521835\|34\|NZ_CP022130\|CRT	521835-521868	34	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	488285-488318	10	0.706
NZ_CP022130_2	2.13\|303741\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303741-303773	33	HQ634177	Synechococcus phage S-CAM1 genomic sequence	5093-5125	11	0.667
NZ_CP022130_2	2.13\|303741\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303741-303773	33	KU686195	Synechococcus phage S-CAM1 isolate 0810SB17, complete genome	88629-88661	11	0.667
NZ_CP022130_2	2.13\|303741\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303741-303773	33	KU686193	Synechococcus phage S-CAM1 isolate 0310NB17, complete genome	88631-88663	11	0.667
NZ_CP022130_2	2.13\|303741\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303741-303773	33	KU686194	Synechococcus phage S-CAM1 isolate 0809CC03, complete genome	88629-88661	11	0.667
NZ_CP022130_2	2.13\|303741\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303741-303773	33	KU686196	Synechococcus phage S-CAM1 isolate 0910CC29, complete genome	88629-88661	11	0.667
NZ_CP022130_2	2.13\|303741\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	303741-303773	33	KU686192	Synechococcus phage S-CAM1 isolate 0309SB33, complete genome	88628-88660	11	0.667
NZ_CP022130_2	2.23\|304350\|33\|NZ_CP022130\|PILER-CR,CRISPRCasFinder,CRT	304350-304382	33	NZ_CP045339	Vibrio sp. THAF190c plasmid pTHAF190c_a, complete sequence	1012270-1012302	11	0.667
NZ_CP022130_3	3.24\|517740\|34\|NZ_CP022130\|CRT	517740-517773	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	12	0.647
NZ_CP022130_3	3.81\|521379\|40\|NZ_CP022130\|CRT	521379-521418	40	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155743-155782	12	0.7

1. spacer 1.9|299815|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

aacggtgtgaaattcgttaaagatacaccata	CRISPR spacer
aacggtgtgaaattcgttaaagatacaccata	Protospacer
********************************

2. spacer 1.9|299815|32|NZ_CP022130|CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

aacggtgtgaaattcgttaaagatacaccata	CRISPR spacer
aacggtgtgaaattcgttaaagatacaccata	Protospacer
********************************

3. spacer 1.21|299814|33|NZ_CP022130|PILER-CR matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

taacggtgtgaaattcgttaaagatacaccata	CRISPR spacer
taacggtgtgaaattcgttaaagatacaccata	Protospacer
*********************************

4. spacer 1.21|299814|33|NZ_CP022130|PILER-CR matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

taacggtgtgaaattcgttaaagatacaccata	CRISPR spacer
taacggtgtgaaattcgttaaagatacaccata	Protospacer
*********************************

5. spacer 2.5|303253|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

tatccgaccagacacctttatacgtctctgatt	CRISPR spacer
tatccgaccagacacctttatacgtctctgatt	Protospacer
*********************************

6. spacer 2.5|303253|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

tatccgaccagacacctttatacgtctctgatt	CRISPR spacer
tatccgaccagacacctttatacgtctctgatt	Protospacer
*********************************

7. spacer 2.18|304046|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_019489 (Lactobacillus phage Sha1, complete genome) position: , mismatch: 0, identity: 1.0

catatcagtaatcccatagttgttccgcttata	CRISPR spacer
catatcagtaatcccatagttgttccgcttata	Protospacer
*********************************

8. spacer 4.3|547728|33|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

ttaatggcgatgtgaaggttagcgaggtatgaa	CRISPR spacer
ttaatggcgatgtgaaggttagcgaggtatgaa	Protospacer
*********************************

9. spacer 4.3|547728|33|NZ_CP022130|CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 0, identity: 1.0

ttaatggcgatgtgaaggttagcgaggtatgaa	CRISPR spacer
ttaatggcgatgtgaaggttagcgaggtatgaa	Protospacer
*********************************

10. spacer 2.8|303436|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 1, identity: 0.97

tgaaatgggtgcagttaaagctgggtcgttaaa	CRISPR spacer
tgaaatgggtgcagttaaagctgggttgttaaa	Protospacer
**************************.******

11. spacer 2.8|303436|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 1, identity: 0.97

tgaaatgggtgcagttaaagctgggtcgttaaa	CRISPR spacer
tgaaatgggtgcagttaaagctgggttgttaaa	Protospacer
**************************.******

12. spacer 2.27|304594|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MG788324 (Lactobacillus phage PM411, complete genome) position: , mismatch: 1, identity: 0.97

cagtttgacgtgaccggtaagcgtatcgggtac	CRISPR spacer
cagtttgacgtgaccggtaagcgtatcgggtat	Protospacer
********************************.

13. spacer 3.21|517536|40|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.975

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
ggaatcactgtccgaatcggagtcgctgtcagagtcagaa	Protospacer
************.***************************

14. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtcggaatcgctg	Protospacer
************ ***************

15. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcagagtcggaatcgctg	Protospacer
************ ***************

16. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcagagtcggaatcgctg	Protospacer
************ ***************

17. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcgctg	Protospacer
************.*********************

18. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcgctg	Protospacer
************.*********************

19. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcgctg	Protospacer
************.*********************

20. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcgctg	Protospacer
************.*********************

21. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcgctg	Protospacer
************.*********************

22. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcactgtcggaatcggagtcgctg	Protospacer
************************ *********

23. spacer 3.74|521001|22|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.955

gctatccgaatcggaatcgctg	CRISPR spacer
gctgtccgaatcggaatcgctg	Protospacer
***.******************

24. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
******.***************************

25. spacer 1.6|299632|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.938

caatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
cgatttcagaaaacgaatcttcgtctgaaatg	Protospacer
*.********************.*********

26. spacer 1.6|299632|32|NZ_CP022130|CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.938

caatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
cgatttcagaaaacgaatcttcgtctgaaatg	Protospacer
*.********************.*********

27. spacer 1.18|299631|33|NZ_CP022130|PILER-CR matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

tcaatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
tcgatttcagaaaacgaatcttcgtctgaaatg	Protospacer
**.********************.*********

28. spacer 1.18|299631|33|NZ_CP022130|PILER-CR matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

tcaatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
tcgatttcagaaaacgaatcttcgtctgaaatg	Protospacer
**.********************.*********

29. spacer 2.6|303314|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

ttggtaagccacaaaggaatgctggttcgaatc	CRISPR spacer
ttggtaagctacaaaggaatgcgggttcgaatc	Protospacer
*********.************ **********

30. spacer 2.6|303314|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

ttggtaagccacaaaggaatgctggttcgaatc	CRISPR spacer
ttggtaagctacaaaggaatgcgggttcgaatc	Protospacer
*********.************ **********

31. spacer 2.12|303680|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

taagattggtgacgagggcaaggaatcttcaag	CRISPR spacer
taagattggtgatgaaggcaaggaatcttcaag	Protospacer
************.**.*****************

32. spacer 2.12|303680|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

taagattggtgacgagggcaaggaatcttcaag	CRISPR spacer
taagattggtgatgaaggcaaggaatcttcaag	Protospacer
************.**.*****************

33. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

34. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

35. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

36. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

37. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

38. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

39. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

40. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

41. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgaa	Protospacer
***************.**.***************

42. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatctgaatcactgtctgagtccgaa	Protospacer
************ *****************.***

43. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatctgaatcactgtctgagtccgaa	Protospacer
************ *****************.***

44. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatctgaatcactgtctgagtccgaa	Protospacer
************ *****************.***

45. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.941

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatctgaatcactgtctgagtccgaa	Protospacer
************ *****************.***

46. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatcggaatcgctgtcagagtcggaa	Protospacer
.*****************************.***

47. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtcagagtcagag	Protospacer
************ ********************.

48. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtcagagtccgaa	Protospacer
************ ***************** ***

49. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatcggagtcgctgtcagagtccgaa	Protospacer
***************.************** ***

50. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtcggaatcgctgtcagagtccgaa	Protospacer
*********.******************** ***

51. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatcggaatcgctgtcagaatcggaa	Protospacer
***************************.**.***

52. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatcggaatcgctgtcagaatcggaa	Protospacer
***************************.**.***

53. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtcagagtccgaa	Protospacer
************ ***************** ***

54. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatcggagtcgctgtcagagtcagag	Protospacer
***************.*****************.

55. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.941

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtcagagtcggaa	Protospacer
************ *****************.***

56. spacer 3.29|518043|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcgctatctgaatctgaatcgctg	Protospacer
******.***** ***************

57. spacer 3.29|518043|28|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
*********.******** *********

58. spacer 3.29|518043|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcgctatctgaatctgaatcgctg	Protospacer
******.***** ***************

59. spacer 3.29|518043|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcactgtcggaatccgaatcgctg	Protospacer
*********.********.*********

60. spacer 3.29|518043|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
*********.******** *********

61. spacer 3.29|518043|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcactgtcggaatccgaatcgctg	Protospacer
*********.********.*********

62. spacer 3.29|518043|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.929

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
cgaatcgctatctgaatctgaatcgctg	Protospacer
******.***** ***************

63. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
******.***** ***************

64. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
******.***** ***************

65. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtcggaatcgctg	Protospacer
******.***** ***************

66. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcagagtcggaatcgctg	Protospacer
******.***** ***************

67. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcgctgtccgagtccgaatcgctg	Protospacer
******.*********** *********

68. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
************ **.************

69. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtccgaatcgctg	Protospacer
************ ***** *********

70. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtcggagtcgctg	Protospacer
************ ********.******

71. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctg	Protospacer
******.***** ***************

72. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggaatcggaatcgctg	Protospacer
************ **.************

73. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtccgaatcgctg	Protospacer
************ ***** *********

74. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
cgaatcactgtcggagtccgaatcgctg	Protospacer
************ ***** *********

75. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
gctatccgaatcgctgtcagaatccgagtcgctg	Protospacer
******.*********** ***************

76. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
gctatccgaatcgctgtcagaatccgagtcgctg	Protospacer
******.*********** ***************

77. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatcggagtcactgtcggaatccgagtcgctg	Protospacer
 ***** ***************************

78. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatcggagtcactgtcggaatccgagtcgctg	Protospacer
 ***** ***************************

79. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatcggagtcactgtcggaatccgagtcgctg	Protospacer
 ***** ***************************

80. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcactgtcagagtccgagtcgctg	Protospacer
******************.**.************

81. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggagtccgagtcgctgtcggaatccgagtcgctg	Protospacer
***.********.*********************

82. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggagtccgagtcgctgtcggaatccgagtcgctg	Protospacer
***.********.*********************

83. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggagtccgagtcgctgtcggaatccgagtcgctg	Protospacer
***.********.*********************

84. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcactg	Protospacer
************.*****************.***

85. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatccgagtcactgtcagagtccgagtcgctg	Protospacer
******************.**.************

86. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
ggaatcggagtcactgtcggaatccgaatcgctg	Protospacer
****** ********************.******

87. spacer 3.50|519321|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

tgaatccgagtcactatcggaatcggagtcgctg	CRISPR spacer
ggaatccgagtcactgtcggaatcggagtcgctg	Protospacer
 **************.******************

88. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatcactg	Protospacer
****** *********** ***************

89. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatcactg	Protospacer
****** *********** ***************

90. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatcactg	Protospacer
****** **************.************

91. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatcactg	Protospacer
****** *********** ***************

92. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatcactg	Protospacer
****** *********** ***************

93. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatcactg	Protospacer
****** **************.************

94. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatcactg	Protospacer
****** **************.************

95. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtccgaatcggaatcactg	Protospacer
****** *********** ***************

96. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatccgagtcgctgtcagagtcggaatcactg	Protospacer
****** **************.************

97. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatcggagtcgctgtcagagtcggaatcgctg	Protospacer
*********************.********.***

98. spacer 3.55|519657|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggaatcggagtcgctgtcagaatccgaatcgctg	Protospacer
************************ *****.***

99. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctg	Protospacer
.*****.***************************

100. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctg	Protospacer
.*****.***************************

101. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgagtcagagtcgctgtctgagtcagagtcgcta	Protospacer
******************************.**.

102. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgaatcagagtcgctgtctgagtcagagtcgctg	Protospacer
***.**************************.***

103. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgagtcagagtcgctgtctgagtctgaatcactg	Protospacer
************************ **.******

104. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
.***********************.*********

105. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
.***********************.*********

106. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
.***********************.*********

107. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
.***********************.*********

108. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
.***********************.*********

109. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.941

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcgctg	Protospacer
.***********************.*********

110. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

111. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

112. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

113. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

114. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

115. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

116. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

117. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtctgagtcggaatcgctg	Protospacer
************************.**.

118. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

119. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtctgaatcggaatcacta	Protospacer
 **************.************

120. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtctgaatcggaatcacta	Protospacer
.**************.************

121. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcactg	Protospacer
************ **************.

122. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcactg	Protospacer
************ **************.

123. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
 *****.***************************

124. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
.*****.***************************

125. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
.*****.***************************

126. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
.*****.***************************

127. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtcggagtcgctg	Protospacer
******.********************.******

128. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatcggagtcactgtcggagtcggaatcgctg	Protospacer
****** *****.*********************

129. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
******.***************** *********

130. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
******.***************** *********

131. spacer 3.86|521661|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtctgagtcgctgtcggagtcggaatcgctg	Protospacer
.**.******************************

132. spacer 3.86|521661|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agagtccgagtcgctgtcggagtcggaatcgctg	Protospacer
***.**.***************************

133. spacer 3.86|521661|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtcggagtcgctg	Protospacer
******.********************.******

134. spacer 3.86|521661|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgaatcgctgtcggagtcggaatcgctg	Protospacer
******.**.************************

135. spacer 3.86|521661|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
******.***************** *********

136. spacer 3.86|521661|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.941

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
******.***************** *********

137. spacer 4.4|547789|33|NZ_CP022130|CRISPRCasFinder,CRT matches to MH809528 (Lactobacillus phage Sabazios, complete genome) position: , mismatch: 2, identity: 0.939

ctattaatgcacatcgttttggatatggcagtg	CRISPR spacer
ctattaatgcacatcgttttggatatggtagcg	Protospacer
****************************.**.*

138. spacer 4.7|547972|33|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

cactgaatgcagtggcgttgttagatacaccat	CRISPR spacer
cgctgaatgcagtggcgttgttaggtacaccat	Protospacer
*.**********************.********

139. spacer 4.7|547972|33|NZ_CP022130|CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

cactgaatgcagtggcgttgttagatacaccat	CRISPR spacer
cgctgaatgcagtggcgttgttaggtacaccat	Protospacer
*.**********************.********

140. spacer 4.8|548033|33|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

tgaggtataatgatcgagtaacgttggtttatt	CRISPR spacer
tgagatataacgatcgagtaacgttggtttatt	Protospacer
****.*****.**********************

141. spacer 4.8|548033|33|NZ_CP022130|CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

tgaggtataatgatcgagtaacgttggtttatt	CRISPR spacer
tgagatataacgatcgagtaacgttggtttatt	Protospacer
****.*****.**********************

142. spacer 4.12|548277|33|NZ_CP022130|CRISPRCasFinder,CRT,PILER-CR matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

cacatacgtttatgataaggataaagaaggcaa	CRISPR spacer
cacatacgtttatgatatggacaaagaaggcaa	Protospacer
***************** ***.***********

143. spacer 4.12|548277|33|NZ_CP022130|CRISPRCasFinder,CRT,PILER-CR matches to MG765275 (Lactobacillus phage Bassarid, complete genome) position: , mismatch: 2, identity: 0.939

cacatacgtttatgataaggataaagaaggcaa	CRISPR spacer
cacatacgtgtatgataaagataaagaaggcaa	Protospacer
********* ********.**************

144. spacer 4.12|548277|33|NZ_CP022130|CRISPRCasFinder,CRT,PILER-CR matches to MG765278 (Lactobacillus phage Silenus, complete genome) position: , mismatch: 2, identity: 0.939

cacatacgtttatgataaggataaagaaggcaa	CRISPR spacer
cacatacgtgtatgataaagataaagaaggcaa	Protospacer
********* ********.**************

145. spacer 4.12|548277|33|NZ_CP022130|CRISPRCasFinder,CRT,PILER-CR matches to MH809528 (Lactobacillus phage Sabazios, complete genome) position: , mismatch: 2, identity: 0.939

cacatacgtttatgataaggataaagaaggcaa	CRISPR spacer
cacatacgtgtatgataaagataaagaaggcaa	Protospacer
********* ********.**************

146. spacer 4.12|548277|33|NZ_CP022130|CRISPRCasFinder,CRT,PILER-CR matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 2, identity: 0.939

cacatacgtttatgataaggataaagaaggcaa	CRISPR spacer
cacatacgtttatgatatggacaaagaaggcaa	Protospacer
***************** ***.***********

147. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MG765278 (Lactobacillus phage Silenus, complete genome) position: , mismatch: 3, identity: 0.906

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ataatcgtctgctttgtcttgactaatgtcga	Protospacer
.******** *****.****************

148. spacer 1.11|299937|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP025693 (Lactobacillus plantarum strain IRG1 plasmid pIRG103, complete sequence) position: , mismatch: 3, identity: 0.906

gataactgggacatgccatcaaatacaacttt	CRISPR spacer
aataactgggacgtgctatcaaatacaacttt	Protospacer
.***********.***.***************

149. spacer 1.11|299937|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP024062 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed4) position: , mismatch: 3, identity: 0.906

gataactgggacatgccatcaaatacaacttt	CRISPR spacer
aataactgggacgtgctatcaaatacaacttt	Protospacer
.***********.***.***************

150. spacer 2.14|303802|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_006936 (Lactobacillus phage phiJL-1, complete genome) position: , mismatch: 3, identity: 0.909

cgctattattgatttagctaacgtaaccacttc	CRISPR spacer
tgctattattgatttggctaacgtaaccactgc	Protospacer
.**************.*************** *

151. spacer 2.14|303802|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to AY236756 (Lactobacillus plantarum bacteriophage phiJL-1, complete genome) position: , mismatch: 3, identity: 0.909

cgctattattgatttagctaacgtaaccacttc	CRISPR spacer
tgctattattgatttggctaacgtaaccactgc	Protospacer
.**************.*************** *

152. spacer 2.27|304594|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018210 (Lactobacillus plantarum strain BLS41 plasmid pLPBLS41_1, complete sequence) position: , mismatch: 3, identity: 0.909

cagtttgacgtgaccggtaagcgtatcgggtac	CRISPR spacer
cagtttgatgtgactggtaagcgtatcgggtat	Protospacer
********.*****.*****************.

153. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtctgag	Protospacer
***************.**.**************.

154. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.912

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatcggaatcactatctgagtctgag	Protospacer
************.********.***********.

155. spacer 3.19|517416|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.912

gctgtctgaatcagaatcactgtctgagtctgaa	CRISPR spacer
gctgtctgaatctgaatcactatctgagtctgag	Protospacer
************ ********.***********.

156. spacer 3.21|517536|40|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.925

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
cgaatcactgtcggaatcggagtcgctgtcagagtcggaa	Protospacer
 *********** ***********************.***

157. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatcggaatcgctgtcagaatcggaa	Protospacer
.**************************.**.***

158. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtccgaatcgctgtcagagtcagag	Protospacer
*********.** ********************.

159. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatcggaatcgctgtcggagtccgca	Protospacer
************************.***** * *

160. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtcggagtcagag	Protospacer
************ ***********.********.

161. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtccgagtcagag	Protospacer
************ *********** ********.

162. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagaatccgaatcgctgtcggagtcagag	Protospacer
************ ***********.********.

163. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtccgaatcggagtcgctgtcagagtcagaa	Protospacer
.***** ********.******************

164. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcggaatcggaatcgctgtcagagtccgaa	Protospacer
.*****.*********************** ***

165. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.912

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtccgaatcgctgtcagagtcagag	Protospacer
*********.** ********************.

166. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcgctgtcagagtcggaatcactgtcagaa	Protospacer
.***********.*****.***************

167. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcgctgtcagagtcggaatcactgtcagaa	Protospacer
.***********.*****.***************

168. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgagtcgctgtcggagtccgaatcactgtcagaa	Protospacer
 **.************** ***************

169. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcactgtcggagtcggaatcactgtcagaa	Protospacer
.*****.***********.***************

170. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcagagtcgctgtcagaa	Protospacer
 ********************.**.*********

171. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcagagtcgctgtcagaa	Protospacer
 ********************.**.*********

172. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcgctgtcagagtctgaatcactgtcagaa	Protospacer
.***********.***** ***************

173. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctgtcagaa	Protospacer
 *****************.*****.*********

174. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtccgagtccgaatcactgtcagaa	Protospacer
 *********** ***** ***************

175. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggaatcggaatcactgtcagaa	Protospacer
 **************.**.***************

176. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcagagtcgctgtcagaa	Protospacer
 ********************.**.*********

177. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgagtcgctgtcggagtcggaatcactgtcagaa	Protospacer
 **.**************.***************

178. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
cgaatcactgtcagagtcggaatcgctgtccgaa	Protospacer
.*********** ***************** ***

179. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
cgaatcgctgtcagagtcggaatcgctgtcggaa	Protospacer
.*****.***** *********************

180. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
cgaatcgctgtccgagtccgaatcgctgtcggaa	Protospacer
.*****.*********** ***************

181. spacer 3.29|518043|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
tgaatcgctatcggaatctgaatcgcta	Protospacer
.*****.********************.

182. spacer 3.29|518043|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
ggaatcactgtcggaatccgaatcgctg	Protospacer
 ********.********.*********

183. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagagtccgaatcgctg	Protospacer
 *********** ***** *********

184. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
 **.******** ***************

185. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagaatcggaatcgctg	Protospacer
 *********** **.************

186. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcgctgtcagagtcggaatcgctg	Protospacer
 *****.***** ***************

187. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagagtccgaatcgctg	Protospacer
 *********** ***** *********

188. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagagtccgaatcgctg	Protospacer
 *********** ***** *********

189. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagagtccgaatcgctg	Protospacer
 *********** ***** *********

190. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagagtccgaatcgctg	Protospacer
 *********** ***** *********

191. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcggagtcggaatcactg	Protospacer
 *********** ***********.***

192. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcggagtcggaatcactg	Protospacer
 *********** ***********.***

193. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtcagaatcggaatcgctg	Protospacer
 *********** **.************

194. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
 **.******** ***************

195. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggagtcactgtcggagtcggaatcgctg	Protospacer
 **.******** ***************

196. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcgctgtccgaatcggaatcgctg	Protospacer
 *****.********.************

197. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggagtcactgtcagagtcggaatcgctg	Protospacer
 **.******** ***************

198. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtccgagtcagagtcgctg	Protospacer
 *****************.**.******

199. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
ggaatcactgtccgaatcggagtcgctg	Protospacer
 **************.*****.******

200. spacer 3.30|518091|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
agaatcgctgtccgagtcggagtcgctg	Protospacer
 *****.**************.******

201. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
 *****.************************.**

202. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
 *****.************************.**

203. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
cgagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
.*****.************************.**

204. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
 ***** ************************.**

205. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
agagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
 *****.************************.**

206. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
agagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
 *****.************************.**

207. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
 ***** ************************.**

208. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
 ***** ************************.**

209. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
agagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
 ***** ************************.**

210. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctgtcgctatctgagtctgag	Protospacer
******************************   *

211. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctgtcgctgtctgagtcagag	Protospacer
*********************.*********  *

212. spacer 3.43|518853|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

cgagtcggagtcactgtctgagtctgaatcgctg	CRISPR spacer
ggagtcggagtcactgtcggagtccgaatcgctg	Protospacer
 ***************** *****.*********

213. spacer 3.43|518853|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

cgagtcggagtcactgtctgagtctgaatcgctg	CRISPR spacer
ggagtcggagtcactgtcagagtcggaatcgctg	Protospacer
 ***************** ***** *********

214. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtccgagtcgctg	Protospacer
.***********.********.************

215. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
 ********.**.*********************

216. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
.********.**.*********************

217. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatcggagtcactgtccgaatccgagtcgctg	Protospacer
 ***** *********** ***************

218. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgagtcactgtcggagtccgaatcgctg	Protospacer
.********************.*****.******

219. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgagtcgctg	Protospacer
 ***********.*****.***************

220. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcgctg	Protospacer
 ***********.***** ***************

221. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcgctg	Protospacer
 ***********.***** ***************

222. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgagtcgctg	Protospacer
 ***********.*****.***************

223. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
 ********.**.*********************

224. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
 ********.**.*********************

225. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgagtcgctg	Protospacer
 ***********.*****.***************

226. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
 ********.**.*********************

227. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agagtccgagtcgctgtcggaatccgagtcgctg	Protospacer
.**.********.*********************

228. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
 ********.**.*********************

229. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcgctg	Protospacer
 ***********.***** ***************

230. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatcggagtcactgtcggagtccgagtcgctg	Protospacer
 ***** **************.************

231. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtccgagtcgctg	Protospacer
.***********.********.************

232. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgagtcactgtccgaatccgagtcactg	Protospacer
 ***************** ***********.***

233. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatcggagtcactgtcggagtccgagtcgctg	Protospacer
 ***** **************.************

234. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcactgtcggagtccgagtcgctg	Protospacer
 ********.***********.************

235. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgaatcactgtcggaatccgaatcgctg	Protospacer
.********.*****************.******

236. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgagtcactgtcagaatccgaatcgctg	Protospacer
.*****************.********.******

237. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agagtccgagtcgctgtcggaatccgagtcgctg	Protospacer
.**.********.*********************

238. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
cgaatccgaatcactgtcggagtccgagtcgctg	Protospacer
 ********.***********.************

239. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgaatcactgtcggaatccgaatcgctg	Protospacer
.********.*****************.******

240. spacer 3.48|519195|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
agagtcggaatcactgtcagaatcggaatcgctg	Protospacer
 ********.******** ***************

241. spacer 3.48|519195|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
ggagtcggaatcactgtcagaatcggaatcgctg	Protospacer
 ********.******** ***************

242. spacer 3.48|519195|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
ggagtcggagtcactgtcggaatccgaatcgctg	Protospacer
 ***************** ***** *********

243. spacer 3.48|519195|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
ggagtcggagtcactgtcagagtcggaatcgctg	Protospacer
 ***************** **.************

244. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
cgaatccgagtcgctgtcggaatcggaatcactg	Protospacer
 ***** ***********.***************

245. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatccgagtcgctgtcagagtcggaatcactg	Protospacer
.***** **************.************

246. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatcggaatcgctgtcagaatcggaatcgctg	Protospacer
.********.********************.***

247. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatcggaatcgctgtcagaatcggaatcgctg	Protospacer
.********.********************.***

248. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatcggaatcgctgtcagaatcggaatcgctg	Protospacer
.********.********************.***

249. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
cgaatcggaatcgctgtccgaatcggaatcactg	Protospacer
 ********.******** ***************

250. spacer 3.55|519657|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.912

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
tgaatcggagtcgctgtctgaatcggaatcacta	Protospacer
 ***************** **************.

251. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agagtcgctgtcgctgtcagagtctgaatcactg	Protospacer
 ********************.********.***

252. spacer 3.68|520605|52|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

gctatccgaatcactgtcggagtcggaatcgctgtcagaatccgagtcgctg	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
.***********.*********************** ***************

253. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgagtctgagtcgctgtctgagtcagagtcgcta	Protospacer
****** ***********************.**.

254. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgagtctgagtcgctgtctgagtcagagtcgcta	Protospacer
****** ***********************.**.

255. spacer 3.72|520893|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
agagtcagagtcactgtcagagtcagagtcactg	Protospacer
 ***********.***** ***************

256. spacer 3.75|521043|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

tgagtcggaatcactatcggaatctgaatcgctg	CRISPR spacer
agagtcggaatcactgtcggaatccgaatcgctg	Protospacer
 **************.********.*********

257. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgaatctgaatcactgtcgctatctgaatcgctg	Protospacer
.**.********************.*********

258. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.912

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgaatctgaatcactgtcgctatctgaatcgctg	Protospacer
.**.********************.*********

259. spacer 3.79|521271|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtccgaatcgctgtcgctatccgaatcgctg	Protospacer
 *****.*****.*********************

260. spacer 3.79|521271|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtccgaatcgctgtcgctatccgaatcgctg	Protospacer
 *****.*****.*********************

261. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtctgaatcggaatcactg	Protospacer
 **************.***********.

262. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtctgaatcggaatcactg	Protospacer
 **************.***********.

263. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtctgaatcggaatcactg	Protospacer
 **************.***********.

264. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
************ ***********.**.

265. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
************ ***********.**.

266. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
************ ***********.**.

267. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
************ **.***********.

268. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
************ **.***********.

269. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
************.**.***********.

270. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
************ **.***********.

271. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtccgaatcactg	Protospacer
************ ***** ********.

272. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
************ ***********.**.

273. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
***.******** **************.

274. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
************.**.***********.

275. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
************.**.***********.

276. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
************.**.***********.

277. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtccgaatcggaatcactg	Protospacer
************.**.***********.

278. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggagtcactg	Protospacer
************ ********.*****.

279. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
************ **.***********.

280. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggagtcactg	Protospacer
************ ********.*****.

281. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggaatcgctg	Protospacer
************ ***********.**.

282. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
************ ***********.**.

283. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggaatcggaatcactg	Protospacer
************ **.***********.

284. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtccgagtccgaatcactg	Protospacer
************.***** ********.

285. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcggagtcggaatcgctg	Protospacer
************ ***********.**.

286. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtccgaatcactg	Protospacer
************ ***** ********.

287. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
***.******** **************.

288. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
***.******** **************.

289. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

290. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

291. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

292. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

293. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

294. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

295. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

296. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

297. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

298. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

299. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcactg	Protospacer
 ***************** ********.

300. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agaatcgctgtctgaatcggaatcacta	Protospacer
 **.***********.************

301. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgaatcgctgtcagagtcggaatcactg	Protospacer
***.******** **************.

302. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agaatcgctgtctgaatcggaatcacta	Protospacer
 **.***********.************

303. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
 *****.***************** *********

304. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcggagtcactgtcggagtcggaatcgctg	Protospacer
 ***** *****.*********************

305. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
.*****.***************** *********

306. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcggagtcactgtcggagtcggaatcgctg	Protospacer
 ***** *****.*********************

307. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtccgaatcgctg	Protospacer
.*****.***************** *********

308. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.912

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatcggagtcgctgtcagagtcggaatcgctg	Protospacer
.***** ***********.***************

309. spacer 3.95|522297|52|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.942

ggagtccgagtcactgtccgaatccgagtcgctgtcggagtccgagtcgctg	CRISPR spacer
agagtcggagtcactgtcagaatccgagtcgctgtcggagtccgagtcgctg	Protospacer
.***** *********** *********************************

310. spacer 1.23|299936|33|NZ_CP022130|PILER-CR matches to NZ_CP024062 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed4) position: , mismatch: 4, identity: 0.879

tgataactgggacatgccatcaaatacaacttt	CRISPR spacer
caataactgggacgtgctatcaaatacaacttt	Protospacer
..***********.***.***************

311. spacer 1.23|299936|33|NZ_CP022130|PILER-CR matches to NZ_CP025693 (Lactobacillus plantarum strain IRG1 plasmid pIRG103, complete sequence) position: , mismatch: 4, identity: 0.879

tgataactgggacatgccatcaaatacaacttt	CRISPR spacer
caataactgggacgtgctatcaaatacaacttt	Protospacer
..***********.***.***************

312. spacer 3.21|517536|40|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.9

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
cgagtcactgtcggaatcggagtcgctgtcagagtcagag	Protospacer
 **.******** **************************.

313. spacer 3.21|517536|40|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.9

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
cgaatcactgtcggaatcggagtcgctgtcagagtccgag	Protospacer
 *********** *********************** **.

314. spacer 3.21|517536|40|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.9

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
tgaatcactgtctgaatcggagtcgctgtctgagtctgag	Protospacer
 ***************************** ***** **.

315. spacer 3.21|517536|40|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.9

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
tgaatcactgtctgaatcggagtcgctgtctgagtctgag	Protospacer
 ***************************** ***** **.

316. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagagtccgaatcgctgtcagagtcagag	Protospacer
.********.** ********************.

317. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatccgaatcgctgtcagagtccgag	Protospacer
.*********** ***************** **.

318. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcagag	Protospacer
.*****.********.*****************.

319. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatccgaatcgctgtcagagtccgag	Protospacer
.*********** ***************** **.

320. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcggaatcggaatcgctgtccgagtcagag	Protospacer
.*****.***************** ********.

321. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcagag	Protospacer
.*********** ***********.********.

322. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
ggagtcagaatccgaatcgctgtcagagtcagag	Protospacer
*  ********* ********************.

323. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcagagtcagagtcactgtcagag	Protospacer
 ***********.********.***********.

324. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcagagtcggaatcactgtcagag	Protospacer
 ***********.*****.**************.

325. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcactgtcggagtccgaatcactgtcagag	Protospacer
.*****.*********** **************.

326. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcactgtcggagtccgaatcactgtcagag	Protospacer
.*****.*********** **************.

327. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtccgaatcgctgtcagag	Protospacer
 ***************** *****.********.

328. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtccgaatcgctgtcagag	Protospacer
 ***************** *****.********.

329. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcagagtcagagtcactgtcagag	Protospacer
 ***********.********.***********.

330. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggaatcggaatcactgtcagag	Protospacer
 **************.**.**************.

331. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcagagtcggaatcactgtcagag	Protospacer
 ***********.*****.**************.

332. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtccgaatcgctgtcagag	Protospacer
 ***************** *****.********.

333. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcggagtcactgtcagag	Protospacer
 *****************.**.***********.

334. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcagagtcgctgtcagca	Protospacer
 ********************.**.******* *

335. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
cgaatcactgtcagagtcggaatcgctgtccgag	Protospacer
.*********** ***************** **.

336. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
ggaatcactgtcggagtcggaatcactgtcggag	Protospacer
 *********** ***********.********.

337. spacer 3.28|517989|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
ggagtcactgtcagagtcggaatcgctgtcggag	Protospacer
 **.******** ********************.

338. spacer 3.29|518043|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.857

cgaatcactatcggaatctgaatcgctg	CRISPR spacer
ggaatcactatctgagtctgaatcgcta	Protospacer
 *********** **.***********.

339. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
tgaatcactgtctgagtccgaatcgcta	Protospacer
.***********.***** ********.

340. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
tgaatcactgtctgagtccgaatcgcta	Protospacer
.***********.***** ********.

341. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.857

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
tgaatcactgtctgagtccgaatcgcta	Protospacer
.***********.***** ********.

342. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.857

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
tgaatcactgtctgagtccgaatcgcta	Protospacer
.***********.***** ********.

343. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
.********.******** **************.

344. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
.********.******** **************.

345. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
.********.******** **************.

346. spacer 3.32|518211|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
gctgtcggaatcgctgtccgaatccgaatcactg	Protospacer
.***************** ***** ********.

347. spacer 3.32|518211|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
gctgtcggaatcgctgtccgaatcggagtcactg	Protospacer
.***************** ********.*****.

348. spacer 3.33|518265|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatccgagtcgctatcggaatctgaatcgctg	CRISPR spacer
ggaatctgaatcgctatcggaatctgaatcgcta	Protospacer
.*****.**.***********************.

349. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtccgaatccgagtcgctg	Protospacer
   ***.***************************

350. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtccgaatccgagtcgctg	Protospacer
.  ***.***************************

351. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
*  .**.***************************

352. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
*  .**.***************************

353. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
*  .** ***************************

354. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
*  .** ***************************

355. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
*  .** ***************************

356. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggaatcggaatcactgtccgaatccgagtcgctg	Protospacer
*  *** *****.*********************

357. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
agagtccgaatcgctgtccgaatccgagtcactg	Protospacer
 *****.***********************..**

358. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
tgagtcggaatcgctgtccgaatcggagtcactg	Protospacer
****** ***************** *****..**

359. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
cgagtctgaatcgctgtcggagtcggag	Protospacer
.***************** ******  *

360. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtcggaatcgctgtccgaatcggag	Protospacer
****** **************.***  *

361. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcagaatcgctgtccgagtcggag	Protospacer
 ***** ******************  *

362. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctatctgagtctgag	Protospacer
***************.**************   *

363. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgaatcgctgtcgctatctgaatcagag	Protospacer
 **************************.***  *

364. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctgtcgctgtctgaatcagag	Protospacer
*********************.*****.***  *

365. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

366. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

367. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtcagag	Protospacer
***************.*****.*********  *

368. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtcagag	Protospacer
***************.*****.*********  *

369. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

370. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

371. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtcagag	Protospacer
***************.*****.*********  *

372. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctgtcgctgtctgaatcagag	Protospacer
*********************.*****.***  *

373. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

374. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtcagag	Protospacer
***************.*****.*********  *

375. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtcagag	Protospacer
***************.*****.*********  *

376. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtcagag	Protospacer
***************.*****.*********  *

377. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

378. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

379. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

380. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
************.**************.***  *

381. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
*  .************** ***************

382. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
*  .************** ***************

383. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
*  .************** ***************

384. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
*  ***.**.************************

385. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
*  ***.**.************************

386. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgaatcgctgtcggagtccgaatcgctg	Protospacer
*  ***.***************** *********

387. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
*  ***.**.************************

388. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgaatcgctgtcggagtcggaatcgctg	Protospacer
.  ***.***************************

389. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.882

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtctgagtcgctgtcggagtcggaatcgctg	Protospacer
*  .*****.************************

390. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgagtcagagtcgctgtctgagtctgagtctgag	Protospacer
************************ *****   *

391. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcagag	Protospacer
****** ***************** ******  *

392. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.882

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgaatcgctgtcgctatctgaatcagag	Protospacer
.********.*********************  *

393. spacer 3.79|521271|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
ggcgtcagaatcgctgtcgctatccgaatcgctg	Protospacer
 * *** *****.*********************

394. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggaatcgctgtcagagtcggaatcactg	Protospacer
 **.******** **************.

395. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggaatcgctgtcagagtcggaatcactg	Protospacer
 **.******** **************.

396. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtcagaatcggaatcactg	Protospacer
 *********** **.***********.

397. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtcagaatcggaatcactg	Protospacer
 *********** **.***********.

398. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtccgagtccgaatcactg	Protospacer
 ***********.***** ********.

399. spacer 3.82|521439|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtcagagtcggaatcgctg	Protospacer
 *********** ***********.**.

400. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctatctgagtctgaatcactg	Protospacer
.********.******** ********.

401. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctatctgagtctgaatcactg	Protospacer
.********.******** ********.

402. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctatctgagtctgaatcactg	Protospacer
.********.******** ********.

403. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtctgaatctgaatcactg	Protospacer
.**************.** ********.

404. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtccgagtccgaatcactg	Protospacer
 ***********.***** ********.

405. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtcagagtccgaatcactg	Protospacer
 *********** ***** ********.

406. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtcggagtcggaatcgctg	Protospacer
.*********** ***********.**.

407. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtcagagtctgaatcactg	Protospacer
 *********** ***** ********.

408. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtcagagtctgaatcactg	Protospacer
 *********** ***** ********.

409. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtcagagtctgaatcactg	Protospacer
 *********** ***** ********.

410. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgaatcgctgtctgagtctgaatcactg	Protospacer
.**.************** ********.

411. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcgctg	Protospacer
 ***************** *****.**.

412. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctatctgagtctgaatcactg	Protospacer
.********.******** ********.

413. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtctgaatctgaatcactg	Protospacer
.**************.** ********.

414. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
ggagtcgctgtcagagtccgaatcactg	Protospacer
 *********** ***** ********.

415. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctatctgagtctgaatcactg	Protospacer
.********.******** ********.

416. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtctgaatctgaatcactg	Protospacer
.**************.** ********.

417. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.857

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtctgaatctgaatcactg	Protospacer
.**************.** ********.

418. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctg	Protospacer
*  ***.**.************************

419. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctg	Protospacer
*  ***.**.************************

420. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MH809528 (Lactobacillus phage Sabazios, complete genome) position: , mismatch: 5, identity: 0.844

ataactttttaactactagcggttatcagagt	CRISPR spacer
ataattttttaactactagcggttaccaaggc	Protospacer
****.********************.**..*.

421. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
cgagtcagagtcggaatcgctgtcagagtcggaa	Protospacer
   ******.********************.***

422. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
cgagtcagagtcggaatcgctgtcagagtcggaa	Protospacer
   ******.********************.***

423. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtccgaatcgctgtcagagtcactg	Protospacer
*********.** ******************  .

424. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctgtcacta	Protospacer
 *****************.*****.******  *

425. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
cgaatcactgtcggagtcggaatcgctgtcacta	Protospacer
.*********** *****************.  *

426. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
ggaatcactgtcagagtccgaatcgctgtcgcta	Protospacer
 *********** ***** ************  *

427. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
ggaatcactgtcagagtccgaatcgctgtcgcta	Protospacer
 *********** ***** ************  *

428. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
cgagtccgaatcgctgtcggaatcggaatcactg	Protospacer
   *** **************************.

429. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agagtccgagtcgctgtcggaatcggaatcactg	Protospacer
*  *** **.***********************.

430. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agagtcggaatcgctgtcagagtcggaatcactg	Protospacer
*  ***************.**.***********.

431. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agagtcggaatcgctgtcagagtcggaatcactg	Protospacer
*  ***************.**.***********.

432. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agagtcggaatcgctgtccgaatcggaatcgctg	Protospacer
*  *************** ***********.**.

433. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agagtccgagtcgctgtcggaatcggaatcactg	Protospacer
*  *** **.***********************.

434. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agagtcggaatcgctgtcagaatcggaatcgctg	Protospacer
*  ***************.***********.**.

435. spacer 3.32|518211|34|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agattcagaatcgctgtctgaatcggaatcacta	Protospacer
*   **.*********** ***************

436. spacer 3.32|518211|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.853

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agattcagaatcgctgtctgaatcggaatcacta	Protospacer
*   **.*********** ***************

437. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
   .**.***************************

438. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
.  .**.***************************

439. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgagtcgctg	Protospacer
.  .**.***************************

440. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
.  .** ***************************

441. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
   ***.*********** ***************

442. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
.  ***.*********** ***************

443. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcgctg	Protospacer
   ***.**.************************

444. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcgctg	Protospacer
   ***.**.************************

445. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtccgaatccgaatcgctg	Protospacer
   ***.********************.******

446. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
   ***.*********** ***************

447. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
   ***.*********** ***************

448. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
   ***.*********** ***************

449. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgagtcgctg	Protospacer
   ***.*********** ***************

450. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgagtcgctg	Protospacer
   ***.**.************************

451. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtcggaatccgagtcgctg	Protospacer
*  .** *********** ***************

452. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtcggaatccgagtcgctg	Protospacer
*  .** *********** ***************

453. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcggaatccgagtcgctg	Protospacer
*  .**.*********** ***************

454. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtccgagtcgctgtccgaatccgagtcgctg	Protospacer
*  .**.**.************************

455. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgaatcgctg	Protospacer
*  .**.********************.******

456. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgaatcgctg	Protospacer
*  .**.********************.******

457. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtcggaatccgagtcgctg	Protospacer
*  .** *********** ***************

458. spacer 3.38|518571|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  ***.*********** ***************

459. spacer 3.38|518571|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  ***.*********** ***************

460. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgaatctgagtcgctg	Protospacer
   ***************.*****.*********

461. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
agagtccgaatcgctgtcagaatccgagtcactg	Protospacer
 *****.*********** ***********..**

462. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtcactg	Protospacer
.*****.*****.*****************..**

463. spacer 3.40|518697|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
ggagtcggaatcgctgtcagaatccgagtcactg	Protospacer
 ***** *********** ***********..**

464. spacer 3.40|518697|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
agagtcagaatcgctgtcagaatccgagtcactg	Protospacer
 ***** *********** ***********..**

465. spacer 3.40|518697|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
cgagtccgaatcactgtccgaatccgagtcactg	Protospacer
.*****.*****.*****************..**

466. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtcggag	Protospacer
 *****.*********** ******  *

467. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcgctgtctgagtctgaa	Protospacer
******************.*****   .

468. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtcagag	Protospacer
*********.********.*****.  *

469. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

470. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtcagag	Protospacer
*********.********.*****.  *

471. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgagtcagag	Protospacer
 *****.*****************.  *

472. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgagtcagag	Protospacer
 *****.*****************.  *

473. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgagtcagag	Protospacer
 *****.*****************.  *

474. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgagtcgctgtccgagtcggag	Protospacer
 *****.**.***************  *

475. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtcagagtcgctgtccgagtcggag	Protospacer
 ***** **.***************  *

476. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgagtcagag	Protospacer
 *****.*****************.  *

477. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgag	Protospacer
***.**************.*****   *

478. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

479. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

480. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

481. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

482. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

483. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgag	Protospacer
***.**************.*****   *

484. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

485. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcgctatctgagtctgag	Protospacer
***************.**.*****   *

486. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.821

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgag	Protospacer
*********.********.*****   *

487. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctgtcgctgtctgagtctgaa	Protospacer
*********************.********   .

488. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********.**************.***  *

489. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********.**************.***  *

490. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********.**************.***  *

491. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********.**************.***  *

492. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agaatccgagtcgctgtcggaatcggagtcggag	Protospacer
.***********.*********** ******  *

493. spacer 3.48|519195|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
   *********.*****************.***

494. spacer 3.48|519195|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
   *********.*****************.***

495. spacer 3.48|519195|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
gctgtcggagtcgctgtctgaatcggaatcactg	Protospacer
   *********.*****************.***

496. spacer 3.50|519321|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

tgaatccgagtcactatcggaatcggagtcgctg	CRISPR spacer
agaatccgagtcgctgtcggaatcggagtcggag	Protospacer
 ***********.**.***************  *

497. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
actgtcagagtcgctgtcagaatcggaatcactg	Protospacer
.  .**.***************************

498. spacer 3.55|519657|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
actgtcagagtcgctgtcagaatcggaatcactg	Protospacer
.  .**.***************************

499. spacer 3.58|519861|34|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 5, identity: 0.853

gctatctgaatcactgtccgagtctgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgagtcgctg	Protospacer
   *********.*****.***************

500. spacer 3.58|519861|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.853

gctatctgaatcactgtccgagtctgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgagtcgctg	Protospacer
   *********.*****.***************

501. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
   ***.**.************************

502. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatcggaatcgctgtcagagtcggaatcgctg	Protospacer
.  *** ***********.***************

503. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatccgaatcgctgtcagagtcggaatcgctg	Protospacer
   ***.***********.***************

504. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgagtcgctgtcggagtcggaatcgctg	Protospacer
.  ***.**.************************

505. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaatcgctg	Protospacer
*  .**.***************** *********

506. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaatcgctg	Protospacer
*  .**.***************** *********

507. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaatcgctg	Protospacer
*  .**.***************** *********

508. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaatcgctg	Protospacer
*  .**.***************** *********

509. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agcatccgaatcgctgtcggagtccgaatcgctg	Protospacer
. .***.***************** *********

510. spacer 3.68|520605|52|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.904

gctatccgaatcactgtcggagtcggaatcgctgtcagaatccgagtcgctg	CRISPR spacer
ggagtccgaatcactgtcagagtcggaatcgctgtccgaatccgagtcgctg	Protospacer
*  .**************.***************** ***************

511. spacer 3.68|520605|52|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.904

gctatccgaatcactgtcggagtcggaatcgctgtcagaatccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtcggagtcggaatcgctgtcagaatccgagtcactg	Protospacer
.  *********.***********************************.***

512. spacer 3.72|520893|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
ggagtccgagtcgctgtcagagtcagagtcagag	Protospacer
 ***** *********** ************  *

513. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

514. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
*  .*****.********************.***

515. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

516. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
*  .*****.********************.***

517. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

518. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  ******.*********************  *

519. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.********.**.******************  *

520. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

521. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  ******.*********************  *

522. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

523. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcgctgtcgctgtctgaatcagag	Protospacer
 ********.***********.*********  *

524. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

525. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

526. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.********.**.******************  *

527. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  ******.*********************  *

528. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

529. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

530. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.********.**.******************  *

531. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

532. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcgctgtcgctgtctgaatcagag	Protospacer
 ********.***********.*********  *

533. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

534. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  ******.*********************  *

535. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
.********.**.******************  *

536. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
*  ******.*********************  *

537. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

538. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

539. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

540. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgaatcagagtcgctgtcgctatctgaatcagag	Protospacer
 **.** ************************  *

541. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctgtctgaatcagag	Protospacer
.**************.*****.*********  *

542. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ********.**.******************  *

543. spacer 3.78|521217|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 5, identity: 0.853

actatcggagtcggaatcgctatctgagtcactg	CRISPR spacer
actatctgagtctgaatcgctatctgagtctgag	Protospacer
****** ***** *****************   *

544. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********************.*****.  *

545. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

546. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

547. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********************.*****.  *

548. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

549. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

550. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********************.*****.  *

551. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

552. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtctgaatcactgtcgctatctgaatcagag	Protospacer
 ***********************.*****.  *

553. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

554. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

555. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

556. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
tgagtctgaatcactgtcgctatctgaatcagag	Protospacer
.***********************.*****.  *

557. spacer 3.79|521271|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtccgaatcgctgtcgctatccgaatcggag	Protospacer
 *****.*****.******************  *

558. spacer 3.80|521325|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatccgaatcactatcggagtcagagtcactg	CRISPR spacer
agaatccgaatcgctatccgagtcagagtcactg	Protospacer
.  *********.***** ***************

559. spacer 3.80|521325|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

gctatccgaatcactatcggagtcagagtcactg	CRISPR spacer
ggagtccgaatcactgtccgagtcagagtcactg	Protospacer
*  .***********.** ***************

560. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcagag	Protospacer
 ***************** ******  .

561. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcagag	Protospacer
 ***************** ******  .

562. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgaatcagag	Protospacer
 ***************** ******  .

563. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
gctgtcgctgtctgagtctgaatcactg	Protospacer
   *************** ********.

564. spacer 3.85|521607|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

gctatctgagtcactgtccgagtcagaatcgctg	CRISPR spacer
agaatccgagtcactgtcagagtcagaatcgctg	Protospacer
.  ***.*********** ***************

565. spacer 3.90|521889|52|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.904

gctatccgaatcgctgtccgaatcggagtcgctgtccgaatctgaatcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgagtcgctgtccgaatccgaatcgctg	Protospacer
*  .******************** *****************.*********

566. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to AP014119 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C36-MedDCM-OCT-S41-C69, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.812

-gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
tgtaatt-tcagctttatcttgtctaatttctg	Protospacer
 *****. ************** ***** ** .

567. spacer 2.1|303009|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_003907 (Vibrio phage VpV262, complete genome) position: , mismatch: 6, identity: 0.818

tgcttgtgcaactaaccgatgcaccaatttatt	CRISPR spacer
tgcttgggctactaaccgatgcaccaagtatgt	Protospacer
****** ** ***************** *   *

568. spacer 2.1|303009|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to AY095314 (Vibriophage VpV262, complete genome) position: , mismatch: 6, identity: 0.818

tgcttgtgcaactaaccgatgcaccaatttatt	CRISPR spacer
tgcttgggctactaaccgatgcaccaagtatgt	Protospacer
****** ** ***************** *   *

569. spacer 2.9|303497|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.818

tacaatta-tcacctacggaatcccaaaagatca	CRISPR spacer
-acaaaaagtcacccacggaatcccaaacgatct	Protospacer
 ****  * *****.************* ****

570. spacer 2.9|303497|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 6, identity: 0.818

tacaatta-tcacctacggaatcccaaaagatca	CRISPR spacer
-acaaaaagtcacccacggaatcccaaacgatct	Protospacer
 ****  * *****.************* ****

571. spacer 2.9|303497|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.818

tacaatta-tcacctacggaatcccaaaagatca	CRISPR spacer
-acaaaaagtcacccacggaatcccaaacgatct	Protospacer
 ****  * *****.************* ****

572. spacer 2.9|303497|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.818

tacaatta-tcacctacggaatcccaaaagatca	CRISPR spacer
-acaaaaagtcacccacggaatcccaaacgatct	Protospacer
 ****  * *****.************* ****

573. spacer 2.9|303497|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.818

tacaatta-tcacctacggaatcccaaaagatca	CRISPR spacer
-acaaaaagtcacccacggaatcccaaacgatct	Protospacer
 ****  * *****.************* ****

574. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtcggaatcactgtcagagtcgctg	Protospacer
*********.********.***********.  .

575. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtcggaatcactgtcagagtcgctg	Protospacer
*********.********.***********.  .

576. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
actgtcgctgtcggagtcagagtcgctgtcagag	Protospacer
*  .*****************.**.********.

577. spacer 3.26|517860|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
tgaatcgctgtctgagtctgaatcactgtcgcta	Protospacer
 *********** ***** ***********.  *

578. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
cgaatcgctgtcggagtcggaatcgctgtcacta	Protospacer
.*****.***** *****************.  *

579. spacer 3.30|518091|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actgtcactgtcggagtccgaatcgctg	Protospacer
   .******** ***** *********

580. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
cgaatcggaatcgctgtccgaatcggaatcactg	Protospacer
   .************** **************.

581. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
ggagtccgagtcgctgtcggaatcggaatcactg	Protospacer
.  *** **.***********************.

582. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
tgagtcggaatcgctgtccgaatcggagtcactg	Protospacer
   *************** ********.*****.

583. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
ggagtccgagtcgctgtcggaatcggaatcactg	Protospacer
.  *** **.***********************.

584. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
ggagtcggaatcactgtcggagtcggaatcactg	Protospacer
.  *********.********.***********.

585. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agaatcggaatcgctgtcagaatcggaatcgctg	Protospacer
*  .**************.***********.**.

586. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agaatcggaatcgctgtcagaatcggaatcgctg	Protospacer
*  .**************.***********.**.

587. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agaatcggaatcgctgtcagaatcggaatcgctg	Protospacer
*  .**************.***********.**.

588. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
agaatcggaatcgctgtcggaatccgagtcactg	Protospacer
*  .******************** **.*****.

589. spacer 3.32|518211|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
ggaatccgaatcgctgtcggaatcggaatcactg	Protospacer
.  .** **************************.

590. spacer 3.32|518211|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.824

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
tgaatcggagtcgctgtctgaatcggaatcacta	Protospacer
   .*****.******** ***************

591. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

592. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

593. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH697579 (Mycobacterium phage Cane17, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

594. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359314 (Mycobacterium phage Ewok, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

595. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

596. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

597. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

598. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

599. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH779502 (Mycobacterium phage FudgeTart, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

600. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359365 (Mycobacterium phage Loanshark, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

601. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

602. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

603. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

604. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

605. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK112549 (Mycobacterium phage Morizzled23, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

606. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

607. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

608. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

609. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

610. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

611. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

612. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KT321476 (Mycobacterium phage Zeenon, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

613. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

614. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

615. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

616. spacer 3.37|518517|34|NZ_CP022130|CRT matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

617. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KX721255 (Mycobacterium phage Yucca, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

618. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

619. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

620. spacer 3.37|518517|34|NZ_CP022130|CRT matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

621. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

622. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

623. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

624. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

625. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

626. spacer 3.37|518517|34|NZ_CP022130|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

627. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

628. spacer 3.37|518517|34|NZ_CP022130|CRT matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

629. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

630. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

631. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

632. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

633. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

634. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

635. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

636. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

637. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

638. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

639. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

640. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

641. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

642. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

643. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK112533 (Mycobacterium phage Bonray, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

644. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

645. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359327 (Mycobacterium phage EmToTheThree, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

646. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

647. spacer 3.37|518517|34|NZ_CP022130|CRT matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

648. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

649. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

650. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

651. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_023696 (Mycobacterium phage Dandelion, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

652. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

653. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

654. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

655. spacer 3.37|518517|34|NZ_CP022130|CRT matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

656. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

657. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

658. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

659. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

660. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

661. spacer 3.37|518517|34|NZ_CP022130|CRT matches to JQ911768 (Mycobacterium phage Ava3, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

662. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

663. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

664. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

665. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

666. spacer 3.37|518517|34|NZ_CP022130|CRT matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

667. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

668. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

669. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

670. spacer 3.37|518517|34|NZ_CP022130|CRT matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

671. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

672. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

673. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

674. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359359 (Mycobacterium phage Colt, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

675. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

676. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

677. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

678. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

679. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

680. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

681. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

682. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

683. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

684. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

685. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

686. spacer 3.37|518517|34|NZ_CP022130|CRT matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

687. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

688. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

689. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

690. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

691. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

692. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

693. spacer 3.37|518517|34|NZ_CP022130|CRT matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

694. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

695. spacer 3.37|518517|34|NZ_CP022130|CRT matches to JN699626 (Mycobacterium phage MoMoMixon, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

696. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

697. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

698. spacer 3.37|518517|34|NZ_CP022130|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

699. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

700. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

701. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

702. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcagaatcgtcc	Protospacer
****************** ***** *****...

703. spacer 3.37|518517|34|NZ_CP022130|CRT matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 6, identity: 0.824

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactatcgctgtccgagtcggaatcgtcc	Protospacer
****************** ***** *****...

704. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgagtcactg	Protospacer
.  .**.***********************.***

705. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgagtcgctgtccgaatccgagtcgctg	Protospacer
.  .**.**.************************

706. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  .**.*********** ***************

707. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgaatcgctg	Protospacer
.  .**.********************.******

708. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgaatcgctg	Protospacer
.  .**.********************.******

709. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  .**.*********** ***************

710. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  .**.*********** ***************

711. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
cgagtccgaatcgctgtcagaatccgagtcgctg	Protospacer
   .**.*********** ***************

712. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  .**.*********** ***************

713. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagaatccgagtcgctg	Protospacer
.  .**.*********** ***************

714. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtcggaatccgagtcgctg	Protospacer
.  .** *********** ***************

715. spacer 3.38|518571|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtcggaatccgagtcgctg	Protospacer
.  .** *********** ***************

716. spacer 3.38|518571|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtctgaatcactgtcagaatccgagtcgctg	Protospacer
.  .********.***** ***************

717. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtccgagtccgaa	Protospacer
 ***** *****************   .

718. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgagtccgaa	Protospacer
 *****.*****************   .

719. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtcagagtcggaa	Protospacer
 ***** *********** ******  .

720. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtcagagtcggaa	Protospacer
 ***** *********** ******  .

721. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtcggaa	Protospacer
 *****.*********** ******  .

722. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtccgaatcggaa	Protospacer
 ***** **************.***  .

723. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgag	Protospacer
 *****.**************.**   *

724. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgag	Protospacer
 *****.**************.**   *

725. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
cgagtccgaatcgctgtccgaatccgag	Protospacer
.*****.**************.**   *

726. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgag	Protospacer
 ***** **************.**   *

727. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcactgtccgagtcagag	Protospacer
 *****.*****.***********.  *

728. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgag	Protospacer
 *****.**************.**   *

729. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgag	Protospacer
 *****.**************.**   *

730. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgag	Protospacer
 *****.*********** *****   *

731. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgag	Protospacer
 *****.**************.**   *

732. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgag	Protospacer
 ***** **************.**   *

733. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtccgaatccgag	Protospacer
 ***** **************.**   *

734. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtccgaatccgag	Protospacer
 ***** **************.**   *

735. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtcagag	Protospacer
 *****.*********** *****.  *

736. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtcagag	Protospacer
 *****.*********** *****.  *

737. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtctgagtcgctgtcggagtcggaa	Protospacer
 ********.******** ******  .

738. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtcggaa	Protospacer
 *****.*********** ******  .

739. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtcggaa	Protospacer
 *****.*********** ******  .

740. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtccgag	Protospacer
 *****.*********** *****   *

741. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtccgagtcagag	Protospacer
 **.**.*****************.  *

742. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgagtcgctgtccgagtcagag	Protospacer
 *****.**.**************.  *

743. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggaatcggaatcgctgtccgagtcagag	Protospacer
 **.** *****************.  *

744. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgagtcgctgtccgagtccgag	Protospacer
 *****.**.**************   *

745. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtcggagtccgag	Protospacer
 ***** *********** *****   *

746. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcactgtccgagtcagag	Protospacer
 ***** *****.***********.  *

747. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
cgagtcggagtcgctgtccgagtcagag	Protospacer
.***** **.**************.  *

748. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtcagag	Protospacer
 *****.*********** *****.  *

749. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcactgtctgagtctgaa	Protospacer
************.*****.*****   .

750. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaa	Protospacer
***.**************.*****   .

751. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcactgtctgagtctgaa	Protospacer
************.*****.*****   .

752. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcactgtctgagtctgaa	Protospacer
************.*****.*****   .

753. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcactgtctgagtctgaa	Protospacer
************.*****.*****   .

754. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaa	Protospacer
***.**************.*****   .

755. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgagtctgaatcactgtctgagtctgaa	Protospacer
************.*****.*****   .

756. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaa	Protospacer
***.**************.*****   .

757. spacer 3.41|518751|28|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.786

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaa	Protospacer
***.**************.*****   .

758. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
   .***********************.**.***

759. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
   .***********************.**.***

760. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   ************************.***  *

761. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   ************************.***  *

762. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
*********.*****.**************   .

763. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   ************************.***  *

764. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtctgaa	Protospacer
***************.*****.********   .

765. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
*********.*****.**************   .

766. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
*********.*****.**************   .

767. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   ************************.***  *

768. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
*********.*****.**************   .

769. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   ************************.***  *

770. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgaatcgctatcgctgtctgagtctgaa	Protospacer
***************.*****.********   .

771. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
*********.*****.**************   .

772. spacer 3.55|519657|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatcggagtcgctgtcagaatccgagtcggag	Protospacer
.*********************** **.**.  *

773. spacer 3.55|519657|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
cgaatcggagtcgctgtcagaatccgagtcggag	Protospacer
 *********************** **.**.  *

774. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgaatcgctg	Protospacer
.**.**   ***************.*********

775. spacer 3.58|519861|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.824

gctatctgaatcactgtccgagtctgagtcgctg	CRISPR spacer
tgaatctgaatcactatctgagtctgagtcgcta	Protospacer
   ************.**.**************.

776. spacer 3.58|519861|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

gctatctgaatcactgtccgagtctgagtcgctg	CRISPR spacer
agagtcggaatcactgtccgagtcagagtcgctg	Protospacer
.  .** ***************** *********

777. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agagtccgaatcactgtcggagtcggaatcgctg	Protospacer
.  .**.*****.*********************

778. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
cgagtctgaatcgctgtcggagtcggagtcactg	Protospacer
   .***********************.**.***

779. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtcggaatcgctg	Protospacer
.  .**.***********.***************

780. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agagtccgagtcgctgtcggagtcggaatcgctg	Protospacer
.  .**.**.************************

781. spacer 3.67|520551|34|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
   *************** ***** ********.

782. spacer 3.67|520551|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
   *************** ***** ********.

783. spacer 3.67|520551|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
   *************** ***** ********.

784. spacer 3.67|520551|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.824

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
   *************** ***** ********.

785. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .*****.*********************  *

786. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .*****.*********************  *

787. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .*****.*********************  *

788. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .*****.*********************  *

789. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgaatcgctgtcgctatctgagtctgag	Protospacer
 ********.*****************.**   *

790. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
*  .*****.*********************  *

791. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
   .********.***********.*********

792. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcgctg	Protospacer
   .********.***********.*********

793. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
agagtctgaatcgctgtcgctatctgaatcagag	Protospacer
 ***********.***********.*****.  *

794. spacer 3.81|521379|40|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.85

ggagtcggaatctgaatcgctgtcagagtcagaatcacta	CRISPR spacer
actgtcggaatccgaatcgctgtcagagtccgaatcactg	Protospacer
.  *********.***************** ********.

795. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
actgtcgctgtcggagtcggagtcactg	Protospacer
   ********* ********.*****.

796. spacer 3.82|521439|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
cgagtcgctgtcagagtcggagtcggag	Protospacer
************ ********.**.  .

797. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
gctatcgctgtctgagtctgaatcactg	Protospacer
   .************** ********.

798. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
gctatcgctgtctgagtctgaatcactg	Protospacer
   .************** ********.

799. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
gctgtcgctgtcagagtctgaatcactg	Protospacer
   ********* ***** ********.

800. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
tgagtcgctgtctgagtctgagtcagag	Protospacer
.***************** **.***  .

801. spacer 3.89|521835|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

gctatccgaatcactatcggaatctgaatcactg	CRISPR spacer
cgagtccgaatcactgtcggaatccgaatcactg	Protospacer
   .***********.********.*********

802. spacer 1.5|299571|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 7, identity: 0.781

cagccaatcagacattaacaacattatcaaag	CRISPR spacer
cacataatcatacattaacaactttatcgatg	Protospacer
**  .***** *********** *****.* *

803. spacer 1.5|299571|32|NZ_CP022130|CRISPRCasFinder,CRT matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 7, identity: 0.781

cagccaatcagacattaacaacattatcaaag	CRISPR spacer
cacataatcatacattaacaactttatcgatg	Protospacer
**  .***** *********** *****.* *

804. spacer 1.5|299571|32|NZ_CP022130|CRISPRCasFinder,CRT matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 7, identity: 0.781

cagccaatcagacattaacaacattatcaaag	CRISPR spacer
cacaaaatcatacattaacaactttatcgatg	Protospacer
**   ***** *********** *****.* *

805. spacer 1.13|300059|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 7, identity: 0.781

acttccggcgctgacattgccggcgggtaggc	CRISPR spacer
gcattcggcgctgacattcccggcgggtcatc	Protospacer
.* *.************* ********* . *

806. spacer 1.13|300059|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 7, identity: 0.781

acttccggcgctgacattgccggcgggtaggc	CRISPR spacer
gcattcggcgctgacattcccggcgggtcatc	Protospacer
.* *.************* ********* . *

807. spacer 1.16|300242|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP047347 (Proteus vulgaris strain ZN3 plasmid pZN3-6kb, complete sequence) position: , mismatch: 7, identity: 0.781

tattccttgggcgattttatccgtggaattta----	CRISPR spacer
tatttcttgggcggttttatccgc----tttatcgt	Protospacer
****.********.*********.    ****

808. spacer 1.16|300242|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP048323 (Escherichia coli strain 64 plasmid p64-A, complete sequence) position: , mismatch: 7, identity: 0.781

tattccttgggcgattttatccgtggaattta----	CRISPR spacer
tatttcttgggcggttttatccgc----tttatcgt	Protospacer
****.********.*********.    ****

809. spacer 1.16|300242|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP049754 (Proteus mirabilis strain PmBR607 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tattccttgggcgattttatccgtggaattta----	CRISPR spacer
tatttcttgggcggttttatccgc----tttatcgt	Protospacer
****.********.*********.    ****

810. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN694646 (Marine virus AFVG_250M1067, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

811. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN694813 (Marine virus AFVG_250M1071, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

812. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN694492 (Marine virus AFVG_250M1068, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

813. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN694318 (Marine virus AFVG_250M1065, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

814. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN693657 (Marine virus AFVG_250M1069, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

815. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN694441 (Marine virus AFVG_250M1066, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

816. spacer 2.19|304107|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN693639 (Marine virus AFVG_250M1070, complete genome) position: , mismatch: 7, identity: 0.788

ccatgtgcttcttctttagtttctttagcgaca	CRISPR spacer
tcagcaggttcttcagtagtttctttagcgaca	Protospacer
.**   * ******  *****************

817. spacer 2.27|304594|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022578 (Mycolicibacterium aubagnense strain JCM 15296 plasmid pJCM15296, complete sequence) position: , mismatch: 7, identity: 0.788

cagtttgacgtgaccggtaagcgtatcgggtac	CRISPR spacer
tccgttgacgtgaccggtatccgtatcgggtgc	Protospacer
.   ***************  **********.*

818. spacer 3.21|517536|40|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.825

ggaatcactgtctgaatcggagtcgctgtcagagtcagaa	CRISPR spacer
cgaatcactgtcagaatcggagtcactgtcagagtcgctg	Protospacer
 *********** ***********.***********.  .

819. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcgctg	Protospacer
.*********** ***********.*****.  .

820. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcgctg	Protospacer
.*********** ***********.*****.  .

821. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatccgaatcgctgtcggagtcgctg	Protospacer
.*********** ***********.*****.  .

822. spacer 3.24|517740|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
gctgtcagagtccgaatcgctgtcgctatccgaa	Protospacer
*********.** ***********.  .** ***

823. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.794

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
actgtcagaatcggagtcactgtcagagtcgctg	Protospacer
.**************.**.***********.  .

824. spacer 3.26|517860|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
cgaatcgctgtcagagtccgaatcactgtcgctg	Protospacer
 ***********.***** ***********.  .

825. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

826. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH697579 (Mycobacterium phage Cane17, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

827. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359314 (Mycobacterium phage Ewok, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

828. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

829. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

830. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

831. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359365 (Mycobacterium phage Loanshark, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

832. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

833. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

834. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

835. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

836. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

837. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

838. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

839. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

840. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

841. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KT321476 (Mycobacterium phage Zeenon, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

842. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

843. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

844. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

845. spacer 3.30|518091|28|NZ_CP022130|CRT matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

846. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

847. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

848. spacer 3.30|518091|28|NZ_CP022130|CRT matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

849. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

850. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

851. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

852. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

853. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

854. spacer 3.30|518091|28|NZ_CP022130|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

855. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

856. spacer 3.30|518091|28|NZ_CP022130|CRT matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

857. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

858. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

859. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

860. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

861. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

862. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

863. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

864. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

865. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

866. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

867. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

868. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

869. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

870. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

871. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK112533 (Mycobacterium phage Bonray, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

872. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

873. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

874. spacer 3.30|518091|28|NZ_CP022130|CRT matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

875. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

876. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

877. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

878. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

879. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

880. spacer 3.30|518091|28|NZ_CP022130|CRT matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

881. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

882. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

883. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

884. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

885. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

886. spacer 3.30|518091|28|NZ_CP022130|CRT matches to JQ911768 (Mycobacterium phage Ava3, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

887. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

888. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

889. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

890. spacer 3.30|518091|28|NZ_CP022130|CRT matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

891. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

892. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

893. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

894. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

895. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

896. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359359 (Mycobacterium phage Colt, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

897. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

898. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

899. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

900. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

901. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

902. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

903. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

904. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

905. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

906. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

907. spacer 3.30|518091|28|NZ_CP022130|CRT matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

908. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

909. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

910. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

911. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

912. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

913. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

914. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

915. spacer 3.30|518091|28|NZ_CP022130|CRT matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

916. spacer 3.30|518091|28|NZ_CP022130|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

917. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

918. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

919. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

920. spacer 3.30|518091|28|NZ_CP022130|CRT matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 7, identity: 0.75

cgaatcactgtccgagtcggaatcgctg	CRISPR spacer
actatcgctgtccgagtcggaatcgtcc	Protospacer
   ***.******************..

921. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
cgaatccgagtcgctgtcggaatcggaatcactg	Protospacer
   .** **.***********************.

922. spacer 3.32|518211|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

actgtcggaatcgctgtcggaatcggaatcacta	CRISPR spacer
ggaatcggaatcactgtcggagtcggaatcactg	Protospacer
.  .********.********.***********.

923. spacer 3.33|518265|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

agaatccgagtcgctatcggaatctgaatcgctg	CRISPR spacer
cgagtcgctgtcgctatccgagtctgaatcgctg	Protospacer
 **.**   ********* **.************

924. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.794

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
.**.**   ********* ***********.***

925. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 7, identity: 0.794

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
.**.**   ********* ***********.***

926. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 7, identity: 0.794

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
.**.**   ********* ***********.***

927. spacer 3.37|518517|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 7, identity: 0.794

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
tgaatctgaatcgctgtctgagtctgaatcgcta	Protospacer
.**.**   ********* ***********.***

928. spacer 3.38|518571|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agaatcggagtcgctgtccgaatccgagtcggag	Protospacer
.  *** **.*********************  *

929. spacer 3.38|518571|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggaatccgaatcgctgtccgaatcggagtccgag	Protospacer
*  ***.***************** *****   *

930. spacer 3.38|518571|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
ggaatccgaatcgctgtccgaatcggagtcagag	Protospacer
*  ***.***************** *****.  *

931. spacer 3.40|518697|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
gctgtcggaatcgctgtccgaatccgaatcactg	Protospacer
   *** ********************.**..**

932. spacer 3.40|518697|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
gctgtcggaatcgctgtccgaatcggagtcactg	Protospacer
   *** ***************** *****..**

933. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaa	Protospacer
 *****.*********** *****   .

934. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaa	Protospacer
 *****.*********** *****   .

935. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

936. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

937. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtcggaatcgctgtcagagtccgaa	Protospacer
 ***** *********** *****   .

938. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgaa	Protospacer
 *****.**************.**   .

939. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtccgaatccgaa	Protospacer
 *****.**************.**   .

940. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgaa	Protospacer
 *****.**************.**   .

941. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtccgaatccgaa	Protospacer
 *****.**************.**   .

942. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaa	Protospacer
 *****.*********** *****   .

943. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

944. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcggagtccgaa	Protospacer
 *****.*********** *****   .

945. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

946. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

947. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgagtcgctgtccgagtccgaa	Protospacer
 *****.**.**************   .

948. spacer 3.41|518751|28|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

949. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtcggaatcgctgtcagagtctgaa	Protospacer
 ***** *********** *****   .

950. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
cgagtcagagtcgctgtccgagtccgaa	Protospacer
.***** **.**************   .

951. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtccgaatcgctgtcagagtccgaa	Protospacer
 *****.*********** *****   .

952. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
agaatccgaatcgctgtccgagtccgaa	Protospacer
 **.**.*****************   .

953. spacer 3.41|518751|28|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

tgagtctgaatcgctgtccgagtcgctg	CRISPR spacer
ggagtcggagtcgctgtccgagtccgaa	Protospacer
 ***** **.**************   .

954. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .***********************.***  *

955. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .***********************.***  *

956. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .***********************.***  *

957. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .***********************.***  *

958. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 ********.*****.**************   .

959. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctgtctgagtcagag	Protospacer
   .*****************.*********  *

960. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 ********.*****.**************   .

961. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
agagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 ********.*****.**************   .

962. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .***********************.***  *

963. spacer 3.45|518979|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
agagtcactgtcactgtcggagtccgaatcgctg	Protospacer
.**.**   ************.*****.******

964. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
gctgtccgaatcactgtcggaatcagagtcggag	Protospacer
*  .*****.************** ******  *

965. spacer 3.52|519447|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtcagaatcgctgtcggagtcagaatcactg	CRISPR spacer
tgaatcgctatcgctgtctgagtctgaatcactg	Protospacer
 **.**.  ********* ***** *********

966. spacer 3.52|519447|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtcagaatcgctgtcggagtcagaatcactg	CRISPR spacer
tgaatcgctatcgctgtctgagtctgaatcactg	Protospacer
 **.**.  ********* ***** *********

967. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatcactg	Protospacer
 **.**.  ************.********.***

968. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatcactg	Protospacer
 **.**.  ************.********.***

969. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatcactg	Protospacer
 **.**.  ************.********.***

970. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcgctgtcagaatccgaatcgctg	Protospacer
 **.**   .**************.*********

971. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcgctgtcagaatccgaatcgctg	Protospacer
 **.**   .**************.*********

972. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgagtcgctgtccgaatccgaatcgctg	Protospacer
.**.**   ********* *****.*********

973. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
ggaatccgagtcgctgtccgaatccgaatcgctg	Protospacer
 **.**   ********* *****.*********

974. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgagtcgctg	Protospacer
.**.**   ***************.**.******

975. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
 **.**   ************.**.*********

976. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgagtcgctg	Protospacer
.**.**   ***************.**.******

977. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
ggaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
 **.**   ************.**.*********

978. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
.**.**   ************.**.*********

979. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
 **.**   ************.**.*********

980. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
 **.**   ************.**.*********

981. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgagtcgctgtcagaatccgagtcgctg	Protospacer
.**.**   ***************.**.******

982. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
 **.**   ************.**.*********

983. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcgctgtcagagtccgaatcgctg	Protospacer
 **.**   ************.**.*********

984. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcgctgtccgaatccgaatcgctg	Protospacer
 **.**   ********* *****.*********

985. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
ggaatccgagtcgctgtccgaatccgaatcgctg	Protospacer
 **.**   ********* *****.*********

986. spacer 3.57|519807|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
actgtcagagtcgctgtcagaatccgaatcgctg	Protospacer
   ***.  ***************.*********

987. spacer 3.57|519807|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgagtcactgtcagaatccgaatcgctg	Protospacer
 **.**   ***.***********.*********

988. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 7, identity: 0.794

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
tgaatctgaatcgctgtctgaatctgagtcgctg	Protospacer
***.**   .******** ********.******

989. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgctg	Protospacer
***.**.  .***********.********.***

990. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgctg	Protospacer
***.**.  .***********.********.***

991. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgaatcgctatcgctgtctgagtctgaatcactg	Protospacer
***.**.  .************** **.******

992. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgaatcgctatcgctgtctgagtctgaatcactg	Protospacer
***.**.  .************** **.******

993. spacer 3.72|520893|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

tgagtcagagtcgctgtctgagtcagagtcactg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgctg	Protospacer
***.**.  .***********.********.***

994. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctatctgagtctgaa	Protospacer
.**************.***********.**   .

995. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctatctgagtctgaa	Protospacer
.**************.***********.**   .

996. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 **************.***********.**   .

997. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 **************.***********.**   .

998. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 **************.***********.**   .

999. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
agagtctgagtcgctatcgctatctgagtctgaa	Protospacer
.**************.***********.**   .

1000. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 **************.***********.**   .

1001. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
tgagtctgagtcgctatcgctatctgagtctgaa	Protospacer
 **************.***********.**   .

1002. spacer 3.76|521097|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.794

ggagtctgagtcgctgtcgctatctgaatcactg	CRISPR spacer
gctatctgaatcgctgtcgctgtctgaatcagag	Protospacer
*  .*****.***********.*********  *

1003. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
gctatcgctgtctgaatctgaatcactg	Protospacer
   .***********.** ********.

1004. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
agagtcgctgtctgagtctgagtctgag	Protospacer
 ***************** **.**   .

1005. spacer 3.82|521439|28|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

cgagtcgctgtctgagtcggaatcacta	CRISPR spacer
gctatcgctgtctgaatctgaatcactg	Protospacer
   .***********.** ********.

1006. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to HM559717 (Synechococcus phage S-CBP4 genomic sequence) position: , mismatch: 8, identity: 0.75

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
taagtactcagctataacttgactaatgtcaa	Protospacer
  *.*  ****** ** *************.*

1007. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_025464 (Synechococcus phage S-CBP4, complete genome) position: , mismatch: 8, identity: 0.75

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
taagtactcagctataacttgactaatgtcaa	Protospacer
  *.*  ****** ** *************.*

1008. spacer 3.26|517860|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
gctatcgctgtctgagtctgaatcactgtcgcta	Protospacer
.  ********* ***** ***********.  *

1009. spacer 3.26|517860|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
gctatcgctgtctgagtctgaatcactgtcgcta	Protospacer
.  ********* ***** ***********.  *

1010. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
ggagtccgagtcagagtcggaatcgctgtcagag	Protospacer
 **.**   *** *****************.**.

1011. spacer 3.28|517989|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
ggagtccgagtcagagtcggaatcgctgtcagag	Protospacer
 **.**   *** *****************.**.

1012. spacer 3.33|518265|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

agaatccgagtcgctatcggaatctgaatcgctg	CRISPR spacer
tgagtcgctatcgctatctgagtctgaatcgctg	Protospacer
 **.**   .******** **.************

1013. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agaatccgaatcgctgtcggagtcggaatcgctg	Protospacer
 **.**   *************** *****.**.

1014. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agaatccgaatcgctgtccgagtccgaatcactg	Protospacer
 **.**   ********* *****.********.

1015. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
ggaatccgaatcgctgtcggaatcggaatcactg	Protospacer
 **.**   ************.** ********.

1016. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agaatccgaatcgctgtcggagtcggagtcactg	Protospacer
 **.**   *************** **.*****.

1017. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
ggaatccgaatcgctgtcagagtccgaatcactg	Protospacer
 **.**   *********.*****.********.

1018. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
ggaatccgaatcgctgtcggagtccgaatcgctg	Protospacer
 **.**   ***************.*****.**.

1019. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agaatcggaatcactgtcggagtccgaatcactg	Protospacer
 **.**.  ***.***********.********.

1020. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agaatcggaatcactgtcggagtccgaatcactg	Protospacer
 **.**.  ***.***********.********.

1021. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
ggaatcggaatcactgtcggagtcggaatcactg	Protospacer
 **.**.  ***.*********** ********.

1022. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 8, identity: 0.765

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agaatccgaatcgctgtcagagtcggaatcactg	Protospacer
 **.**   *********.***** ********.

1023. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtcagaatcagagtcgctg	Protospacer
   ***   ********* ***** *********

1024. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgctg	Protospacer
   ***   *********.***** *********

1025. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtcagaatcagagtcgctg	Protospacer
   ***   ********* ***** *********

1026. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgctg	Protospacer
   ***   *********.***** *********

1027. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtcagaatcagagtcgctg	Protospacer
   ***   ********* ***** *********

1028. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtcagaatcagagtcgctg	Protospacer
   ***   ********* ***** *********

1029. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtcagaatcagagtcgctg	Protospacer
   ***   ********* ***** *********

1030. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgctg	Protospacer
   ***   *********.***** *********

1031. spacer 3.40|518697|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtctgaatcgctgtccgaatccgagtcgttg	CRISPR spacer
gctatccgaatcgctgtccgaatcagagtcactg	Protospacer
   .**.***************** *****..**

1032. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctgtctgagtctgag	Protospacer
   .*****************.********   *

1033. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctatcgctgtctgagtcagag	Protospacer
   .***********.*****.*********  *

1034. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
gctatctgaatcgctgtcgctgtctgaatcagag	Protospacer
   .*****************.*****.***  *

1035. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
actgtctgaatcggagtcgctatctgagtctgag	Protospacer
   **********  ***************   *

1036. spacer 3.42|518799|34|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.765

tgagtctgaatcgctgtcgctatctgagtcactg	CRISPR spacer
actgtctgaatcggagtcgctatctgagtctgag	Protospacer
   **********  ***************   *

1037. spacer 3.45|518979|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

ggaatccgagtcactgtcggaatccgagtcgctg	CRISPR spacer
gctgtccgagtcactgtcggagtcggagtcagag	Protospacer
*  .*****************.** *****.  *

1038. spacer 3.52|519447|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

ggagtcagaatcgctgtcggagtcagaatcactg	CRISPR spacer
ggagtccgaatcgctgtcagagtcactgtcggcg	Protospacer
****** ***********.******  .**. .*

1039. spacer 3.52|519447|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

ggagtcagaatcgctgtcggagtcagaatcactg	CRISPR spacer
tgaatcgctgtcgctgtctgagtctgaatcactg	Protospacer
 **.**.  .******** ***** *********

1040. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
actgtcagagtcgctgtcagaatcggaatcactg	Protospacer
   ***.  *************** *****.***

1041. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
actgtcagagtcgctgtcagaatcggaatcactg	Protospacer
   ***.  *************** *****.***

1042. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcgctgtcagagtccgaatcgctg	Protospacer
 **.**   .***********.**.*********

1043. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgaatcgctgtcggaatccgaatcgctg	Protospacer
.**.**   .********.*****.*********

1044. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgaatcgctgtccgaatccgaatcgctg	Protospacer
.**.**   .******** *****.*********

1045. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
cgaatccgaatcgctgtcagagtcggaatcgctg	Protospacer
.**.**   .***********.** *********

1046. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcactgtcagaatccgaatcgctg	Protospacer
 **.**   .**.***********.*********

1047. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcgctgtcagagtccgaatcgctg	Protospacer
 **.**   .***********.**.*********

1048. spacer 3.57|519807|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcgctgtcagaatccgagtcgctg	Protospacer
 **.**   .**************.**.******

1049. spacer 3.57|519807|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.765

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
agaatccgaatcgctgtcagaatccgagtcgctg	Protospacer
 **.**   .**************.**.******

1050. spacer 3.67|520551|34|NZ_CP022130|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.765

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
ggttgccgcttcgctgtcgtagtcggattcgctg	Protospacer
* *  *.*  ********* ******* ******

1051. spacer 3.78|521217|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

actatcggagtcggaatcgctatctgagtcactg------	CRISPR spacer
actgtcggagtcggaatcgct------gtcactatccgaa	Protospacer
***.*****************      ******.

1052. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   *********.***********.*****.  *

1053. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   *********.***********.*****.  *

1054. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   *********.***********.*****.  *

1055. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   *********.***********.*****.  *

1056. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.765

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctgtctgaatcgctgtcgctatctgaatcagag	Protospacer
   *********.***********.*****.  *

1057. spacer 3.81|521379|40|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.8

ggagtcggaatctgaatcgctgtcagagtcagaatcacta	CRISPR spacer
gctgtcactatccgaatcgctgtcagagtcggaatcactg	Protospacer
*  ***.  ***.*****************.********.

1058. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt	CRISPR spacer
tttgcttattaactactagcggttctccaata	Protospacer
 * .*** **************** ** .*

1059. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt	CRISPR spacer
tttgcttattaactactagcggttctccaata	Protospacer
 * .*** **************** ** .*

1060. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt	CRISPR spacer
tttgcttattaactactagcggttctccaata	Protospacer
 * .*** **************** ** .*

1061. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt	CRISPR spacer
tttgcttattaactactagcggttctccaata	Protospacer
 * .*** **************** ** .*

1062. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt	CRISPR spacer
tttgcttattaactactagcggttctccaata	Protospacer
 * .*** **************** ** .*

1063. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt	CRISPR spacer
tttgcttattaactactagcggttctccaata	Protospacer
 * .*** **************** ** .*

1064. spacer 1.2|299388|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MK448459 (Streptococcus satellite phage Javan375, complete genome) position: , mismatch: 9, identity: 0.719

ataactttttaactactagcggttatcagagt-----	CRISPR spacer
ttaactttttaattgctagcggtt-----tgttcttg	Protospacer
 ***********.*.*********      **

1065. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 9, identity: 0.719

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ttgctgtgcagcttcatcttgacgaatgtcgc	Protospacer
 *. *   ******.******** *******

1066. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 9, identity: 0.719

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ttgctgtgcagcttcatcttgacgaatgtcgc	Protospacer
 *. *   ******.******** *******

1067. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 9, identity: 0.719

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ttgctgtgcagcttcatcttgacgaatgtcgc	Protospacer
 *. *   ******.******** *******

1068. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 9, identity: 0.719

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ttgctgtgcagcttcatcttgacgaatgtcgc	Protospacer
 *. *   ******.******** *******

1069. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 9, identity: 0.719

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ttgctgtgcagcttcatcttgacgaatgtcgc	Protospacer
 *. *   ******.******** *******

1070. spacer 1.3|299449|32|NZ_CP022130|CRISPRCasFinder,CRT matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 9, identity: 0.719

gtaatcgtcagctttatcttgactaatgtcga	CRISPR spacer
ttgctgtgcagcttcatcttgacgaatgtcgc	Protospacer
 *. *   ******.******** *******

1071. spacer 1.6|299632|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_LR134403 (Listeria monocytogenes strain NCTC7974 plasmid 6, complete sequence) position: , mismatch: 9, identity: 0.719

caatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
cgctttcagaaaaccaaacttcatctttacgt	Protospacer
*. *********** ** ********  *

1072. spacer 1.6|299632|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NC_048206 (Escherichia virus vB_Eco_mar001J1 genome assembly, chromosome: 1) position: , mismatch: 9, identity: 0.719

caatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
ataatcatgacaacgaatcttcttctgaaatc	Protospacer
  * *.  ** *********** ********

1073. spacer 1.6|299632|32|NZ_CP022130|CRISPRCasFinder,CRT matches to LR027385 (Escherichia virus vB_Eco_mar001J1 strain vB_Eco_mar002J2 genome assembly, chromosome: 1) position: , mismatch: 9, identity: 0.719

caatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
ataatcatgacaacgaatcttcttctgaaatc	Protospacer
  * *.  ** *********** ********

1074. spacer 1.6|299632|32|NZ_CP022130|CRISPRCasFinder,CRT matches to LR027385 (Escherichia virus vB_Eco_mar001J1 strain vB_Eco_mar002J2 genome assembly, chromosome: 1) position: , mismatch: 9, identity: 0.719

caatttcagaaaacgaatcttcatctgaaatg	CRISPR spacer
ataatcatgacaacgaatcttcttctgaaatc	Protospacer
  * *.  ** *********** ********

1075. spacer 1.8|299754|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP053379 (Serratia marcescens strain FY plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccgaatcctttttatcggcaattaatacgc	CRISPR spacer
gtccggatcgtttttatcggcaatgatggggg	Protospacer
 ****.*** ************** *  . *

1076. spacer 1.8|299754|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP041127 (Serratia marcescens strain WVU-005 plasmid pWVU-005-1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccgaatcctttttatcggcaattaatacgc	CRISPR spacer
atccggatcgtttttatcggcaatgatggggg	Protospacer
 ****.*** ************** *  . *

1077. spacer 1.8|299754|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP018920 (Serratia marcescens strain UMH7 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

ttccgaatcctttttatcggcaattaatacgc	CRISPR spacer
gtccggatcgtttttatcggcaatgatggggg	Protospacer
 ****.*** ************** *  . *

1078. spacer 1.8|299754|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP018916 (Serratia marcescens strain UMH1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ttccgaatcctttttatcggcaattaatacgc	CRISPR spacer
atccggatcgtttttatcggcaatgatggggg	Protospacer
 ****.*** ************** *  . *

1079. spacer 1.8|299754|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP018918 (Serratia marcescens strain UMH5 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ttccgaatcctttttatcggcaattaatacgc	CRISPR spacer
gtccggatcgtttttatcggcaatgatggggg	Protospacer
 ****.*** ************** *  . *

1080. spacer 1.12|299998|32|NZ_CP022130|CRISPRCasFinder,CRT matches to NZ_CP022993 (Paraburkholderia aromaticivorans strain BN5 plasmid pBN3, complete sequence) position: , mismatch: 9, identity: 0.719

aacgatctagatgcagccgttgctgatcgttt	CRISPR spacer
aaaagcgcagttgcacccgttgctgatcgttg	Protospacer
** ... .** **** ***************

1081. spacer 2.1|303009|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028385 (Providencia heimbachae strain 99101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

tgcttgtgcaactaaccgatgcaccaatttatt	CRISPR spacer
ggattgtgcaacaaaccgatggaccaatggtga	Protospacer
 * ********* ******** ******

1082. spacer 2.21|304229|32|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to KX397371 (Erwinia phage vB_EamM_Parshik, complete genome) position: , mismatch: 9, identity: 0.719

----agctgtagcagcttctgagataccaccagttg	CRISPR spacer
tcagagt----gcatcttctcagataccaccagtga	Protospacer
    **.    *** ***** ************* .

1083. spacer 2.26|304533|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN961670 (Pseudomonas putida strain 420352 plasmid p420352-IMP, complete sequence) position: , mismatch: 9, identity: 0.727

ttgaca-atctatcgtgcacaaatcctaactcag	CRISPR spacer
-cgccgcatctatcgtgtaccaatcctaactttt	Protospacer
 .* *. **********.** **********.

1084. spacer 2.26|304533|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MK496050 (Pseudomonas sp. strain FFUP_PS_41 plasmid pJBCL41, complete sequence) position: , mismatch: 9, identity: 0.727

ttgaca-atctatcgtgcacaaatcctaactcag	CRISPR spacer
-cgccgcatctatcgtgtaccaatcctaactttt	Protospacer
 .* *. **********.** **********.

1085. spacer 3.26|517860|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
ggaatcgctgtcggagtccgcatcagcatcactt	Protospacer
.***************** * **** ..***

1086. spacer 3.26|517860|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
gctgtcgctgtcagagtctgaatcactgtcgcta	Protospacer
.  .********.***** ***********.  *

1087. spacer 3.26|517860|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

agaatcgctgtcggagtcagaatcactgtcagaa	CRISPR spacer
gctgtcgctgtctgagtctgaatcactgtcgcta	Protospacer
.  .******** ***** ***********.  *

1088. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agcatccgaatcgctgtcggagtccgaatcgctg	Protospacer
 * .**   ***************.*****.**.

1089. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
agcatccgaatcgctgtccgagtccgaatcactg	Protospacer
 * .**   ********* *****.********.

1090. spacer 3.37|518517|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
cgagtcactgtcgctgtcggaatcgctgtccgaa	Protospacer
*********.***********.**   .**   *

1091. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1092. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1093. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1094. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1095. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1096. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1097. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1098. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1099. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1100. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1101. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1102. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1103. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
.  .**   *********.***** *********

1104. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgagtcgctatcgctgtctgaatcagagtcgctg	Protospacer
   .**   *********.***** *********

1105. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgcta	Protospacer
   ***   *********.***** ********.

1106. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagagtcgctg	Protospacer
   ***   .********.***** *********

1107. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgcta	Protospacer
   ***   *********.***** ********.

1108. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagagtcgctg	Protospacer
   ***   .********.***** *********

1109. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctgtcgctgtctgaatcagagtcgctg	Protospacer
   ***   .********.***** *********

1110. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgcta	Protospacer
   ***   *********.***** ********.

1111. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
tgaatcgctatcgctgtctgaatcagagtcgcta	Protospacer
   ***   *********.***** ********.

1112. spacer 3.48|519195|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

cgagtcggagtcactgtctgaatcggaatcgctg	CRISPR spacer
agagtcggagtcactgtcggagtcgctgtcagag	Protospacer
 ***************** **.***  .**.  *

1113. spacer 3.50|519321|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

tgaatccgagtcactatcggaatcggagtcgctg	CRISPR spacer
gctgtccgagtcactgtcggagtcggagtcagag	Protospacer
   .***********.*****.********.  *

1114. spacer 3.52|519447|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.735

ggagtcagaatcgctgtcggagtcagaatcactg	CRISPR spacer
------cgaatcgctgtcggagtcagagtcgctg	Protospacer
       ********************.**.***

1115. spacer 3.55|519657|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatcggagtcactgtcagagtcgctgtcagaa	Protospacer
.***********.********.***  .***  .

1116. spacer 3.55|519657|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.735

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
agaatcggagtcactgtcagagtcgctgtcagaa	Protospacer
.***********.********.***  .***  .

1117. spacer 3.58|519861|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcactgtccgagtctgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgagtctgagtcgctg	Protospacer
.  .**   ***.*****.***************

1118. spacer 3.58|519861|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcactgtccgagtctgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgagtctgagtcgctg	Protospacer
.  .**   ***.*****.***************

1119. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcgctgtcggagtcagagtcgctg	Protospacer
   ***   .**************.**.******

1120. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
cgaatcactgtcgctgtcggagtcggagtcactg	Protospacer
   ***   .*****************.**.***

1121. spacer 3.67|520551|34|NZ_CP022130|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
------cgaatcgctgtcggagtcagagtcgctg	Protospacer
      .*****************.**.******

1122. spacer 3.67|520551|34|NZ_CP022130|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.735

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
cgtcgacgaatcgctgtcggagtccgaatcggag	Protospacer
  *   .***************** ******  *

1123. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .********.***********.*****.  *

1124. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .********.***********.*****.  *

1125. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .********.***********.*****.  *

1126. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .********.***********.*****.  *

1127. spacer 3.79|521271|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.735

cgagtctgaatcactgtcgctatccgaatcgctg	CRISPR spacer
gctatctgaatcgctgtcgctatctgaatcagag	Protospacer
   .********.***********.*****.  *

1128. spacer 3.85|521607|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

gctatctgagtcactgtccgagtcagaatcgctg	CRISPR spacer
agagtcactgtcactgtcggagtccgaatcgctg	Protospacer
.  .**   ********* ***** *********

1129. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtctgaa	Protospacer
******.**.***************  .**   .

1130. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtctgaa	Protospacer
******.**.***************  .**   .

1131. spacer 3.86|521661|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
agaatccgaatcgctgtcggagtcgctgtctgaa	Protospacer
******.**.***************  .**   .

1132. spacer 3.86|521661|34|NZ_CP022130|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 9, identity: 0.735

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
ggttgccgcttcgctgtcgtagtcggattcgctg	Protospacer
.*   *.*  ********* ******* ******

1133. spacer 3.88|521775|40|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.775

ggaatctgaatcactatcggaatcggaatcggaatcgctg	CRISPR spacer
tgaatcggaatcactatctgaatcggaatcactatctgag	Protospacer
 ***** *********** ***********.  ***   *

1134. spacer 3.88|521775|40|NZ_CP022130|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.775

ggaatctgaatcactatcggaatcggaatcggaatcgctg	CRISPR spacer
tgaatcggaatcactatctgaatcggaatcactatctgag	Protospacer
 ***** *********** ***********.  ***   *

1135. spacer 3.88|521775|40|NZ_CP022130|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 9, identity: 0.775

ggaatctgaatcactatcggaatcggaatcggaatcgctg	CRISPR spacer
tgaatcggaatcactatctgaatcggaatcactatctgag	Protospacer
 ***** *********** ***********.  ***   *

1136. spacer 3.95|522297|52|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.827

ggagtccgagtcactgtccgaatccgagtcgctgtcggagtccgagtcgctg	CRISPR spacer
ggagtccgagtcactgtcagaatccgaatcgctgtcggagtcgctgtctgaa	Protospacer
****************** ********.**************   ***   .

1137. spacer 3.95|522297|52|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.827

ggagtccgagtcactgtccgaatccgagtcgctgtcggagtccgagtcgctg	CRISPR spacer
ggagtccgagtcactgtcagaatccgaatcgctgtcggagtcgctgtctgaa	Protospacer
****************** ********.**************   ***   .

1138. spacer 2.22|304289|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to MN693806 (Marine virus AFVG_250M575, complete genome) position: , mismatch: 10, identity: 0.697

ctgatttcagcagcaggataaatagaagtagcc	CRISPR spacer
gtgctgtcagcagcaggataaatagcaactctt	Protospacer
 ** * ******************* *..  ..

1139. spacer 3.28|517989|34|NZ_CP022130|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 10, identity: 0.706

---tgaatcactgtccgagtcggaatcgctgtcggaa	CRISPR spacer
gcttgg---cctgtccgaggcggaattgctgtcgcgt	Protospacer
   **.    ********* ******.******* .

1140. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.706

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctg	Protospacer
   .**   *************** *****.**.

1141. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.706

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
actatccgaatcgctgtcggagtcggaatcgctg	Protospacer
   .**   *************** *****.**.

1142. spacer 3.37|518517|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.706

cgagtcactatcgctgtcggagtctgaatcacta	CRISPR spacer
actatccgaatcgctgtcagagtcggaatcactg	Protospacer
   .**   *********.***** ********.

1143. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgcta	Protospacer
.  .**   *********.***** ********.

1144. spacer 3.38|518571|34|NZ_CP022130|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.706

gctatctgaatcgctgtccgaatccgagtcgctg	CRISPR spacer
agagtcgctatcgctgtctgaatcagagtcgcta	Protospacer
.  .**   *********.***** ********.

1145. spacer 3.52|519447|34|NZ_CP022130|CRT matches to NZ_CP014964 (Geobacter anodireducens strain SD-1 plasmid pSD, complete sequence) position: , mismatch: 10, identity: 0.706

ggagtcagaatcgctgtcggagtcagaatcactg	CRISPR spacer
ctggtcagcatcgctgtcggcgtcagaggggcta	Protospacer
  .***** *********** ******.  .**.

1146. spacer 3.55|519657|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 10, identity: 0.706

ggaatcggagtcgctgtcagaatcggaatcactg	CRISPR spacer
ggagtcggagtcgctgtccgaatcactgtcggaa	Protospacer
***.************** *****.  .**.  .

1147. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.706

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
gctatccgaatcgctgtcagaatccgagtcgctg	Protospacer
   .**   .**************.**.******

1148. spacer 3.57|519807|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.706

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
gctatccgaatcgctgtcagaatccgagtcgctg	Protospacer
   .**   .**************.**.******

1149. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP046724 (Pantoea agglomerans strain ASB05 plasmid pASB05p2, complete sequence) position: , mismatch: 10, identity: 0.706

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
catagtgcgatcgctgacagaatctgaatggctg	Protospacer
.. . .** .****** ************ ****

1150. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP034471 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_2, complete sequence) position: , mismatch: 10, identity: 0.706

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
catagtgcgatcgctgacagaatctgaatggctg	Protospacer
.. . .** .****** ************ ****

1151. spacer 3.57|519807|34|NZ_CP022130|CRT matches to NZ_CP034476 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_2, complete sequence) position: , mismatch: 10, identity: 0.706

tgagtcgctgtcgctgtcagaatctgaatcgctg	CRISPR spacer
catagtgcgatcgctgacagaatctgaatggctg	Protospacer
.. . .** .****** ************ ****

1152. spacer 3.67|520551|34|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.706

gctatctgaatcgctgtcggagtcggaatcgctg	CRISPR spacer
agagtcactgtcactgtcggagtccgaatcgctg	Protospacer
.  .**   .**.*********** *********

1153. spacer 3.75|521043|34|NZ_CP022130|CRT matches to MN693980 (Marine virus AFVG_250M1182, complete genome) position: , mismatch: 10, identity: 0.706

tgagtcggaatcactatcggaatctgaatcgctg	CRISPR spacer
agagtcggaatacctatcggaatctgccagaagg	Protospacer
 **********  *************    .  *

1154. spacer 3.80|521325|34|NZ_CP022130|CRT matches to NZ_CP044300 (Escherichia coli strain P59A plasmid pP59A-2, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggagtcagagtcactg	CRISPR spacer
ctcaccgccatcaccatcggtgtcagagtcactt	Protospacer
 ..*.*   *****.***** ************

1155. spacer 3.80|521325|34|NZ_CP022130|CRT matches to MG516909 (Escherichia coli plasmid pEc1675, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggagtcagagtcactg	CRISPR spacer
ctcaccgccatcaccatcggtgtcagagtcactt	Protospacer
 ..*.*   *****.***** ************

1156. spacer 3.80|521325|34|NZ_CP022130|CRT matches to NZ_CP046008 (Escherichia coli strain 1919D62 plasmid p1919D62-2, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggagtcagagtcactg	CRISPR spacer
ctcaccgccatcaccatcggtgtcagagtcactt	Protospacer
 ..*.*   *****.***** ************

1157. spacer 3.80|521325|34|NZ_CP022130|CRT matches to NZ_CP033252 (Escherichia coli strain ECCHD184 plasmid pTB212, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggagtcagagtcactg	CRISPR spacer
ctcaccgccatcaccatcggtgtcagagtcactt	Protospacer
 ..*.*   *****.***** ************

1158. spacer 3.86|521661|34|NZ_CP022130|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.706

agaatctgagtcgctgtcggagtcggaatcgctg	CRISPR spacer
cgtcgacgaatcgctgtcggagtccgaatcggag	Protospacer
 *    .**.************** ******  *

1159. spacer 3.89|521835|34|NZ_CP022130|CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggaatctgaatcactg	CRISPR spacer
gaattccgaatccctatctgaatctgaaccgggc	Protospacer
*   ******** ***** *********.*.

1160. spacer 3.89|521835|34|NZ_CP022130|CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggaatctgaatcactg	CRISPR spacer
gaactccgaatccctatctgaatctgaaccgggc	Protospacer
*   ******** ***** *********.*.

1161. spacer 3.89|521835|34|NZ_CP022130|CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 10, identity: 0.706

gctatccgaatcactatcggaatctgaatcactg	CRISPR spacer
gaactccgaatccctatctgaatctgaaccgggc	Protospacer
*   ******** ***** *********.*.

1162. spacer 2.13|303741|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to HQ634177 (Synechococcus phage S-CAM1 genomic sequence) position: , mismatch: 11, identity: 0.667

caagtcaaatgccacgattggagatatgcaaca	CRISPR spacer
accatcaaatgccactagtggagatatgtggtg	Protospacer
   .*********** * **********.....

1163. spacer 2.13|303741|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to KU686195 (Synechococcus phage S-CAM1 isolate 0810SB17, complete genome) position: , mismatch: 11, identity: 0.667

caagtcaaatgccacgattggagatatgcaaca	CRISPR spacer
accatcaaatgccactagtggagatatgtggtg	Protospacer
   .*********** * **********.....

1164. spacer 2.13|303741|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to KU686193 (Synechococcus phage S-CAM1 isolate 0310NB17, complete genome) position: , mismatch: 11, identity: 0.667

caagtcaaatgccacgattggagatatgcaaca	CRISPR spacer
accatcaaatgccactagtggagatatgtggtg	Protospacer
   .*********** * **********.....

1165. spacer 2.13|303741|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to KU686194 (Synechococcus phage S-CAM1 isolate 0809CC03, complete genome) position: , mismatch: 11, identity: 0.667

caagtcaaatgccacgattggagatatgcaaca	CRISPR spacer
accatcaaatgccactagtggagatatgtggtg	Protospacer
   .*********** * **********.....

1166. spacer 2.13|303741|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to KU686196 (Synechococcus phage S-CAM1 isolate 0910CC29, complete genome) position: , mismatch: 11, identity: 0.667

caagtcaaatgccacgattggagatatgcaaca	CRISPR spacer
accatcaaatgccactagtggagatatgtggtg	Protospacer
   .*********** * **********.....

1167. spacer 2.13|303741|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to KU686192 (Synechococcus phage S-CAM1 isolate 0309SB33, complete genome) position: , mismatch: 11, identity: 0.667

caagtcaaatgccacgattggagatatgcaaca	CRISPR spacer
accatcaaatgccactagtggagatatgtggtg	Protospacer
   .*********** * **********.....

1168. spacer 2.23|304350|33|NZ_CP022130|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045339 (Vibrio sp. THAF190c plasmid pTHAF190c_a, complete sequence) position: , mismatch: 11, identity: 0.667

tcagatgtgattaaatctgtcgttgaaatctat	CRISPR spacer
attgatgtgattaaatcggtcgctgaacaaacg	Protospacer
 . ************** ****.****

1169. spacer 3.24|517740|34|NZ_CP022130|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 12, identity: 0.647

gctgtcagaatcggaatcgctgtcagagtcagaa	CRISPR spacer
------agaatcggagtcactgtcagagtcgctg	Protospacer
      *********.**.***********.  .

1170. spacer 3.81|521379|40|NZ_CP022130|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 12, identity: 0.7

ggagtcggaatctgaatcgctgtcagagtcagaatcacta	CRISPR spacer
actgtcggagtccgaatcgctgtcagagtcactgtcggcg	Protospacer
.  ******.**.******************  .**. ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

404189 : 413437

Lactobacillus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088769690.1\|404189_405185_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	4.6e-56	40.1
WP_088769691.1\|405756_406317_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	7.0e-86	86.0
WP_088769692.1\|406414_408853_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	89.4
WP_088769693.1\|408857_409472_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	5.1e-106	93.6
WP_088769694.1\|409762_410710_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.3e-156	86.3
WP_088769695.1\|411078_412065_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	2.2e-98	60.4
WP_191982864.1\|412279_413437_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.3e-131	61.3

DBSCAN-SWA_2

1148358 : 1260381

104

Lactobacillus_phage(74.55%)

holin,capsid,terminase,integrase,portal,tRNA,head,protease,tail

attL 1171214:1171231|attR 1266953:1266970

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088770020.1\|1148358_1149774_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	6.8e-45	29.9
WP_088771263.1\|1150953_1152444_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_050339193.1\|1153446_1154652_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
WP_050339194.1\|1154670_1156050_-	DNA repair protein RadA	NA	NA	NA	NA
WP_050339195.1\|1156186_1156723_-	dUTP diphosphatase	J9PV85	Bacillus_phage	9.2e-35	45.3
WP_003637758.1\|1157320_1157617_+	N-acetyltransferase	NA	NA	NA	NA
WP_088770021.1\|1157626_1158310_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_088770022.1\|1158385_1159717_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	1.4e-68	33.6
WP_050339198.1\|1161022_1161715_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_088770023.1\|1163068_1163746_-	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_050339200.1\|1163950_1164985_-	EamA family transporter	NA	NA	NA	NA
WP_088770024.1\|1165296_1166259_-	AEC family transporter	NA	NA	NA	NA
WP_088770025.1\|1166566_1167760_+	LCP family protein	NA	NA	NA	NA
WP_088770026.1\|1168894_1169668_-	hypothetical protein	NA	NA	NA	NA
WP_088770027.1\|1169660_1170464_-	acetyl-CoA carboxyl transferase	NA	NA	NA	NA
WP_088770028.1\|1170460_1171783_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
1171214:1171231	attL	NA	NA	NA	NA
WP_088770029.1\|1171785_1172262_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_088770030.1\|1172277_1173249_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_088770031.1\|1173491_1174025_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003637743.1\|1174021_1174441_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_088770032.1\|1174511_1177364_-	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_088770033.1\|1177668_1178055_-	DUF956 family protein	NA	NA	NA	NA
WP_050339212.1\|1178188_1179121_-	PTS mannose/fructose/sorbose transporter family subunit IID	NA	NA	NA	NA
WP_050339213.1\|1179139_1179949_-	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
WP_088770034.1\|1179984_1180959_-	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
WP_088770035.1\|1181251_1182118_-	C39 family peptidase	NA	NA	NA	NA
WP_088770036.1\|1182304_1182547_-	hypothetical protein	NA	NA	NA	NA
WP_088770037.1\|1182880_1183726_-	hypothetical protein	NA	NA	NA	NA
WP_065674499.1\|1184615_1185146_-\|holin	holin	E9LUS0	Lactobacillus_phage	2.0e-34	93.1
WP_065674498.1\|1185158_1185422_-	hemolysin XhlA family protein	E9LUR9	Lactobacillus_phage	2.2e-37	97.7
WP_065674497.1\|1185421_1186594_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	3.8e-198	89.2
WP_088770038.1\|1186605_1186965_-	hypothetical protein	E9LUR7	Lactobacillus_phage	6.1e-43	77.3
WP_164886062.1\|1186948_1187110_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	2.3e-18	96.2
WP_157685943.1\|1187106_1187346_-	hypothetical protein	A0A2K9VCL5	Lactobacillus_phage	5.0e-17	79.6
WP_065674494.1\|1187396_1187651_-	hypothetical protein	A0A2K9VCL3	Lactobacillus_phage	7.9e-37	90.5
WP_088770039.1\|1187658_1190445_-	hypothetical protein	A0A291I9G1	Lactobacillus_phage	2.6e-104	54.2
WP_088770040.1\|1190459_1192814_-	hypothetical protein	E9LUR3	Lactobacillus_phage	5.1e-271	62.2
WP_088770041.1\|1192877_1194650_-\|tail	phage tail family protein	E9LUR2	Lactobacillus_phage	3.6e-237	67.9
WP_088770042.1\|1194725_1199225_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	57.1
WP_065674490.1\|1199266_1199452_-	hypothetical protein	NA	NA	NA	NA
WP_088770043.1\|1199496_1199871_-\|tail	phage tail assembly chaperone	A0A2P0ZLH4	Lactobacillus_phage	6.6e-56	92.7
WP_065674488.1\|1199943_1200591_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.9e-106	91.9
WP_065674487.1\|1200606_1200987_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.5e-60	92.9
WP_065674486.1\|1200986_1201394_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	8.5e-65	92.4
WP_063488418.1\|1201396_1201744_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	7.0e-44	73.9
WP_088770044.1\|1201730_1202066_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	2.7e-45	85.2
WP_065674484.1\|1202145_1203378_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	5.2e-73	42.0
WP_065674483.1\|1203392_1204136_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.1e-121	93.1
WP_088770045.1\|1204113_1205307_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.4e-224	98.7
WP_003644528.1\|1205309_1205504_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	7.4e-27	98.4
WP_088770046.1\|1205493_1207392_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	96.5
WP_065674480.1\|1207394_1207853_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	1.6e-80	97.4
WP_088770047.1\|1208048_1208516_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	3.9e-82	94.8
WP_191982858.1\|1208526_1208697_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.5e-20	89.3
WP_088770048.1\|1208680_1208872_-	hypothetical protein	NA	NA	NA	NA
WP_003638317.1\|1209600_1210029_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	8.3e-55	73.8
WP_050339247.1\|1210274_1210508_-	hypothetical protein	NA	NA	NA	NA
WP_003638315.1\|1210644_1210782_-	hypothetical protein	NA	NA	NA	NA
WP_162985048.1\|1210774_1210951_-	hypothetical protein	E9LUP2	Lactobacillus_phage	3.0e-11	62.1
WP_101809556.1\|1211031_1211199_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	1.1e-15	83.6
WP_088770049.1\|1211201_1211501_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.8e-43	86.9
WP_065674477.1\|1211657_1212533_-	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	6.3e-49	41.2
WP_065674476.1\|1212526_1213330_-	replisome organizer	E9LUM6	Lactobacillus_phage	6.4e-40	56.9
WP_088770050.1\|1213428_1213734_-	hypothetical protein	NA	NA	NA	NA
WP_191982859.1\|1213734_1213905_-	hypothetical protein	NA	NA	NA	NA
WP_088770051.1\|1213953_1214178_-	hypothetical protein	E9LUT8	Lactobacillus_phage	1.3e-27	84.9
WP_088770052.1\|1214197_1214389_-	hypothetical protein	E9LUT7	Lactobacillus_phage	8.3e-23	88.3
WP_065674473.1\|1214400_1214640_-	tagatose-bisphosphate aldolase	E9LUT6	Lactobacillus_phage	5.9e-34	83.5
WP_050339256.1\|1214774_1215053_-	hypothetical protein	A0A2P0ZLA9	Lactobacillus_phage	1.7e-32	78.2
WP_016058354.1\|1215120_1215447_+	hypothetical protein	E9LUT2	Lactobacillus_phage	8.3e-55	100.0
WP_050339257.1\|1215562_1215772_-	hypothetical protein	NA	NA	NA	NA
WP_191982860.1\|1215783_1216482_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	3.9e-70	61.7
WP_157685945.1\|1216743_1217046_-	hypothetical protein	NA	NA	NA	NA
WP_015380504.1\|1217042_1217264_-	hypothetical protein	NA	NA	NA	NA
WP_050339259.1\|1217522_1217849_+	helix-turn-helix transcriptional regulator	E3W8B9	Leuconostoc_phage	2.1e-18	46.1
WP_003641360.1\|1217879_1218269_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_050339260.1\|1218333_1218540_+	hypothetical protein	E9LUS6	Lactobacillus_phage	5.1e-26	100.0
WP_050339261.1\|1219026_1219209_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	6.7e-14	65.5
WP_088770054.1\|1220664_1221822_+\|integrase	site-specific integrase	A0A2P0ZL94	Lactobacillus_phage	6.3e-214	96.6
WP_056952844.1\|1222112_1222988_-	homoserine kinase	NA	NA	NA	NA
WP_050339265.1\|1222996_1224283_-	homoserine dehydrogenase	NA	NA	NA	NA
WP_050339266.1\|1224335_1224794_-	SprT family protein	NA	NA	NA	NA
WP_088770055.1\|1224786_1226967_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_050339268.1\|1227387_1227822_-	hypothetical protein	NA	NA	NA	NA
WP_088771264.1\|1227877_1230532_-	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.0e-70	30.1
WP_003637728.1\|1231471_1232299_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.2e-73	55.4
WP_050339269.1\|1232298_1233777_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	6.6e-107	44.1
WP_088770056.1\|1233934_1234672_+	WecB/TagA/CpsF family glycosyltransferase	NA	NA	NA	NA
WP_050339271.1\|1234810_1235512_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_088770057.1\|1235535_1236672_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_088770058.1\|1236752_1237541_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	6.5e-29	34.7
WP_088770059.1\|1237905_1238718_+	nicotinamide mononucleotide transporter	A0A291I9M7	Lactobacillus_phage	4.5e-49	41.5
WP_088770060.1\|1238995_1240096_+	anion permease	NA	NA	NA	NA
WP_088770061.1\|1240230_1241058_-	serine/threonine protein phosphatase	NA	NA	NA	NA
WP_050339276.1\|1241090_1241426_-	cupin domain-containing protein	NA	NA	NA	NA
WP_088770062.1\|1241470_1241788_-	cupin domain-containing protein	NA	NA	NA	NA
WP_082230353.1\|1242856_1243690_-	metallophosphoesterase	NA	NA	NA	NA
WP_050340435.1\|1243750_1245223_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.5e-66	33.8
WP_088770064.1\|1252477_1253977_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	9.7e-90	38.3
WP_088770065.1\|1254079_1255087_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_088770066.1\|1255086_1255974_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_088770067.1\|1256154_1258392_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	4.6e-104	47.8
WP_003637712.1\|1258472_1259015_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.5e-08	26.0
WP_088770068.1\|1259034_1260381_-\|tRNA	tRNA lysidine(34) synthetase TilS	R4TVK3	Phaeocystis_globosa_virus	1.0e-13	28.8
1266953:1266970	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2185351 : 2193943

Bacillus_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088770573.1\|2185351_2186443_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.9e-13	30.9
WP_088770574.1\|2186432_2187380_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-20	30.5
WP_162937100.1\|2187598_2188570_-	GMP reductase	Q4ZCY7	Staphylococcus_virus	9.8e-136	70.9
WP_003639882.1\|2188620_2189910_-	adenylosuccinate synthase	L7Y4J5	Megavirus	4.6e-72	37.0
WP_050339902.1\|2190226_2191525_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
WP_088770576.1\|2192608_2193943_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	4.6e-27	27.5

DBSCAN-SWA_4

2731522 : 2740033

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050339689.1\|2731522_2732005_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.7e-16	40.4
WP_088770893.1\|2731988_2733119_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_088770894.1\|2733121_2733853_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.1e-38	39.0
WP_088770895.1\|2733854_2734109_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_088770896.1\|2734108_2734789_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_088770897.1\|2734781_2737001_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	9.1e-145	41.0
WP_088770898.1\|2736985_2738440_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.1e-50	34.2
WP_088770899.1\|2738436_2739462_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FC27	Synechococcus_phage	4.2e-60	41.3
WP_088770900.1\|2739454_2740033_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-20	33.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022131

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022130

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection