CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	1 crisprs	csa3,RT,cas14j	3	7	1	0
NZ_CP016316	Bacillus cereus strain M3, complete sequence	4 crisprs	cas3,c2c9_V-U4,csa3,cas14k,WYL,cas4,c2c10_CAS-V-U3,DinG,cas14j,RT,Cas14u_CAS-V,DEDDh	0	2	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016317_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016317_1

143440-143816

TypeV

Consensus_repeat	Method
CCAGAAGAAAAACCAGAAGTGAAGCCAGA	CRT

7 spacers

cas14j

The CRISPR arrays of NZ_CP016317_1

>merge|NZ_CP016317|1|143440-143816|CRT
AAAGAGACTAAACCAGAAGTGAAGCCAGATCCAAAACCTGAAACAAAACCAGAAGAAAAGCCAGAAGTGAAGCCAGATCCAAAACCTGAAACGAAACCAGAAGAAAAACCAGAAGTGAAGCCAGATCCAAAACCTGAAACGAAACCAGAAGAAAAACCAGAAGTGAAGCCAGACCCAAAACCTGAAACGAAACCAGAAGAAAAACCAGAAGAAAAACCAGAAGTGAAGCCAGACCCAAAACCTGAAACAAAACCAGAAGAAAAACCAGAAGTGAAGCCAGACCCAAAACCTGAAACAAAACCAGAAGAAAAACCAGAAGTGAAGCCAGACCCAAAACCTGAAACGAAACCAGAGGAAAAACCAGAGACAAAGCCAGA

>NZ_CP016317|1|1|143440-143816|CRT
AAAGAGACTAAACCAGAAGTGAAGCCAGA	TCCAAAACCTGAAACAAAA
CCAGAAGAAAAGCCAGAAGTGAAGCCAGA	TCCAAAACCTGAAACGAAA
CCAGAAGAAAAACCAGAAGTGAAGCCAGA	TCCAAAACCTGAAACGAAA
CCAGAAGAAAAACCAGAAGTGAAGCCAGA	CCCAAAACCTGAAACGAAA
CCAGAAGAAAAACCAGAAGAAAAACCAGA	AGTGAAGCCAGACCCAAAACCTGAAACAAAA
CCAGAAGAAAAACCAGAAGTGAAGCCAGA	CCCAAAACCTGAAACAAAA
CCAGAAGAAAAACCAGAAGTGAAGCCAGA	CCCAAAACCTGAAACGAAA
CCAGAGGAAAAACCAGAGACAAAGCCAGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016317.1\|WP_001181745.1\|142159_142555_+\|DUF4320-family-protein	unknown	unknown	gnl\|CDD\|379505
NZ_CP016317.1\|WP_000557422.1\|137349_138486_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_000564666.1\|134287_134893_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133393
NZ_CP016317.1\|WP_000098927.1\|133365_133701_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_000425108.1\|150548_150941_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319772
NZ_CP016317.1\|WP_000239320.1\|140168_141668_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_000918313.1\|132031_133339_-\|plasmid-replication-protein-RepX	unknown	unknown	gnl\|CDD\|214867
NZ_CP016317.1\|WP_001032086.1\|150101_150356_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_000837871.1\|130308_131595_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379384
NZ_CP016317.1\|WP_000675654.1\|150990_151698_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP016317.1\|WP_001002940.1\|139195_140149_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_088883375.1\|155795_156923_-\|collagen-like-protein	unknown	unknown	gnl\|CDD\|236090
NZ_CP016317.1\|WP_001168864.1\|141684_142134_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_088883371.1\|144396_146748_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016317.1\|WP_088883374.1\|152522_155486_-\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_CP016317.1\|WP_088883372.1\|148729_149971_+\|glutathionylspermidine-synthase	unknown	unknown	gnl\|CDD\|367631
NZ_CP016317.1\|WP_085963576.1\|147294_148655_-\|IS3-like-element-ISBce15-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP016317.1\|WP_000160678.1\|135210_136323_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP016317.1\|WP_088883373.1\|151742_152258_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319806
NZ_CP016317.1\|WP_000583540.1\|157271_157835_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737

Protein	Function_ID	Function_description	E-value
NZ_CP016317.1\|WP_001181745.1\|142159_142555_+\|DUF4320-family-protein	gnl\|CDD\|379505	pfam14208, DUF4320, Domain of unknown function (DUF4320). This family of proteins is found in bacteria. Proteins in this family are typically between 120 and 131 amino acids in length. There are two completely conserved residues (G and Y) that may be functionally important.	1.11175e-28
NZ_CP016317.1\|WP_000675654.1\|150990_151698_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	9.33224e-15
NZ_CP016317.1\|WP_000564666.1\|134287_134893_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133393	cd04765, HTH_MlrA-like_sg2, Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	0.00087896
NZ_CP016317.1\|WP_000583540.1\|157271_157835_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	4.20442e-49
NZ_CP016317.1\|WP_000425108.1\|150548_150941_+\|hypothetical-protein	gnl\|CDD\|319772	cd02077, P-type_ATPase_Mg, magnesium transporting ATPase (MgtA), similar to Escherichia coli MgtA and Salmonella typhimurium MgtA. MgtA is a membrane protein which actively transports Mg(2+) into the cytosol with its electro-chemical gradient rather than against the gradient as other cation transporters do. It may act both as a transporter and as a sensor for Mg(2+). In Salmonella typhimurium and Escherichia coli, the two-component system PhoQ/PhoP regulates the transcription of the mgtA gene by sensing Mg(2+) concentrations in the periplasm. MgtA is activated by cardiolipin and it highly sensitive to free magnesium in vitro. It consists of a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0.00829821
NZ_CP016317.1\|WP_000918313.1\|132031_133339_-\|plasmid-replication-protein-RepX	gnl\|CDD\|214867	smart00864, Tubulin, Tubulin/FtsZ family, GTPase domain. This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins. These proteins are involved in polymer formation. Tubulin is the major component of microtubules, while FtsZ is the polymer-forming protein of bacterial cell division, it is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ and tubulin are GTPases, this entry is the GTPase domain. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in bacteria and archaea.	5.75845e-14
NZ_CP016317.1\|WP_000837871.1\|130308_131595_-\|hypothetical-protein	gnl\|CDD\|379384	pfam13814, Replic_Relax, Replication-relaxation. This family includes proteins which are essential for plasmid replication and plasmid DNA relaxation.	4.69275e-22
NZ_CP016317.1\|WP_088883375.1\|155795_156923_-\|collagen-like-protein	gnl\|CDD\|236090	PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated.	1.66765e-06
NZ_CP016317.1\|WP_000160678.1\|135210_136323_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.09955e-51
NZ_CP016317.1\|WP_088883374.1\|152522_155486_-\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	0
NZ_CP016317.1\|WP_085963576.1\|147294_148655_-\|IS3-like-element-ISBce15-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	6.25009e-58
NZ_CP016317.1\|WP_088883372.1\|148729_149971_+\|glutathionylspermidine-synthase	gnl\|CDD\|367631	pfam03738, GSP_synth, Glutathionylspermidine synthase preATP-grasp. This region contains the Glutathionylspermidine synthase enzymatic activity EC:6.3.1.8. This is the C-terminal region in bi-enzymes. Glutathionylspermidine (GSP) synthetases of Trypanosomatidae and Escherichia coli couple hydrolysis of ATP (to ADP and Pi) with formation of an amide bond between spermidine and the glycine carboxylate of glutathione (gamma-Glu-Cys-Gly). In the pathogenic trypanosomatids, this reaction is the penultimate step in the biosynthesis of the antioxidant metabolite, trypanothione (N1,N8-bis-(glutathionyl)spermidine), and is a target for drug design. This region, the pre-ATP grasp region, probably carries the substrate-binding site.	5.63787e-64
NZ_CP016317.1\|WP_088883373.1\|151742_152258_+\|HAD-family-hydrolase	gnl\|CDD\|319806	cd07503, HAD_HisB-N, histidinol phosphate phosphatase and related phosphatases. This family includes the N-terminal domain of the Escherichia coli bifunctional enzyme histidinol-phosphate phosphatase/imidazole-glycerol-phosphate dehydratase, HisB. The N-terminal histidinol-phosphate phosphatase domain catalyzes the dephosphorylation of histidinol phosphate, the eight step of L-histidine biosynthesis. This family also includes Escherichia coli GmhB phosphatase which is highly specific for D-glycero-D-manno-heptose-1,7-bisphosphate, it removes the C(7)phosphate and not the C(1)phosphate, and this is the third essential step of lipopolysaccharide heptose biosynthesis. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.03874e-55

>NZ_CP016317.1|WP_001181745.1|142159_142555_+|DUF4320-family-protein
MQNTVTTALFLTLSLLLITLIPEGVLYGMQLVKAHDFASSTVELAEQTGGFQYTYEGKNVNLIPDIEKKMKEQNMDGWKYEYTKGRVDHNQPLNFKIKAEHHFFIFKMIGIDSVKAPIWANKDGMGQIYFR
>NZ_CP016317.1|WP_001168864.1|141684_142134_+|hypothetical-protein
MQKFIIGAASILLFVGCLFLMTDMIIGDTTHTDNKSASERAGSTAMDKAVKVGVLRAQEEIAIEPGIAKKEFEKSYKQNATFKDPASKREFSVHAVQEQPAMIAVEGEAEAASYTKQFDEKKGNIKSNARHIFIYEADSDNKKAGGNVK
>NZ_CP016317.1|WP_000239320.1|140168_141668_+|hypothetical-protein
MVKKIVLAISDTVYTAYLREDFIGAGFEVADSDVMHIKYLDEILDTEQPDILCINDKRLNIDAGHEEKRELIILQKLRDIRFNRDIRIVVFTERENDDEFLAKLIYLGIYDIFNSRRIDIDNKVIPQLLQESDIKNVAEIVGASQAPQQTKLPEVPVDEEEEEVSSELEEGGNNEASSNSKKLFKNNQKRKSVPGESQKAPIIKKQYKLAFEPVYEKQIGIAIPRRTIVVASMNKRSGATFVSHLLAAYLNELQIDVNYIENLYDDGYTYPLLKGYTEAPENYRSEFMLQRYKEMLQKESDILSIPKWKQGRINYIVKNPIVDQELKNETEQDFDHFIKVLLANQEAPISIIDAGYDWDKDLYHEICEMADFIFFVAEPDLHQLLKIAHPLTQKERKLVSYLVLEKTRIIGNKFSTALLKHEVVEECFGDKVLTALAPYEIEDVFESQLKSSTLLSSRNYYKELEGIMKEIAELLLPNQLLNQKKSSILSGFRFRKSEN
>NZ_CP016317.1|WP_001002940.1|139195_140149_+|hypothetical-protein
MNEIVNMSKERFTKYCEENAAFEEDISRIINHYFLLLGNKANILQEREFNNEIEEKTFKNNVKRFETLFPAAVKNAFLKGYQLCLEFINHPETQIPENLYTDPNFIKDIPFALANASEYELYEIIRTDETQEFSVFAIRTYEGIRPLLEQVFCEVAFTGAEYAFEHERMEKGIELKKGNSTSLTKVPVDRLFAITPSVNGVVVHAEEHCEIWNLNWNSKVTINDPFIELAEVTFIHQTKDMIQKNIEDGVLYYSILYLGTPLHEIQDRLEIRVKLNSDFGAPRTMEQVEIEYILNEIIGKVHLEAQIPIENMILIQR
>NZ_CP016317.1|WP_000557422.1|137349_138486_+|hypothetical-protein
MHTQMAFSQQNFKVHGVKFFDGLLNIVKLENERKELPSSALATYILLHFECNDIGMLPREFQIMDLAKKSGIPYTTIYTGFQVCLERRLVKETPVGNRTVYEIVDYALYNHTTAETAKMTGISLSYFRIPFHLIQTTIMSSLVKARDNRGIIFLLDLINTFSRKVGMEHYKHKIEEFQITRKMSSLKRRLNRNAKKVRHYIEIINPIVQFTAIDSKEKKSNETRITSARKQVKQIIIEKFNVVFSSNCVIENDKKELHRPVAKCRKEAVSRLKHMGQALRKKDKENIMTAFRQEIVDIAIYLPTKQKQSELLIYAMTYALDQVESCLKEQEIFSIPAFMRVKFRESWIGFKEKNLSTGKKHDAMINYHKKNGVYPEFM
>NZ_CP016317.1|WP_000160678.1|135210_136323_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MTKHNKAYKFRLYPTGDQAHLMRKTFGCVRFVYNRMLAERKEAYEKHKDDKEQLKKQKLPTPAKYKAEFEWLKEVDSLALANAQLNLQTAYKNFFRGQNDFPTFKSKKDRKSYTTNVVNGNIMLLNGHIKLPKLKMVRIKQHREIPQDHVIKSCTISMTPTGKYYVSILTEYEKEIVQNEVETVVGLDFAMDRLYVSSEDERANYPKFYREMLDRLAKAQRVLSRRTKGSIRWNKQRIRVAKLHEKVANQRKNFLHHKSKELATHFDVVAIEDLNMKGMSQALHFGKSVADNAWGMFTSFLAYKLHEQGKQLMKIDKWFPSTKTCSSCGNVKNMSLSERVYSCICGVNLDRDYNAAINIKNEAIRLLALA
>NZ_CP016317.1|WP_000564666.1|134287_134893_+|MerR-family-transcriptional-regulator
MIDEQLSDGYYRVSEVATMLDIPESTLRRWLNDFDEYLNIKKERQLKYVHEDSIDTVKKIKHYYSESKKKHEIVGLLDMDPTVIRNVYAEDVDGDGEPKETSLVKAQQVNPDFIEALTEKITEEVTAKVTEELTKQNMEFFAAVAKQSQDNFDRINKRLEERDEKLMSTIRLIQEQKSANAQRQENTEQKGGFFSKLFGKK
>NZ_CP016317.1|WP_000098927.1|133365_133701_-|hypothetical-protein
MSSSEIIDVLCENLNDGIWALRVLYAEGAMNKEKLWDYINQYHKDYQIENEKDYEGKKILPSRYALDIMTARLEGAGLISFKAIGRVRIYDVTDLGNVLIKELEKRVEKNN
>NZ_CP016317.1|WP_000918313.1|132031_133339_-|plasmid-replication-protein-RepX
MAGNFSEIESQGNISLKFGFLGLGMGGCAIAAECANKETQIKNNKYPYRAILVNTNSQDFNKIEIKNTGNVRKIQLEGYEQGAARNPQVGEEAFVKHETKIFEAVKQEFEDRDFIWITCGLGGGTGTGALLKAIEMLYEHDYNFGLLLTLPRDAEALKVLENATSRIRSIAMNQEAFGSIVLIDNAKLYRKFEEENPSALANEYTSYSNKYIADALHEINLVTSSFTPFSDTHFDASEFAQVINTPGVLSLAKLELKSNQLDTENPLGYLTQLGNALEKGVLYDTEREELESAKKSALSIVTSPLRAGRLYNFSFLNQMENFLKERTPYVDERPIAPYVNKHTTKKEEDIVKFYSVVAGLPLPKRVSDIIDEITRIKEEREQANSKKSNAVLNKLFAFDDSVQEEKPKKKKLNFGAEPEVEVADDSQPAKKKLSF
>NZ_CP016317.1|WP_000837871.1|130308_131595_-|hypothetical-protein
MKSKTYKYTSKGTQKSFRLKEADIFVFTFLYYKRYLTTRQITQLYSAFEGRDFSEDSVFTKLNRFSKYGAILTKKIDKRDDSITRRATFSLKDRMVDYLQELGRIPAGSSKRRYSSSISLHTLCSREILVRTLLEVSKKTNTNKLLCELDIRSYHQKQKKTEIEDAGLLLIPDEHISYKDKNIYIEMDMCKETNATLVEKVGKYIEYAQKNTKNITVVFVMYDKSMFLAEDAEPPYVRMKNLLFSMREYHEHLMNLPNLNMHICSLKEAGDVISDILLGIDDNQNFEQDILLPLSKRTVGDADWRYAFVETVQTFKEKIDGGLRRTYKRDKDVMQDFFFIFGNENDYRMIARLDDVVFSRREGDEGVPLVVIYPKRKKARDILLMDTYDNVLLLSLQNEGVTIDADEQIMARTANNIHPKRRKLVELY
>NZ_CP016317.1|WP_088883371.1|144396_146748_+|hypothetical-protein
MKIKSKLLLVCTSVLLAMPTMVEAKNADVPFLNGNEDKFLKSKDLQMQGKFYRFGRDYAPPGIDLAYKGDLHYPAVYNGSFSFENPQANLVQSEDLSEPYVRISNEGYWNKAVTVGDRMVTEIERVNNGVISDKYWGNPKFVLDNINSHVIFNNSGSENYGAFYWIRDIAYLSGGYAGAGGVNGINKYNLWYVRSSKPEIKDFKASNGKKDTPVKITFNGFEYVSKDKGYTERGPKLDLGNPYSSIAGERNRVKWLLDITKNGEKVHHQENYLRSTPQKDNQKPNEGDAGRFTKEDISWQPQMCGRYTAKLKIIDGVQRDSNEKTVDFIVDGNCGTEVTPNPDPGDEDDFKYKIDFSADRIEGETAREGKNIKTRIDVSRDNFKPERDQYREKVNNNINKSQQEVYRAESDRDSAQSSLSYCRRNPIHEKDEKGNDYYIDRDCSWEENRLDSAVSRLDTARQKLEKEKNKIKKLDALEAKYANPETVVVLKHNGQQVASEKVRLTEREKKTLNLGWQHKGKGTIQAEINPAGNRLDIEETTYKNNPIKTAIYAPSHEKGMCGVTSVKGVVETVSERVSKEDTVGEMFYETLSGSIDNLAPSKLHAGYGFSYEVNGKYKNDWNTNYPGVFTKATAQYPFADEGLKTTYDLESVSNNGLTSKFLPKNMYLSEVTGHVFDSKRPTKSLYWDGKEKIIDGQRKWYAPLKTKDGKYSFNVETNPAGVNEMSLCLTDEVKIKGVAYDDFKKRRVLADLPFPVQTPGWNWVGKENIITDLSNWYYMKNRN
>NZ_CP016317.1|WP_085963576.1|147294_148655_-|IS3-like-element-ISBce15-family-transposase
MSRKYKFELKRNAVEHYLNTNDSFKVTAKKYQVSISLLKEWVARTREQGIESLNSKCTRYDIQFKMEVLNFMNNTGASPLQAAAMFNVPSPRTVRKWRSMLESQGIDALRKTSKGYSTVKKKQAIAPKKKQNINSQNDLQKEIEYLRMENAYFKKVTRLNSTKTTISEKDKAHIIYELRHEYKIIDLIKAAEMARSTYYYWVKQMSREDKYNEVKESIKQIFQEHQGRYGYRRITLELRNQGYTINHKTVLRLMNQLGLKSLVRITKYRSYRGKVGKVAPNVLKRDFKASKPNEKWVTDVTEVHLFGEKLYLSPILDLFNGEIISYNIEKRPTFLLVERMLDKALKCLDKEDTPILHSDQGWHYQMDRYQYILRENNITQSMSRKGNCLDNAVIENFFGLLKSELLYLKDFESMEHFREELENYIYYYNNKRIKAKLKGLPPVKYRIQSLLAA
>NZ_CP016317.1|WP_088883372.1|148729_149971_+|glutathionylspermidine-synthase
MLDNQQQQDYMKKWFALSEQACTRGFTWPSLLENDEWCQYMSTGIKRIKKEEYNNIIEATELVKTIFQKVYKYLLESHEGFLQLKLPTELWEVTRTNYDVLFSYFTRFDFIVANDEIKLIEINADTPTGYLEPSVANQVLCDHHQVINPNCIEEKLETTWHKIISDYELNPHDVIHFTSYDWHEEDYQTVKFIQQYCPQPSDYVGIQSIIVADDGLYTPDGVKIEYLYRLYPLEYLLEDKDYSGKSIGLMFLDHIAQGRVKIINPPSAFLIQNKGVLALIWQLHEQNKWFTEKEHKIIEKYFLPTYFSKDKFEENDIDYVKKATFGREGGGVSIINEGKEVAADKTPYYEQQHKIYQKYIEMPDCTIDTWDGDYTGKLLIVSHLIGGEPAGLFLRVGERITGNLSMFIGISTE
>NZ_CP016317.1|WP_001032086.1|150101_150356_+|hypothetical-protein
MNKFQTMKDLKEEFGSNVLSSFLILIGAIISIIFGNVTKDLFDTNVSVWLYIIACYVVPFIFMVLEFWLVARTKRIVKEMNNLQ
>NZ_CP016317.1|WP_000425108.1|150548_150941_+|hypothetical-protein
MEMEKFNAKAFFIFIGIILILSIGARFAQEFRAEQEKNHEIRMELTRSNVKVAEEMVAKELNTDNKNFRMTAVPGDLLNRSYWITKELVSEIKKDGEEYRIYFETKRVSNSEGDLVMYKPTGIYKILKEE
>NZ_CP016317.1|WP_000675654.1|150990_151698_+|CPBP-family-intramembrane-metalloprotease
MKGEYSKMNHSNLHKSGYVILIYFVMTQFVGIIGVQLLAKTGWYDIKGNQQQAIQQLLVHWELIGFSLILIFIYLIYKKEAMNDSKLSIKLSRVSFGWILIGIVAVFFAQTIGSILDKSIFHLTTQSVNTSSSIESVAISPLALVSIVILAPLVEELVFRYAAINILSRKFNKIMCILVSALFFSIIHFDFPFVFGYFLIGLVLAAIYIRTNRLLVSFVVHATMNLIIVILQIFQ
>NZ_CP016317.1|WP_088883373.1|151742_152258_+|HAD-family-hydrolase
MFLDRDGVINQVLTDRVRFVNKPEDIYLLPGAADAIAIFNRQGYMVLVTSNQGGVGLGYMTQEELLEIHKHMQEKLINENAGAHIQEFAACIHRLKDGCSCRKPEAGMLLQLAQKYDIDLASSYMIGDQETDICAGKKAGTKTIRIASSLEETQANFKFPSLLNVALENIF
>NZ_CP016317.1|WP_088883374.1|152522_155486_-|Tn3-family-transposase
MGVKQLLSEAQRNELMDLSRLTEWDLVTFHTFSKHDLHLIFKHRRGYNRLGFALQLALIRYPGWALTEYNDIPMSVIKHIARQLQIPAEEFSKYANRNNTLWEHLSEIREEYNFTNFSSSHEENLLKHLTQQAMENSNSLHLIEIALSMLRKSKVILPAMYVIENIVWEAKQQADQKVYSILYDDLTSEQKKRIDALLLPTNNGISPLAWLKQLPSQPSPESFLKVVERFEYVKDIGLVVDTSKINSNRLRQLARLGSKYEPYAFRRFDEVRRYSILVAFMLEITQDLIDYAIEIHDRIMMNLQLKGKKAQDEMQKVNGKKLNEKLVQFIKICGALIEAKEVGKDAFTALDDVMPWDKMVESVEEAKQLSRPISYDYLDLLETRYSYIRRYAPTLLRVFQFGSTKSAEPVLQALHTIHDLNINGKRKVPMSAPLNFVSNRWQKHVYDDEGNVNRHYYELAALTELRNYIRSGDVFVSGSRQHKAFDDYLISEEDWRNIINAENYLAVPLTVEEYLTERITSLNQRLDWLSKNSEKLEGVDISQGKLYVERLDKGTPEEAKAFSIRLHNMLPRIKLTDLLLEVSSWTGFHEQFIHASTNKSPDKEEKNVVLATLMAMGTNIGLTKMAEATPGISYRQMANTAQWRIYDDAMVRAQSVLVNFQHRRQLATYWGDGNTSSSDGMRVPIGVRSLHADSNPHYGTGRGATIYRFISDQFASFYLKVINTNARDALYVLDGLLHHETDLMIEEHYTDTAGYTDQVFGLTHLLGFRFAPRIRDLMDTKLFTINGVQEYPNVQSLLKGKINLKVIQENYNDVLRLAYSVRTGKVSSSLIMGKLGSYARQNKLATALGEMGRIEKTIFTLDYISSKSVRRKIQKGLNKGEATNALARAIFFGKSGEFRERALQDQLQRASALNIIINAISVWNTVYMEKAVEELKDTGEFREDLMPYIWPLGWEHINFLGEYKFEGLHATSLQSLRPLNIKEPIYS
>NZ_CP016317.1|WP_088883375.1|155795_156923_-|collagen-like-protein
MSDENEKKYSNELAQADFISAAAFDPSLVGPTLPPTPPFTLPTGPTGATGPTGATGSTGVTGPTGVTGPTGATGPTGATGSTGVTGPTGATGPSGATGSTGTTGPTGDTGPTGITGPTGVTGPTGATGPTGATGPTGATGPTGATGSTGVTGPTGITGPTGATGTTGSTGPTGVTGPTGVTGPTGATGPTGVTGPTGATGPTGATGPTGATGATATTSTKAILFGGTNAGFQRIAGSPGADSQTLPYVTAGAGSVVAFSASINVNNLGTGVYLLRVCDNVPTNLASPGAGQIVSTITLTLTANITGTIVFSIKPTDIGAQPVKVFNPNPVVAPATVTWTSTIPGNPVARTDAISLFITPGITQSAVYSVFISTAV
>NZ_CP016317.1|WP_000583540.1|157271_157835_+|recombinase-family-protein
MIIGYARVSTFDQNLDRQIHSLTEYGCEKVIQENFTGTIRERQGLINLFDVIRKGDTVVVESISRLGRKTLDILSIIQQFEEIGIQFVSLKENMDTGTPTGKAMLQMMCVIAELERNLIAERVKEGLEASKKRGKRLDRPKLEKEKLSIALRMYDSKEYSIKEIVEGTGVSQGSLYRAINQRKLEET

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP016316.1	2981870-2981888	2	0.895
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP016316.1	1779977-1779995	2	0.895
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP016316.1	1779977-1779995	2	0.895

1. spacer 1.1|143469|19|NZ_CP016317|CRT matches to position: 2981870-2981888, mismatch: 2, identity: 0.895

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaagccagaaacaaaa	Protospacer
******.** *********

2. spacer 1.2|143517|19|NZ_CP016317|CRT matches to position: 1779977-1779995, mismatch: 2, identity: 0.895

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacaagaaacgaaa	Protospacer
********  *********

3. spacer 1.3|143565|19|NZ_CP016317|CRT matches to position: 1779977-1779995, mismatch: 2, identity: 0.895

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacaagaaacgaaa	Protospacer
********  *********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	75094-75112	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	75142-75160	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	75190-75208	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	79990-80008	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80110-80128	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199578-199596	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199674-199692	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199722-199740	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	187591-187609	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	211510-211528	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143469-143487	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	280813-280831	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	280861-280879	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	280909-280927	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	443713-443731	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	82774-82792	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	5351-5369	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	303447-303465	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68733-68751	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69304-69322	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69352-69370	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69400-69418	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69448-69466	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	161454-161472	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263766-263784	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263814-263832	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263862-263880	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263910-263928	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433581-433599	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	62919-62937	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499916-499934	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500060-500078	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267364-267382	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267436-267454	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267484-267502	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267544-267562	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267592-267610	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267640-267658	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267688-267706	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	361014-361032	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166658-166676	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166706-166724	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166754-166772	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166802-166820	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	56552-56570	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	371740-371758	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	82223-82241	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	119896-119914	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	124119-124137	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	87214-87232	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	119821-119839	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	458420-458438	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	82505-82523	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244696-244714	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244744-244762	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244792-244810	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10556-10574	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10604-10622	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10652-10670	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10700-10718	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10748-10766	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23680-23698	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23872-23890	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180878-180896	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180926-180944	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180974-180992	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	216798-216816	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	185883-185901	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233810-233828	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233858-233876	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233906-233924	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233954-233972	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	76778-76796	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123346-123364	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123394-123412	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123442-123460	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123490-123508	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123538-123556	0	1.0
NZ_CP016317_1	1.1\|143469\|19\|NZ_CP016317\|CRT	143469-143487	19	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152759-152777	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143517-143535	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143565-143583	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104524-104542	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104620-104638	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104716-104734	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471719-471737	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	45932-45950	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46028-46046	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46124-46142	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55576-55594	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55672-55690	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55768-55786	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68589-68607	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68637-68655	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	161406-161424	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433485-433503	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433533-433551	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	10434-10452	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	216846-216864	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487767-487785	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP009317	Bacillus cereus 03BB102 plasmid unnamed, complete sequence	84038-84056	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NC_012473	Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence	52867-52885	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127639-127657	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127735-127753	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127831-127849	0	1.0
NZ_CP016317_1	1.2\|143517\|19\|NZ_CP016317\|CRT	143517-143535	19	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	371788-371806	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143517-143535	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143565-143583	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104524-104542	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104620-104638	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104716-104734	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471719-471737	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	45932-45950	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46028-46046	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46124-46142	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55576-55594	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55672-55690	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55768-55786	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68589-68607	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68637-68655	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	161406-161424	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433485-433503	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433533-433551	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	10434-10452	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	216846-216864	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487767-487785	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP009317	Bacillus cereus 03BB102 plasmid unnamed, complete sequence	84038-84056	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NC_012473	Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence	52867-52885	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127639-127657	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127735-127753	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127831-127849	0	1.0
NZ_CP016317_1	1.3\|143565\|19\|NZ_CP016317\|CRT	143565-143583	19	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	371788-371806	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143613-143631	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143769-143787	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471767-471785	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471815-471833	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68685-68703	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68889-68907	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	NZ_CP014853	Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence	337788-337806	0	1.0
NZ_CP016317_1	1.4\|143613\|19\|NZ_CP016317\|CRT	143613-143631	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500108-500126	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80290-80320	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143661-143691	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143709-143739	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104476-104506	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104572-104602	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104668-104698	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50731-50761	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	45968-45998	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46064-46094	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46160-46190	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55528-55558	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55624-55654	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55720-55750	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107140-107170	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68781-68811	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68829-68859	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96455-96485	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244840-244870	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10508-10538	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23776-23806	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23824-23854	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499808-499838	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499952-499982	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	106009-106039	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133317-133347	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133413-133443	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166838-166868	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152591-152621	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018486	Bacillus thuringiensis HD-771 plasmid p01, complete sequence	154246-154276	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	87022-87052	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127591-127621	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127687-127717	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127783-127813	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197693-197723	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197789-197819	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80026-80044	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80062-80080	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80302-80320	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143673-143691	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143721-143739	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50695-50713	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50743-50761	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50791-50809	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	45980-45998	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46076-46094	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46172-46190	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107104-107122	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107152-107170	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107200-107218	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68793-68811	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68841-68859	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96419-96437	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96467-96485	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96515-96533	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499820-499838	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499868-499886	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499964-499982	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500012-500030	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	105973-105991	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	106021-106039	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	106069-106087	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	360834-360852	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133329-133347	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133425-133443	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166850-166868	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_018486	Bacillus thuringiensis HD-771 plasmid p01, complete sequence	154258-154276	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197705-197723	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197801-197819	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104476-104494	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104572-104590	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104668-104686	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55528-55546	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55624-55642	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55720-55738	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244840-244858	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10508-10526	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23776-23794	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23824-23842	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	186063-186081	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152591-152609	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	87022-87040	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127591-127609	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127687-127705	0	1.0
NZ_CP016317_1	1.6\|143721\|19\|NZ_CP016317\|CRT	143721-143739	19	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127783-127801	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143613-143631	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143769-143787	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471767-471785	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471815-471833	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68685-68703	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68889-68907	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	NZ_CP014853	Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence	337788-337806	0	1.0
NZ_CP016317_1	1.7\|143769\|19\|NZ_CP016317\|CRT	143769-143787	19	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500108-500126	0	1.0
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	79978-80008	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80014-80044	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80050-80080	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80098-80128	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143457-143487	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143601-143631	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143757-143787	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50827-50857	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50683-50713	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50779-50809	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107236-107266	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107092-107122	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107188-107218	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68673-68703	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68721-68751	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68877-68907	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96551-96581	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96407-96437	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96503-96533	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244696-244726	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244744-244774	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244792-244822	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10556-10586	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10748-10778	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23872-23902	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499856-499886	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500000-500030	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500096-500126	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	106105-106135	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	105961-105991	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	106057-106087	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166646-166676	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166790-166820	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152759-152789	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	75082-75112	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	75130-75160	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_KY940428	UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence	75178-75208	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP004876	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence	82223-82253	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_017203	Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence	119896-119926	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199566-199596	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199710-199740	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_020384	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence	124119-124149	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	187579-187609	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	187627-187657	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	211498-211528	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	280801-280831	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	280849-280879	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	280897-280927	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	443701-443731	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471755-471785	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471803-471833	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP015152	Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence	119821-119851	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP013056	Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence	82762-82792	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	458420-458450	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	5339-5369	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	303435-303465	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP004861	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence	82505-82535	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263754-263784	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263802-263832	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263850-263880	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	263898-263928	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014866	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence	62907-62937	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	100158-100188	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	100206-100236	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP014853	Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence	337776-337806	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267352-267382	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267472-267502	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267532-267562	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267628-267658	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	361002-361032	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	361050-361080	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	185835-185865	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	185883-185913	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	425629-425659	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010091	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence	76778-76808	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	56540-56570	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	56588-56618	1	0.968
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143505-143535	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016317	Bacillus cereus strain M3 plasmid pBCM301, complete sequence	143553-143583	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104524-104554	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104620-104650	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104716-104746	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	104764-104794	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011655	Bacillus cereus AH187 plasmid pAH187_270, complete sequence	50635-50665	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	45872-45902	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	45920-45950	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46016-46046	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	46112-46142	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55576-55606	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55672-55702	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55768-55798	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_005707	Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence	55816-55846	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_010924	Bacillus cereus strain AH187 plasmid pCER270, complete sequence	107044-107074	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68577-68607	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_011777	Bacillus cereus AH820 plasmid pAH820_272, complete sequence	68625-68655	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP045776	Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence	96359-96389	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010111	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence	244888-244918	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10604-10634	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10652-10682	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	10700-10730	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23920-23950	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23680-23710	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022346	Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence	23728-23758	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	499904-499934	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046512	Bacillus cereus strain JHU plasmid p1, complete sequence	500048-500078	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_016792	Bacillus cereus NC7401 plasmid pNCcld, complete sequence	105913-105943	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166694-166724	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	166742-166772	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152663-152693	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	86974-87004	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	87070-87100	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	87118-87148	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127639-127669	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127735-127765	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127831-127861	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	127879-127909	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199518-199548	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199614-199644	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053290	Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence	199662-199692	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	187483-187513	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_020394	Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence	187531-187561	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	458276-458306	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP044979	Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence	458372-458402	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	99942-99972	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	99990-100020	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	100038-100068	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	100110-100140	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267424-267454	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267580-267610	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP046513	Bacillus cereus strain JHU plasmid p2, complete sequence	267676-267706	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	360954-360984	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	360858-360888	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	360906-360936	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	185931-185961	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	185979-186009	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	186027-186057	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	425486-425516	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	425534-425564	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	CP020755	Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence	425582-425612	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	56444-56474	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP021062	Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence	56492-56522	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69220-69250	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69292-69322	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69340-69370	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69388-69418	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042928	Bacillus cereus strain G1-1 plasmid unnamed, complete sequence	69436-69466	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	181034-181064	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180878-180908	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180926-180956	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	180974-181004	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	234026-234056	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233810-233840	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233858-233888	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233906-233936	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040341	Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence	233954-233984	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123586-123616	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123346-123376	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123394-123424	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123442-123472	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123490-123520	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	123538-123568	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	95029-95059	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	95065-95095	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040783	Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence	120146-120176	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	96198-96228	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	96246-96276	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	96294-96324	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	96342-96372	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	87214-87244	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	87262-87292	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	161394-161424	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP007513	Bacillus bombysepticus plasmid pBb, complete genome	161490-161520	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433473-433503	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433521-433551	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014865	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence	433569-433599	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	10254-10284	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	10290-10320	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	10338-10368	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP023246	Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence	10374-10404	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	216750-216780	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	216798-216828	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP042875	Bacillus cereus strain 09 plasmid unnamed1, complete sequence	216846-216876	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487767-487797	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487839-487869	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487887-487917	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487935-487965	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP045607	Bacillus cereus strain SB1 plasmid p1, complete sequence	487983-488013	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259439-259469	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259487-259517	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259535-259565	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259583-259613	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259631-259661	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259679-259709	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	371728-371758	2	0.935
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80146-80176	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80194-80224	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80242-80272	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133221-133251	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133269-133299	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009636	Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence	133365-133395	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197597-197627	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197645-197675	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053962	Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence	197741-197771	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009317	Bacillus cereus 03BB102 plasmid unnamed, complete sequence	83942-83972	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP009317	Bacillus cereus 03BB102 plasmid unnamed, complete sequence	83990-84020	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_012473	Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence	52903-52933	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_012473	Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence	52951-52981	3	0.903
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	471707-471737	4	0.871
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP050184	Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence	259391-259421	4	0.871
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152639-152669	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP016589	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence	86926-86956	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	360822-360852	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	186063-186093	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP040783	Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence	120230-120260	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP010578	Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence	96150-96180	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP020005	Bacillus thuringiensis strain Bacillus thuringiensis L-7601 plasmid unnamed3, complete sequence	121703-121733	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257549-257579	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257597-257627	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151796-151826	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151844-151874	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	105035-105065	5	0.839
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NC_018501	Bacillus thuringiensis HD-771 plasmid p02, complete sequence	152495-152525	6	0.806
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_CP015177	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence	87166-87196	6	0.806
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	105059-105089	6	0.806
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	105083-105113	6	0.806
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	105107-105137	6	0.806
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	105131-105161	6	0.806
NZ_CP016317_1	1.5\|143661\|31\|NZ_CP016317\|CRT	143661-143691	31	NZ_AP014867	Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence	105155-105185	6	0.806

1. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

2. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

3. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

4. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

5. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

6. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

7. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

8. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

9. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

10. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

11. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

12. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

13. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

14. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

15. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

16. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

17. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

18. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

19. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

20. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

21. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

22. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

23. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

24. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

25. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

26. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

27. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

28. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

29. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

30. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

31. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

32. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

33. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

34. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

35. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

36. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

37. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

38. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

39. spacer 1.1|143469|19|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

40. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

41. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

42. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

43. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

44. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

45. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

46. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

47. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

48. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

49. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

50. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

51. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

52. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

53. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

54. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

55. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

56. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

57. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

58. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

59. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

60. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

61. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

62. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

63. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

64. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

65. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

66. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

67. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

68. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

69. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

70. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

71. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

72. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

73. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

74. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

75. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

76. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

77. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

78. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

79. spacer 1.1|143469|19|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacaaaa	CRISPR spacer
tccaaaacctgaaacaaaa	Protospacer
*******************

80. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

81. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

82. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

83. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

84. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

85. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

86. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

87. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

88. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

89. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

90. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

91. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

92. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

93. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

94. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

95. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

96. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

97. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

98. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

99. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

100. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP009317 (Bacillus cereus 03BB102 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

101. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NC_012473 (Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

102. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

103. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

104. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

105. spacer 1.2|143517|19|NZ_CP016317|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

106. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

107. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

108. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

109. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

110. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

111. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

112. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

113. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

114. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

115. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

116. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

117. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

118. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

119. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

120. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

121. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

122. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

123. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

124. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

125. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

126. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP009317 (Bacillus cereus 03BB102 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

127. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NC_012473 (Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

128. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

129. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

130. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

131. spacer 1.3|143565|19|NZ_CP016317|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 0, identity: 1.0

tccaaaacctgaaacgaaa	CRISPR spacer
tccaaaacctgaaacgaaa	Protospacer
*******************

132. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

133. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

134. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

135. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

136. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

137. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

138. spacer 1.4|143613|19|NZ_CP016317|CRT matches to NZ_CP014853 (Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

139. spacer 1.4|143613|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

140. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

141. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

142. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

143. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

144. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

145. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

146. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

147. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

148. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

149. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

150. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

151. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

152. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

153. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

154. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

155. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

156. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

157. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

158. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

159. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

160. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

161. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

162. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

163. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

164. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

165. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

166. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

167. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

168. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018486 (Bacillus thuringiensis HD-771 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

169. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

170. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

171. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

172. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

173. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

174. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaaa	Protospacer
*******************************

175. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

176. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

177. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

178. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

179. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

180. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

181. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

182. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

183. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

184. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

185. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

186. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

187. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

188. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

189. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

190. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

191. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

192. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

193. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

194. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

195. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

196. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

197. spacer 1.6|143721|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

198. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

199. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

200. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

201. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

202. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

203. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

204. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

205. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_018486 (Bacillus thuringiensis HD-771 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

206. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

207. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

208. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

209. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

210. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

211. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

212. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

213. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

214. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

215. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

216. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

217. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

218. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

219. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

220. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

221. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

222. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

223. spacer 1.6|143721|19|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacaaaa	CRISPR spacer
cccaaaacctgaaacaaaa	Protospacer
*******************

224. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

225. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

226. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

227. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

228. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

229. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

230. spacer 1.7|143769|19|NZ_CP016317|CRT matches to NZ_CP014853 (Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

231. spacer 1.7|143769|19|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

cccaaaacctgaaacgaaa	CRISPR spacer
cccaaaacctgaaacgaaa	Protospacer
*******************

232. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

233. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagacccaaaacctgaaacaaaa	Protospacer
***.***************************

234. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagacccaaaacctgaaacaaaa	Protospacer
***.***************************

235. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

236. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

237. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

238. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

239. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaat	Protospacer
******************************

240. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

241. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

242. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaat	Protospacer
******************************

243. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

244. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

245. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

246. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

247. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

248. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaat	Protospacer
******************************

249. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

250. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

251. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

252. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

253. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

254. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

255. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

256. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

257. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
ggtgaagccagacccaaaacctgaaacaaaa	Protospacer
.******************************

258. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
ggtgaagccagacccaaaacctgaaacaaaa	Protospacer
.******************************

259. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

260. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacaaat	Protospacer
******************************

261. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

262. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagacccaaaacctgaaacaaaa	Protospacer
******.************************

263. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

264. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

265. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

266. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

267. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

268. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_KY940428 (UNVERIFIED: Bacillus sp. (in: Bacteria) strain PUMK-07 plasmid pMK-07, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

269. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP004876 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB299, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

270. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_017203 (Bacillus thuringiensis serovar chinensis CT-43 plasmid pCT281, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

271. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

272. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

273. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_020384 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-285, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

274. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

275. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacctaaaacctgaaacaaaa	Protospacer
**************.****************

276. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

277. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

278. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

279. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

280. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

281. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

282. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

283. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP015152 (Bacillus thuringiensis strain Bc601 plasmid pBTBC2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

284. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP013056 (Bacillus thuringiensis strain YWC2-8 plasmid pYWC2-8-1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

285. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

286. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

287. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

288. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP004861 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB293, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

289. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

290. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

291. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

292. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

293. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014866 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

294. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgagacaaaa	Protospacer
************************.******

295. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgagacaaaa	Protospacer
************************.******

296. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP014853 (Bacillus thuringiensis strain HD12 plasmid pHD120345, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaaacgaaa	Protospacer
***************************.***

297. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

298. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

299. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

300. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

301. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

302. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacctaaaacctgaaacaaaa	Protospacer
**************.****************

303. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacctaaaacctgaaacaaaa	Protospacer
**************.****************

304. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

305. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacctaaaacctgaaacaaaa	Protospacer
**************.****************

306. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010091 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB267, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

307. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaaa	Protospacer
************.******************

308. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 1, identity: 0.968

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacctaaaacctgaaacaaaa	Protospacer
**************.****************

309. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

310. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016317 (Bacillus cereus strain M3 plasmid pBCM301, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

311. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

312. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

313. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

314. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP047086 (Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaatctgaaacaaaa	Protospacer
************.******.***********

315. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011655 (Bacillus cereus AH187 plasmid pAH187_270, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

316. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaatctgaaacaaaa	Protospacer
************.******.***********

317. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

318. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

319. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045534 (Bacillaceae bacterium C02 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

320. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

321. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

322. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

323. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_005707 (Bacillus cereus ATCC 10987 plasmid pBc10987, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaatctgaaacaaaa	Protospacer
************.******.***********

324. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_010924 (Bacillus cereus strain AH187 plasmid pCER270, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

325. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

326. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_011777 (Bacillus cereus AH820 plasmid pAH820_272, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

327. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP045776 (Bacillus paranthracis strain CFSAN068816 plasmid p1CFSAN068816, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

328. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010111 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-5, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

329. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

330. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

331. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

332. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

333. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

334. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022346 (Bacillus thuringiensis strain c25 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaaa	Protospacer
************.**.***************

335. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
ggtgaagccagatccaaaacctgaaacaaaa	Protospacer
.***********.******************

336. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046512 (Bacillus cereus strain JHU plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
ggtgaagccagatccaaaacctgaaacaaaa	Protospacer
.***********.******************

337. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_016792 (Bacillus cereus NC7401 plasmid pNCcld, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

338. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

339. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

340. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagagccaaaacctgaaacaaag	Protospacer
************ *****************.

341. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

342. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

343. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

344. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

345. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

346. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

347. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaatctgaaacaaaa	Protospacer
************.******.***********

348. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

349. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

350. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053290 (Bacillus cereus strain WPySW2 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

351. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

352. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_020394 (Bacillus thuringiensis serovar thuringiensis str. IS5056 plasmid pIS56-233, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

353. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaat	Protospacer
************.*****************

354. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP044979 (Bacillus thuringiensis strain BT62 plasmid pBT62A, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

355. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccgaaacctgagacaaaa	Protospacer
***************.********.******

356. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccgaaacctgagacaaaa	Protospacer
***************.********.******

357. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccgaaacctgagacaaaa	Protospacer
***************.********.******

358. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccgaaacctgaaacgaaa	Protospacer
***************.***********.***

359. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

360. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

361. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP046513 (Bacillus cereus strain JHU plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

362. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

363. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

364. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

365. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

366. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

367. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

368. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

369. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

370. spacer 1.5|143661|31|NZ_CP016317|CRT matches to CP020755 (Bacillus thuringiensis strain ATCC 10792 plasmid pLDW-16, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaac	Protospacer
************.*****************

371. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

372. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP021062 (Bacillus thuringiensis strain ATCC 10792 plasmid poh1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

373. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

374. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

375. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagatccaaaacctgaaacaaaa	Protospacer
***.********.******************

376. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

377. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042928 (Bacillus cereus strain G1-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

378. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

379. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

380. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

381. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagatccaaaacctgaaacaaaa	Protospacer
***.********.******************

382. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

383. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

384. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

385. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagatccaaaacctgaaacaaaa	Protospacer
***.********.******************

386. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040341 (Bacillus cereus strain DLOU-Tangshan plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

387. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacaaag	Protospacer
************.*****************.

388. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

389. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

390. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

391. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagatccaaaacctgaaacaaaa	Protospacer
***.********.******************

392. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

393. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaagaaaaa	Protospacer
*************************. ****

394. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaagaaaaa	Protospacer
*************************. ****

395. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040783 (Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

396. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

397. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

398. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

399. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaaa	Protospacer
************.**.***************

400. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

401. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaaa	Protospacer
************.**.***************

402. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

403. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP007513 (Bacillus bombysepticus plasmid pBb, complete genome) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

404. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

405. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

406. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014865 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

407. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaaa	Protospacer
************.**.***************

408. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaaa	Protospacer
************.**.***************

409. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

410. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP023246 (Bacillus cereus strain HBL-AI plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaaa	Protospacer
************.**.***************

411. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

412. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaaa	Protospacer
******.*****.******************

413. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP042875 (Bacillus cereus strain 09 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

414. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaaacgaaa	Protospacer
************.**************.***

415. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

416. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

417. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

418. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP045607 (Bacillus cereus strain SB1 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

419. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

420. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

421. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

422. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

423. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

424. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaagcctgaaacaaaa	Protospacer
************.*****.************

425. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.935

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtaaagccagatccaaaacctgaaacaaaa	Protospacer
***.********.******************

426. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

427. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

428. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

429. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

430. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

431. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009636 (Bacillus cereus 03BB108 plasmid pBFI_2, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

432. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

433. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

434. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053962 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaaaccagatccaaaacctgaaacaaag	Protospacer
******.*****.*****************.

435. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009317 (Bacillus cereus 03BB102 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaag	Protospacer
************.**.**************.

436. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP009317 (Bacillus cereus 03BB102 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaag	Protospacer
************.**.**************.

437. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_012473 (Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaag	Protospacer
************.**.**************.

438. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_012473 (Bacillus cereus 03BB102 plasmid p03BB102_179, complete sequence) position: , mismatch: 3, identity: 0.903

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccgaaacctgaaacaaag	Protospacer
************.**.**************.

439. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 4, identity: 0.871

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agaaaagccagatccaaaacctgaaacgaaa	Protospacer
** .********.**************.***

440. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP050184 (Bacillus thuringiensis strain HER1410 plasmid pLUSID1, complete sequence) position: , mismatch: 4, identity: 0.871

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccaaaacctgaagtacca	Protospacer
*************************..*  *

441. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
aacaaagccagagccaaaacctgaaacaaag	Protospacer
*...******** *****************.

442. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP016589 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-01, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaagtacca	Protospacer
************.************..*  *

443. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
cccaaaaccagacccaaaacctgaaacaaaa	Protospacer
  ..**.************************

444. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
cccaaaaccagacccaaaacctgaaacaaaa	Protospacer
  ..**.************************

445. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP040783 (Bacillus thuringiensis strain HM-311 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccgaaacctgaagttcaa	Protospacer
***************.*********..  **

446. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP010578 (Bacillus thuringiensis serovar morrisoni strain BGSC 4AA1 plasmid pBMB232, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaagtacca	Protospacer
************.************..*  *

447. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP020005 (Bacillus thuringiensis strain Bacillus thuringiensis L-7601 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaacctgaagtacca	Protospacer
************.************..*  *

448. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
aactaagccagagacaaaacctgaaacaaaa	Protospacer
*.. ********  *****************

449. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
aactaagccagagacaaaacctgaaacaaaa	Protospacer
*.. ********  *****************

450. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
aactaagccagagacaaaacctgaaacaaaa	Protospacer
*.. ********  *****************

451. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
aactaagccagagacaaaacctgaaacaaaa	Protospacer
*.. ********  *****************

452. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014867 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence) position: , mismatch: 5, identity: 0.839

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaaccagaagtgaaa	Protospacer
************.******** ***...***

453. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NC_018501 (Bacillus thuringiensis HD-771 plasmid p02, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccggatccaaaacctgaagtacca	Protospacer
*********.**.************..*  *

454. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_CP015177 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB267, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagacccgaaacctgatgttcaa	Protospacer
***************.******** ..  **

455. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014867 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaaccagaagtgaag	Protospacer
************.******** ***...**.

456. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014867 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaaccagaagtgaag	Protospacer
************.******** ***...**.

457. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014867 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaaccagaagtgaag	Protospacer
************.******** ***...**.

458. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014867 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaaccagaagtgaag	Protospacer
************.******** ***...**.

459. spacer 1.5|143661|31|NZ_CP016317|CRT matches to NZ_AP014867 (Bacillus thuringiensis serovar tolworthi strain Pasteur Institute Standard strain plasmid pKK3, complete sequence) position: , mismatch: 6, identity: 0.806

agtgaagccagacccaaaacctgaaacaaaa	CRISPR spacer
agtgaagccagatccaaaaccagaagtgaag	Protospacer
************.******** ***...**.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

99153 : 217533

104

Bacillus_phage(24.0%)

transposase,protease,integrase

attL 103364:103379|attR 223814:223830

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_073536292.1\|99153_99633_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000520284.1\|100763_102473_+	hypothetical protein	NA	NA	NA	NA
103364:103379	attL	NA	NA	NA	NA
WP_088883365.1\|103689_104655_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P793	Bacillus_phage	9.4e-38	32.3
103364:103379	attL	NA	NA	NA	NA
WP_033696043.1\|104733_105045_+	hypothetical protein	NA	NA	NA	NA
WP_000136244.1\|105141_105462_-	hypothetical protein	NA	NA	NA	NA
WP_088883380.1\|105737_107510_-	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_088883366.1\|107634_108048_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_000282368.1\|108034_108421_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_001267125.1\|108442_108814_-	hypothetical protein	NA	NA	NA	NA
WP_000029264.1\|108833_109682_-	thiazole biosynthesis protein ThiF	E3T5K6	Cafeteria_roenbergensis_virus	4.0e-08	33.1
WP_000209415.1\|109684_110095_-	hypothetical protein	NA	NA	NA	NA
WP_088883367.1\|110145_111111_-	hypothetical protein	NA	NA	NA	NA
WP_076855997.1\|111463_112108_-	hypothetical protein	NA	NA	NA	NA
WP_076855996.1\|112085_112907_-	hypothetical protein	NA	NA	NA	NA
WP_061536281.1\|112923_113736_-	hypothetical protein	NA	NA	NA	NA
WP_088883368.1\|113732_114290_-	hypothetical protein	NA	NA	NA	NA
WP_000062335.1\|114273_114603_-	hypothetical protein	NA	NA	NA	NA
WP_000673198.1\|114615_115728_-	DNA polymerase III subunit beta	NA	NA	NA	NA
WP_002073837.1\|115808_116201_-	hypothetical protein	NA	NA	NA	NA
WP_000251816.1\|116413_118315_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	9.6e-26	28.7
WP_046199364.1\|119073_119430_-	hypothetical protein	Q0ILF6	Lactococcus_phage	1.5e-20	43.9
WP_001055068.1\|119452_119848_-	hypothetical protein	NA	NA	NA	NA
WP_046199365.1\|120179_120431_-	hypothetical protein	NA	NA	NA	NA
WP_046199366.1\|120498_120783_-	hypothetical protein	NA	NA	NA	NA
WP_046199367.1\|121043_121268_-	hypothetical protein	NA	NA	NA	NA
WP_046199368.1\|121285_121558_-	hypothetical protein	NA	NA	NA	NA
WP_012477839.1\|121997_122261_-	hypothetical protein	NA	NA	NA	NA
WP_001259098.1\|122508_123435_-	hypothetical protein	NA	NA	NA	NA
WP_000796697.1\|123444_124428_-	hypothetical protein	NA	NA	NA	NA
WP_001125083.1\|125042_125993_+	nucleoside hydrolase	NA	NA	NA	NA
WP_088883369.1\|126212_129713_-	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_000365750.1\|129730_130117_-	hypothetical protein	NA	NA	NA	NA
WP_000837871.1\|130308_131595_-	hypothetical protein	NA	NA	NA	NA
WP_000918313.1\|132031_133339_-	plasmid replication protein RepX	NA	NA	NA	NA
WP_000098927.1\|133365_133701_-	hypothetical protein	NA	NA	NA	NA
WP_000564666.1\|134287_134893_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_000160678.1\|135210_136323_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A286QQB7	Streptococcus_phage	3.3e-79	45.0
WP_000557422.1\|137349_138486_+	hypothetical protein	NA	NA	NA	NA
WP_001002940.1\|139195_140149_+	hypothetical protein	NA	NA	NA	NA
WP_000239320.1\|140168_141668_+	hypothetical protein	NA	NA	NA	NA
WP_001168864.1\|141684_142134_+	hypothetical protein	NA	NA	NA	NA
WP_001181745.1\|142159_142555_+	DUF4320 family protein	NA	NA	NA	NA
WP_088883370.1\|142809_144279_+	cell surface protein	NA	NA	NA	NA
WP_088883371.1\|144396_146748_+	hypothetical protein	NA	NA	NA	NA
144361:144376	attR	NA	NA	NA	NA
WP_085963576.1\|147294_148655_-\|transposase	IS3-like element ISBce15 family transposase	A0A1B1P773	Bacillus_phage	2.5e-89	60.4
144361:144376	attR	NA	NA	NA	NA
WP_088883372.1\|148729_149971_+	glutathionylspermidine synthase	B2ZXR7	Ralstonia_phage	1.1e-22	25.8
WP_001032086.1\|150101_150356_+	hypothetical protein	NA	NA	NA	NA
WP_000425108.1\|150548_150941_+	hypothetical protein	NA	NA	NA	NA
WP_000675654.1\|150990_151698_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_088883373.1\|151742_152258_+	HAD family hydrolase	NA	NA	NA	NA
WP_088883374.1\|152522_155486_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.5e-214	41.0
WP_088883375.1\|155795_156923_-	collagen-like protein	Q2Q460	Bacillus_phage	9.9e-55	73.0
WP_000583540.1\|157271_157835_+	recombinase family protein	A0A219Y9V9	Aeromonas_phage	3.6e-29	40.1
WP_000045534.1\|157972_158941_-\|integrase	tyrosine-type recombinase/integrase	A0A1L4BKH1	Thermus_phage	2.0e-19	25.6
WP_000216166.1\|159423_159630_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_001170598.1\|159723_160209_+	hypothetical protein	NA	NA	NA	NA
WP_000095403.1\|160238_160715_+	stage V sporulation protein AC	NA	NA	NA	NA
WP_000938965.1\|160715_161732_+	stage V sporulation protein AD	NA	NA	NA	NA
WP_000575919.1\|161728_162079_+	stage V sporulation protein AE	NA	NA	NA	NA
WP_000215902.1\|162088_162295_+	DUF1657 domain-containing protein	NA	NA	NA	NA
WP_012552713.1\|162315_163185_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_001049162.1\|163427_164009_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
WP_000576160.1\|164031_164583_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	4.9e-39	48.6
WP_000702268.1\|164958_166089_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_088883376.1\|166093_167188_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_002019995.1\|167196_168732_-	spore germination protein	NA	NA	NA	NA
WP_000234699.1\|173866_174223_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000842153.1\|174345_175461_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.2e-31	28.0
WP_000053341.1\|175465_176299_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_000264853.1\|176465_176738_+	hypothetical protein	NA	NA	NA	NA
WP_000425291.1\|176812_179080_+	bifunctional glutamate--cysteine ligase GshA/glutathione synthetase GshB	NA	NA	NA	NA
WP_000508314.1\|180912_181416_+	hypothetical protein	NA	NA	NA	NA
WP_001186887.1\|182070_183216_-	DUF418 domain-containing protein	NA	NA	NA	NA
WP_001045585.1\|183255_183738_-	thioredoxin family protein	NA	NA	NA	NA
WP_002081503.1\|184757_185315_+	hypothetical protein	NA	NA	NA	NA
WP_001043933.1\|186201_186474_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.4e-23	67.8
WP_000973308.1\|186722_187844_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.1e-169	79.9
WP_000894490.1\|188480_188921_+	hypothetical protein	NA	NA	NA	NA
WP_000021283.1\|188945_189179_+	hypothetical protein	A0A217ERD4	Bacillus_phage	1.2e-07	55.4
WP_033679280.1\|189205_189397_+	hypothetical protein	NA	NA	NA	NA
WP_000843054.1\|189422_189701_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.9e-14	60.7
WP_000588952.1\|190096_190348_-	YolD-like family protein	NA	NA	NA	NA
WP_001265876.1\|190610_191729_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WIF9	Clostridium_phage	7.9e-12	31.9
WP_000823956.1\|191740_193846_+\|integrase	tyrosine-type recombinase/integrase	L7TK95	Rhizobium_phage	3.5e-05	26.0
WP_000179341.1\|193838_194219_+	hypothetical protein	NA	NA	NA	NA
WP_000795224.1\|194536_195412_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_000275816.1\|195540_196152_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_000789405.1\|196257_197640_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	7.4e-20	23.6
WP_016099827.1\|197732_198377_-	YitT family protein	NA	NA	NA	NA
WP_000658979.1\|198491_198944_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_000154467.1\|198969_199488_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001174224.1\|199665_200304_-	HD domain-containing protein	NA	NA	NA	NA
WP_080120890.1\|200940_201858_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_001166855.1\|201875_202196_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_000423355.1\|202434_203382_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_000334699.1\|203677_205576_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	6.2e-41	25.2
WP_000762856.1\|207065_207632_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_000819001.1\|207654_209247_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	6.8e-126	51.0
WP_000428096.1\|209236_210469_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.4e-25	25.7
WP_000590816.1\|210491_213650_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	2.2e-19	22.6
WP_157674596.1\|213877_214045_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001091679.1\|214152_214641_-	hypothetical protein	NA	NA	NA	NA
WP_001043707.1\|214676_216302_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_000936733.1\|216273_217533_-\|integrase	site-specific integrase	NA	NA	NA	NA
223814:223830	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP016316

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP016316_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016316_1

865607-865698

Orphan

Consensus_repeat	Method
TTTGTTAGCAATTGCAAATGCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016316_1

>merge|NZ_CP016316|1|865607-865698|CRISPRCasFinder
TTTGTTAGCAATTGCAAATGCTTTGTTAATGTCTTTAGTGAAGACACTTGCTTGCAGACCGAACTCTGATTTGTTAGCAATTGCAATTGCTT

>NZ_CP016316|1|1|865607-865698|CRISPRCasFinder
TTTGTTAGCAATTGCAAATGCTT	TGTTAATGTCTTTAGTGAAGACACTTGCTTGCAGACCGAACTCTGA
TTTGTTAGCAATTGCAATTGCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016316.1\|WP_016716570.1\|862612_864037_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|163522
NZ_CP016316.1\|WP_073531109.1\|855276_855615_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP016316.1\|WP_000116628.1\|869234_871235_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP016316.1\|WP_016716569.1\|861352_862552_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|377581
NZ_CP016316.1\|WP_000623610.1\|873016_873751_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP016316.1\|WP_000732845.1\|871505_872303_+\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270429
NZ_CP016316.1\|WP_016716568.1\|860557_861073_-\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153228
NZ_CP016316.1\|WP_142238356.1\|877292_878429_+\|DUF445-family-protein	unknown	unknown	gnl\|CDD\|226834
NZ_CP016316.1\|WP_000508216.1\|858813_860070_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP016316.1\|WP_073531106.1\|876105_877158_-\|histidine-kinase	unknown	unknown	gnl\|CDD\|373047
NZ_CP016316.1\|WP_142238357.1\|856968_858729_-\|SgrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|173872
NZ_CP016316.1\|WP_016716571.1\|864568_865396_+\|glutamate-racemase	unknown	unknown	gnl\|CDD\|234851
NZ_CP016316.1\|WP_014893277.1\|872289_872988_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP016316.1\|WP_073531108.1\|867477_869238_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP016316.1\|WP_000013338.1\|873802_874006_-\|small-acid-soluble-spore-protein,-SasP-family	unknown	unknown	gnl\|CDD\|365990
NZ_CP016316.1\|WP_001063872.1\|860114_860318_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_073531107.1\|874624_876085_-\|YheC/YheD-family-protein	unknown	unknown	gnl\|CDD\|373047
NZ_CP016316.1\|WP_011040036.1\|856347_856896_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|376808
NZ_CP016316.1\|WP_016716565.1\|855784_856324_+\|ester-cyclase	unknown	unknown	gnl\|CDD\|377824
NZ_CP016316.1\|WP_000510468.1\|874362_874608_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP016316.1\|WP_016716570.1\|862612_864037_-\|amino-acid-permease	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	1.25286e-88
NZ_CP016316.1\|WP_073531109.1\|855276_855615_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	2.61717e-38
NZ_CP016316.1\|WP_000116628.1\|869234_871235_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	8.67477e-164
NZ_CP016316.1\|WP_016716569.1\|861352_862552_-\|ABC-transporter-permease	gnl\|CDD\|377581	pfam05975, EcsB, Bacterial ABC transporter protein EcsB. This family consists of several bacterial ABC transporter proteins which are homologous to the EcsB protein of Bacillus subtilis. EcsB is thought to encode a hydrophobic protein with six membrane-spanning helices in a pattern found in other hydrophobic components of ABC transporters.	2.8546e-95
NZ_CP016316.1\|WP_000623610.1\|873016_873751_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	4.26912e-155
NZ_CP016316.1\|WP_000732845.1\|871505_872303_+\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270429	cd13711, PBP2_Ngo0372_TcyA, Substrate binding domain of ABC transporters involved in cystine import; the type 2 periplasmic binding protein fold. This subgroup includes cystine-binding domain of periplasmic receptor-dependent ATP-binding cassette transporters from Neisseria gonorrhoeae and Bacillus subtilis and their related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.20439e-113
NZ_CP016316.1\|WP_016716568.1\|860557_861073_-\|type-1-glutamine-amidotransferase	gnl\|CDD\|153228	cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. This group includes proteins similar to PfpI from P. furiosus. and PH1704 from Pyrococcus horikoshii. These enzymes are ATP-independent intracellular proteases and may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For PH1704, it is believed that this Cys together with a different His in one monomer and Glu (from an adjacent monomer) forms a different catalytic triad from the typical GATase1domain. PfpI is homooligomeric. Protease activity is only found for oligomeric forms of PH1704.	4.28835e-77
NZ_CP016316.1\|WP_142238356.1\|877292_878429_+\|DUF445-family-protein	gnl\|CDD\|226834	COG4399, COG4399, Uncharacterized protein conserved in bacteria [Function unknown].	2.73755e-100
NZ_CP016316.1\|WP_000508216.1\|858813_860070_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.26722e-72
NZ_CP016316.1\|WP_073531106.1\|876105_877158_-\|histidine-kinase	gnl\|CDD\|373047	pfam14398, ATPgrasp_YheCD, YheC/D like ATP-grasp. A member of the ATP-grasp fold predicted to be involved in the modification/biosynthesis of spore-wall and capsular proteins.	1.19852e-15
NZ_CP016316.1\|WP_142238357.1\|856968_858729_-\|SgrR-family-transcriptional-regulator	gnl\|CDD\|173872	cd08507, PBP2_SgrR_like, The C-terminal solute-binding domain of DNA-binding transcriptional regulator SgrR is related to the ABC-type oligopeptide-binding proteins and contains the type 2 periplasmic-binding fold. A novel family of SgrR transcriptional regulator contains a two-domain structure with an N terminal DNA-binding domain of the winged helix family and a C-terminal solute-binding domain. The C-terminal domain shows strong homology with the ABC-type oligopeptide-binding protein family, a member of the type 2 periplasmic-binding fold protein (PBP2) superfamily that also includes the C-terminal substrate-binding domain of LysR-type transcriptional regulators. SgrR (SugaR transport-related Regulator) is negatively autoregulated and activates transcription of divergent operon SgrS, which encodes a small RNA required for recovery from glucose-phosphate stress. Hence, the small RNA SgrS and SgrR, the transcription factor that controls sgrS expression, are both required for recovery from glucose-phosphate stress. Most of periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.40227e-154
NZ_CP016316.1\|WP_016716571.1\|864568_865396_+\|glutamate-racemase	gnl\|CDD\|234851	PRK00865, PRK00865, glutamate racemase; Provisional.	2.08077e-114
NZ_CP016316.1\|WP_014893277.1\|872289_872988_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.40678e-86
NZ_CP016316.1\|WP_073531108.1\|867477_869238_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP016316.1\|WP_000013338.1\|873802_874006_-\|small-acid-soluble-spore-protein,-SasP-family	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	1.03127e-22
NZ_CP016316.1\|WP_073531107.1\|874624_876085_-\|YheC/YheD-family-protein	gnl\|CDD\|373047	pfam14398, ATPgrasp_YheCD, YheC/D like ATP-grasp. A member of the ATP-grasp fold predicted to be involved in the modification/biosynthesis of spore-wall and capsular proteins.	7.58308e-102
NZ_CP016316.1\|WP_011040036.1\|856347_856896_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	6.86159e-41
NZ_CP016316.1\|WP_016716565.1\|855784_856324_+\|ester-cyclase	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	1.09038e-39

>NZ_CP016316.1|WP_016716571.1|864568_865396_+|glutamate-racemase
MSVCHKHSVIGVLDSGVGGLTVASEIIRQLPKESIYYIGDNERCPYGPRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAAALTALQEALSIPVIGVIHPGARAAIKVTKKGKIGVIGTVGTIKSNMYEKALHELDTYLKVHSHACPTLATVVENQLEDTAYVTEQVKQALLPLTKEDIDTLILGCTHYPLLESYIKKELGENVTIISSAEETAIELSTILQHKGILSDNLNPEHQFFTTGSVSSFEHIAERWLGYQISVKCVNLPMEKQLVN
>NZ_CP016316.1|WP_016716570.1|862612_864037_-|amino-acid-permease
MQQKKWGFWVLTAFVVGNMVGAGIFMVPSTLAQTASPLGVTLAWLTTGFGVLMLALVFGNLAIRRPDLTTGPQSHAYALFSTPKKKKMAGFSMVWGYWVANWASNVAIITSFAGYLSLFFPIMKDTRLLFSIGSFNVEVGKLITFTICSILLWGTHIILTNGVSGAGKLNFLATTTKVTGFLLFIVVTLFAFEASKFGQWYTPMIDKSGVSHGLLSQVNLAALTTLWAFIGIESAVLLSNRAVSPKTVKRATVAGLLITVAIYLGITILTMGVLHIDKLQTSERPLADALNAAMGHGGGKLMALLALTSLFGSILGWILLSSEVPYQAAKEGFFPSFFTKTNKKGSPIYSLRLTNIMSQVFLFSTLSGTIAEAYTFVITVSTLAYLIPYLVSPIFQLKLVATGETYKNETRARITDGIVAVIALCYALWVIKTGAADIKTFLLGIGLFVIGFAFYPLMNRDQKKNNEKKNGQVA
>NZ_CP016316.1|WP_016716569.1|861352_862552_-|ABC-transporter-permease
MSIESLWSSRFQQHMQNIITYFARMINGLLYSFIFISCVGAYYYAQFLKASPSKGISLLLITIVLTFIITRCPIRTFIQKPDAVYLLALEEKLTSYFKKSLLYNYIIQLFPLLFTFLILVPLALQSLQVTVPFLCTIFIVLMITKAWNMYIHWMWRDSHENGIWFIIRITCNALIIYMLFYSANVLILGGLLLLLAFLLLYTKKQPTKRIPWDYIIEQEEKMNVRFYQFASIFTDVPQLNKQVNKRKWLTTWIEPLLHKKRATFFYLHTLAFLRGNDYFGIYIRLGLIGAFALYFIPNIYVKGAIAYIVLYMISMQLRSLWKYFSGNIIAALYPIHTEKRMNQFLHLIFILLSIQLIVFSIVILIATGQFLHSLIIMIIGLLWIKFIIVPKTKQRVSSF
>NZ_CP016316.1|WP_016716568.1|860557_861073_-|type-1-glutamine-amidotransferase
MSKKIATLITDYFEDTEYTEPAEAFKQKGYELTTIETEKGKTVHGKQGKTEVVIDKGIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDTKKPVFAICHGPQLLITAQTLEGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQPEDIPAFIEESLRILG
>NZ_CP016316.1|WP_001063872.1|860114_860318_-|hypothetical-protein
MNNNPPSTPQDNSENNSRDITLQTLRVIGLVVLISGYILVALSEVGELKVLLTNPNSNPDLAEVDPF
>NZ_CP016316.1|WP_000508216.1|858813_860070_+|MFS-transporter
MGFWSMHRNIKIRIITSFLTRTVSTMIFPFMAIYFSIKLGSAIAGALLLINVIASLVIGLYGGYVGDRLGRKKVMIIGQSIQVISIACMGVANSDYVDSPWLTFVFMLVNSLGSGLMNPATEAMLIDVSTPENRKVMYSINYWAINLSIAIGAIFGGLLFENYRLQLFIVLTVVAIITLYVMAVYMEEVYVARKTVEKKNVLKDMADSYKVVMKDRAFLIFCAASICTLSLEFQINNYLGVRLQKEFETVHFLFGNGVTFDLTGIRMLSWISAENTILVVLCSALLIKMLKSFNDLKILYVGLFIYTIGFTILGTSNSLWILLIAGLFQTVGEMMYVPVRQSIMADMVPNEARGSYMAINGMVFQMAKMNGALGVMLGSFLASWGMSALYFIVGMSSILLFMKAIGREKYEEEVSQIG
>NZ_CP016316.1|WP_142238357.1|856968_858729_-|SgrR-family-transcriptional-regulator
MIEGSVYMKIMDYYIRLRLHAQDQQHMRNSLQELADALYCSTKNVKILLKKMSEEQLISWTPGRGRGNKTEILFIHNFVEAIESYTDELLAQEKLKDIFLLLKEPLPLALQKKIENKLHHHFGYEPSNDMYDILKIPISRKIFPLDPAFVAVTTESHLTGQIFDTLVVYNDVTEKMEPHIAHTWELSEDGLTWTFYLRKDVYFHNETVLTSKDVQFSFERLKEVHSPFEWLTEEIVQIETPSPLQIRFHLAKPNLFFLHYVSSIQLAILPHDASIENHHYIGTGPFKLAHYSEDNIVLEAFTHYFKERALLDRIEFWGIPDHVQIDADYELPNEEKNERHNIQIEEIGCIYAGFNFTKPGPHHDIYFRKAWRELYDVETILRSIEGRRTIAASSFFPERSRQASKRSYSLEKAKEYLKKSTYNGETIHIYFFAFKDSANDAYFLKERCESLGIQVELHPFLVSDYMNCSIDQRADIIFMGEVFAADHELAFLNVFKNKSCFVNRFMDPHYEKQINCLLDTFLLEENKEKRYELMYEIEEFLQTEQIILFNYHVLKRKTYPSALKNVTIDSFGWANFAKLWIQPSTY
>NZ_CP016316.1|WP_011040036.1|856347_856896_+|NAD(P)H-dependent-oxidoreductase
MKNIFIINGHEKYGTKEGRLNKTLVDYMVTVLSEKHHVKTTTIQDGYSIKEEQEKFLWADVVIYQTPIYWFSVPGLFKTYMDEVYEYGLFFKGADEYGTGGLLTEKEYMFSTTWNAPENSFGDKTKFFEGESLESTLSHLHRVQKFLGMSPLKSFACYDVVKNPDIEQYLLNLKDHLDGVIK
>NZ_CP016316.1|WP_016716565.1|855784_856324_+|ester-cyclase
MGIKKLFRFLSLFVVCIVLVACGVEEKTEVQLLKEMPKPKAMTIDPSLSQKEATEMVHAAQRFYAFWDTGKEELIPQTVTENFFDHTLPKGRPQGMEGLKFAAQNFHKVVPNIHCEIEDLLVVGDKVTARLSFTGTHNDKKIDFFAIDILHVKDGKITEDWHLEDNLTLKQQLGLVAEE
>NZ_CP016316.1|WP_073531109.1|855276_855615_-|helix-turn-helix-transcriptional-regulator
MNNIDSVELTKGLPGIPCPIAKTLDVISTKWTFLIIRDLLIEGTLRFSDLQKSMDGISPKTLSLRLKELESQGIITRKVYPEVPPRVEYTLTDKGKQLEGIFIELKRFGLSL
>NZ_CP016316.1|WP_073531108.1|867477_869238_+|ATP-binding-cassette-domain-containing-protein
MFSVLLKLRWFFKEHWKRYSIAIGALLIVNIVEVIPPKVLGVTIDNIKTGTLSNEAIMQSILILIGVTIVGYGLTFVWQHQLFGGAFVLEKTMRSKFMGHLLKMTPTFYQKNRTGDLMARATNDLKAIAMTAGFGILTLVDSSLYMLTIVFMMGFTISWELTFAALIPLPIMAYAMNIYGKKLHERFTVAQDAFGDMNDKVLESIAGVRVIRAYVQENADQERFHHLGDDVYEKNMKVARIDALFQPTVKMLVGLSYLIGLVYGAYLVFQSKVTLGELVSFNVYLGMMIWPMFAIGELINVMQRGNASLDRVNETLAYEPDVKDPKHPKVVQEPDYIQFDDVTFSYPSSTETNLKKVSFTLKQGETLGVVGKTGSGKTTLVRQLLRQYPLGDGDIAVSDVRLDKMTNENVLGWIGYVPQEHILFSKTARENILFGNREATEEELEKAIEIAAFKKDLEFLPEGLETLVGEKGVSLSGGQKQRISIARAVIQNPEILILDDSLSAVDARTEAAIIDNIRTERSGKTTIITTHRLSAVQHADWILVMDDGQVIEEGTHDQLVKSGGWYAEQFERQQGENESADSGVKI
>NZ_CP016316.1|WP_000116628.1|869234_871235_+|ABC-transporter-ATP-binding-protein
MSVSKRLFQYAMKVKGTIFAAMLMLFIFVIAELAGPFVAKTMIDDHIVGIEKPWYETEKSEEAVSYNGAFYKRSDRFQEGEKKGKEVRVMQVGFQYYFVPNKVNLEGSRTVKGDMITVQNGKAVQVYKAKALTKEEVFAFYKPEINRLLLLGGGYFALLVVVSLFAYGKQFFLQKAANKIIQIMREDVFSHIQTLPIRYFDHLPAGKIVSRVTNDTEAIRDLYVTVLATFVSSIIYIIGIFAALFLLDVKLATLCLLIIPILIVWAILYRKYASVYNHKMRSRLSDINGTVNESIQGMPIIQAFRQERETKKEFEELNGDYFKYQNKILNLNAATSHNLVSVLRNIAFTGVIWYFGGASLSATGVISLGILYAFVDYLTRLFSPITNMVNQLANLEQSRVASERVFELLEEKGETVEEERMPRLQGNVKFDNVSFSYNGKDEVLKNISFEAKQGETVALVGHTGSGKSSIMNVLFQFYEFEKGKLTIDGHDVKEMPKQATREHMGIVLQDPFLFSGTVASNVSLENENISKERIVKALRDVGAERFANNINEEITEKGSTLSTGERQLISFARALAFDPAILILDEATSSIDTETEAMIQQALEVVKKGRTTFIIAHRLSTIKSADQIIVLDRGTILEKGSHDELMKKRGRYYDMYKTQMEGNQSA
>NZ_CP016316.1|WP_000732845.1|871505_872303_+|amino-acid-ABC-transporter-substrate-binding-protein
MKKLFSVLAVTTLAIGIVAGCGKEEKKDTASQDALQKIKQSGELVIGTEGTYPPFTFHDSSNKLTGFDVELAEEVAKRLGVKPVFKETQWDSLLAGLDAKRFDMVANEVGIREDRQKKYDFSKPYVSSSAALVIAKDKDKPATFADVKGLKGAQSLTSNYADIAKKNGAEIVGVEGFSQAAELLASGRVDFTINDKLSVLNYLETKKDAKIKIVDTEKEASESGFLFRKGSTKLVQEVDKALEDMKKDGTYDKIAKKWFGENVSK
>NZ_CP016316.1|WP_014893277.1|872289_872988_+|amino-acid-ABC-transporter-permease
MYLSSALVSDRLSTWMDIMQSSFMPMLKEAVFTTIPLTLITFIIGLILATLTALARISGSRILQWIARIYVSIIRGTPLLVQLFIIFYGLPTLNIEVEPYTAAVVGFSLNVGAYASEIIRASILSIPKGQWEAAYTIGMTYPQALKRVILPQATRVSIPPLSNTFISLVKDTSLASLILVTEMFRKAQEIAAMNYEFLIVYFEAGLIYWVICFLLSIVQQMLEKRSERYTLK
>NZ_CP016316.1|WP_000623610.1|873016_873751_+|amino-acid-ABC-transporter-ATP-binding-protein
MISIQHLQKSFGDNTVLKHIDLTVEKGEVVVIIGPSGSGKTTFLRCLNVLETPNAGNIRIGNKELNFSQKVTKKDIVNLRTQTGMVFQHHNLFPHLTALQNVMEGLVTVKKMGKEEAKKKANYFLEKVGLADKVDLYPFQLSGGQQQRVGIARALAMEPEVLLFDEPTSALDPELVQEVLKVMKELAKEGMTMVIVTHEMRFAHQIANRVIFMDGGVVVEQGTPEEVFTNPKEERTKKFLQMLQ
>NZ_CP016316.1|WP_000013338.1|873802_874006_-|small-acid-soluble-spore-protein,-SasP-family
MANQNSSNQLVVPGATAAIDQMKYEIAQEFGVQLGADSTARANGSVGGEITKRLVAMAEQSLGGFHK
>NZ_CP016316.1|WP_000510468.1|874362_874608_+|hypothetical-protein
MGICPLCNALESQTYSCQNCQSILQDYGKAVDYIDDYSAYMDQELLSAVDGLTHNNSNEYCNHIFYCGVCNVETEVVVKLV
>NZ_CP016316.1|WP_073531107.1|874624_876085_-|YheC/YheD-family-protein
MKEHIYTLNISDEHPNSITLPYIFSITPPITSLSFGLRHVASKEVKIHYSFTREIIIGKQIAEKLLLPHSTTIHAFTQNQTIIFGPLIGIFTTGFTDDASNPLGNRSTSLGELLTPPFTLRPFVFVFGVQHIDWEDETIEGYFFQEEKWIKKKVPLPNVIYDRLPNRKAENYKPIVRAKRKLEHDYAIPWFNPGFFNKWEVHQLLVKDESIMPLLPNTETFQHFEQVERFLGTYKSIYMKPIHGSFGRNIHQLFYSQVENCYYCRYRENEENKLRKYQSLETLLNHVLKGHDLKKFIVQQGISLLRFDGQPVDFRIHTNKNHFGQWMVSAIVAKIAGKGSLTTHVNSGGDTKLLQELFPDSTKQVQIENKLKHTALQISYALDEQVTGNIGEIGFDIGLDTQENPWLFEANSKPGRTVFQDAKLKEQSELTRQLFYEYAIYLTEHSLRDTKEKMSQIKSETSSNNEHIPSPMIHSQIRKQKLPPHS
>NZ_CP016316.1|WP_073531106.1|876105_877158_-|histidine-kinase
MVLGILTSQPHYEQTYYTEIAKRARLYHNVVAQFTPFCIDPKTDLISGLIYDTDTGKWKEQTFPIPSYIYDRSSFNEETDFDKAKSIIHSLHNRPSTTFLNNTLIDLSELHDVFLMNKKLSPYIPKFEIATIHNVFKLLLKTKDIIIRPTNAHSNESLYRVVYKNKTFHVDTINDAYHISTPIKRTDEFISWYKSNIRSARYITHTMLQPPNQLTYPLHIRTILQKNKEQKWNVIGQFIQKSSFPNQLLLSATDDSSLHAFSKIKYVLSSTGVQLLQDALQDIINEVFQTLDQSYSSLFELELSTIMDQKGAIWLMYVNTIPPYEHYIRYSDSLAEKIYHGPLQFSRFTP
>NZ_CP016316.1|WP_142238356.1|877292_878429_+|DUF445-family-protein
MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQLGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVMTNEHSLRHMLEQWNVAHVEKEATEKIEHVITEKIEVFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILGRATQFFESEEGKTRLSKMIDDFFASRGTLLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTDVLQKEWEKLKGRDVKEVETFVEKEMIVSSILSAVKVEETVSEFLNQSVQQVCEPVQETMIEKVVPSAVTKGLKWGTENVDSILNNLHLAEIVQQEVSTFSTERLEDLVLSITKNELKMITYLGALLGGMIGIVQGLLLLFLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016316_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016316_2

2746050-2746244

Orphan

Consensus_repeat	Method
TTTCGGAATGAACGTTCATTCCT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP016316_2

>merge|NZ_CP016316|2|2746050-2746244|CRISPRCasFinder
TTGCGGAATGAATATTCATTCCTGCCATTTTAAAATGCCATTTCGGAATGAACGTTCATTCCTATTACTCTATTACATTGTTTTATAAACTCTATTAAACTACTTTTTCGGAATGAATGTTCATTCCTTTAGTTACACAAATACCCTCTCCTACTCTCATTTTTTAATTCTATTCAGGAATGAATATTCATTCCT

>NZ_CP016316|2|2|2746050-2746244|CRISPRCasFinder
TTGCGGAATGAATATTCATTCCT	GCCATTTTAAAATGCCA
TTTCGGAATGAACGTTCATTCCT	ATTACTCTATTACATTGTTTTATAAACTCTATTAAACTACTT
TTTCGGAATGAATGTTCATTCCT	TTAGTTACACAAATACCCTCTCCTACTCTCATTTTTTAATTCTA
TTCAGGAATGAATATTCATTCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016316.1\|WP_061183029.1\|2751863_2753036_-\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
NZ_CP016316.1\|WP_073531219.1\|2733597_2735703_-\|BglG-family-transcription-antiterminator	unknown	unknown	gnl\|CDD\|226234
NZ_CP016316.1\|WP_000459662.1\|2732018_2733290_-\|PTS-ascorbate-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|236502
NZ_CP016316.1\|WP_001013099.1\|2758888_2759326_+\|YndM-family-protein	unknown	unknown	gnl\|CDD\|371204
NZ_CP016316.1\|WP_088883309.1\|2741712_2742561_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
NZ_CP016316.1\|WP_073530550.1\|2755222_2758738_-\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|238697
NZ_CP016316.1\|WP_000346939.1\|2736009_2736681_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP016316.1\|WP_000633868.1\|2739233_2740859_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP016316.1\|WP_001100979.1\|2747051_2748209_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
NZ_CP016316.1\|WP_016717780.1\|2736739_2738713_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP016316.1\|WP_000757315.1\|2733314_2733584_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99905
NZ_CP016316.1\|WP_001273581.1\|2753315_2754392_-\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|183614
NZ_CP016316.1\|WP_016717784.1\|2749651_2750752_-\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
NZ_CP016316.1\|WP_016717781.1\|2741077_2741533_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_061183030.1\|2750744_2751845_-\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
NZ_CP016316.1\|WP_001107304.1\|2746264_2746831_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
NZ_CP016316.1\|WP_061183031.1\|2748345_2749635_-\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
NZ_CP016316.1\|WP_041184760.1\|2759668_2760199_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP016316.1\|WP_142238319.1\|2742897_2746014_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP016316.1\|WP_016717778.1\|2731422_2731848_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP016316.1\|WP_061183029.1\|2751863_2753036_-\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
NZ_CP016316.1\|WP_073531219.1\|2733597_2735703_-\|BglG-family-transcription-antiterminator	gnl\|CDD\|226234	COG3711, BglG, Transcriptional antiterminator [Transcription].	3.50372e-56
NZ_CP016316.1\|WP_000459662.1\|2732018_2733290_-\|PTS-ascorbate-transporter-subunit-IIC	gnl\|CDD\|236502	PRK09410, ulaA, PTS system ascorbate-specific transporter subunit IIC; Reviewed.	0
NZ_CP016316.1\|WP_001013099.1\|2758888_2759326_+\|YndM-family-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	2.97159e-44
NZ_CP016316.1\|WP_088883309.1\|2741712_2742561_-\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	6.86497e-145
NZ_CP016316.1\|WP_073530550.1\|2755222_2758738_-\|DUF4020-domain-containing-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	5.56385e-56
NZ_CP016316.1\|WP_000346939.1\|2736009_2736681_+\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.41959e-75
NZ_CP016316.1\|WP_000633868.1\|2739233_2740859_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP016316.1\|WP_001100979.1\|2747051_2748209_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	2.40318e-73
NZ_CP016316.1\|WP_016717780.1\|2736739_2738713_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0
NZ_CP016316.1\|WP_000757315.1\|2733314_2733584_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99905	cd05563, PTS_IIB_ascorbate, PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is an L-ascorbate-specific permease with two cytoplasmic subunits (IIA and IIB) and a transmembrane channel IIC subunit. Subunits IIA, IIB, and IIC are encoded by the sgaA, sgaB, and sgaT genes of the E. coli sgaTBA operon. In some bacteria, the IIB (SgaB) domain is fused C-terminal to the IIA (SgaT) domain. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include ascorbate, chitobiose/lichenan, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	2.67352e-34
NZ_CP016316.1\|WP_001273581.1\|2753315_2754392_-\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
NZ_CP016316.1\|WP_016717784.1\|2749651_2750752_-\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	2.57685e-159
NZ_CP016316.1\|WP_061183030.1\|2750744_2751845_-\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
NZ_CP016316.1\|WP_001107304.1\|2746264_2746831_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	1.94431e-63
NZ_CP016316.1\|WP_061183031.1\|2748345_2749635_-\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
NZ_CP016316.1\|WP_041184760.1\|2759668_2760199_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	7.06264e-69
NZ_CP016316.1\|WP_142238319.1\|2742897_2746014_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	7.08053e-76

>NZ_CP016316.1|WP_142238319.1|2742897_2746014_-|MMPL-family-transporter
MSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMNKDGTEKYEIIAVFNSGSNTALTTEQKEEITKTINVLQNEKEQLGIKEIVSHLDNKDLEKQLVSKDKTTILTQISIDKKHGEISKVTNNLHNKVKTKEVTTYLTGSDLIAGDFLTSSQEGVKKTEVISIIFILVILIIVFRSPIVPIVSLLTVGVSYLVSMGIIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVAVLLLVLTTLNPFFMVLLGKGMFYPVKTFKGHEDSRLWGFFAKNSVVRPFVALIIVFVISIPFILKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLQTLDELTDKILKVKGVSEVYAPTRPTGDRIKELYINKQAGELNTGLGDANGGIKEINDGLTTAKDKMGNKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAKGAQQIESGLTSVNENISILSHAASQLHAGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQTKPELANDSNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMSNGVTKLQKGAADLKNGLNEGASGSKQIVNKSSELQTGLTKINDGQGQLLTGLKDLQEQMGQLQSGLSKSTEGLEKVSNGLGDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPVIQEINKTIDGTLKGTELNHAKTAIGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLLLAYFASLGISEQISTQVLHVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGDPATKIVTASRHIGGVVLSAALILDGTFAALIPSGVLTLIQVASVVGVALFLLAIIVMPILLPALIGLTSKMKNYAKKLSERK
>NZ_CP016316.1|WP_088883309.1|2741712_2742561_-|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAKLINEILNQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLVSNSGDFKEVLLKRVLKKGSNYLLPYRKIKNEFGDQFSDELCNDISRNDIYELSFDKNIELIADKWNDFAEIALEDNKVYIFECCFIQNPLTIGMIKYGEQKEKIINYVMKIAKIIENLNPMLFYVEQDDLEFSFRKALKERNPEWSKGIVDYYTNQGYGKEHNHSGVEGTIKVLEARRDLELEIFDMLKMKKEKINNTKYEIDSYSSMLKDKLTIQMVK
>NZ_CP016316.1|WP_016717781.1|2741077_2741533_+|hypothetical-protein
MKKIFIIGALCLSIASLTACSSNNTKTPTESKQEKKETKITVDSIITEFKNAGLQAENPTDLPQKEFGNLRKEGKRIVVPALGEDKGGRLFEITKKEDLEKVKKYYDELGNSAPMLFSHTHAKGNFLLQMNGDMKDEEFAKYKDVMDRFIK
>NZ_CP016316.1|WP_000633868.1|2739233_2740859_-|ATP-binding-cassette-domain-containing-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTRLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKMSELTGAEKVKVLLAQALFGQPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIKPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDYNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTILFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>NZ_CP016316.1|WP_016717780.1|2736739_2738713_-|LTA-synthase-family-protein
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKHKLSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKDYVQFGSDLLSPDHKQVVAFRNGNYVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQKSLKYSDQVVNGDLLRFYTPEGFTPVDRSKYNYNHRDKNKTKVKTTEDGETK
>NZ_CP016316.1|WP_000346939.1|2736009_2736681_+|TerC-family-protein
MDFLSAEYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKDQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFTAFFESNPFIKWAFIIIVIAGVVFFGKMKQKTKDVSI
>NZ_CP016316.1|WP_073531219.1|2733597_2735703_-|BglG-family-transcription-antiterminator
MILDTRSINILQQIIQAEGYVPINQLIDVIQVSKRTLYYDIKKIDDWLQEEGLHSIEYIRHLGYCLNKETKQMIVKKLNECVINQYEYSPKERKIWLILYLLIQEKRILLEDLINLLQVSRNTVLADLKKLKVELNKYNLSLHFGRKEGYQIVGNEQSKRNLLILSLSQIICQHSWEYLISQVNYIMCDMGSETDTLARETLYTIKKILANCEEFLGVQYTDEVLENLSVYMYLFHRRILKGKCVEMEEAEKNVLQDSKQFEAAKYIAKQFERAFIVKFPIDEIYYITTHLLGAKVNYQENIYEKNNMDEIHSIVDRMIKDFQHYACVLFQDFNGLFTDLYLHMKPAFYRVKYGIEIENPLRNTIQENYEEVYFLTKKVIHHFEEYVKKSVSDDEIVYVTMHFGAWMRKEGIVPNPRKTALLVCPNGIGTSRMLQYQLEKLFSNIDILNAISKREYESNIFDVDCIITTTEIEKGNVPVFKVNPILSDSEKAALLRKVNGVLYGENQKDSVDLVMGIIQKYADVVDEKSLKRELIEFMSGPAYFEKEEKYKPMLNELLTREFIHLEDRVDNWKDAIRLAADPLLQNQYIFEEYINEMIVNVEKLGPYIVIAPRIAIPHARPEAGVKKLGMSLLQLKESVLFSEKQEHAANLIIVLAAIDNETHLKALAQLSEMLSDPKNVEMLIHSNSIDEMLKMIAKYSN
>NZ_CP016316.1|WP_000757315.1|2733314_2733584_-|PTS-sugar-transporter-subunit-IIB
MKKVLVVCGNGLGSSFIVEMNVKKILNELGLQAEVSHTDLASSKSEQADLYLGAKDIICNLEDGNRTVAGLTNILDLNEIKEALQKHLM
>NZ_CP016316.1|WP_000459662.1|2732018_2733290_-|PTS-ascorbate-transporter-subunit-IIC
MFDIIMKDILGQPAILVGLFAMCGLLLQKKNFADTVSGTLKTIMGFVVLGGGATILIGALDVFGKIFDKAFHIKGIIPNNEAVVAIAQQTLGKETALIMVFGMIANLLIARFTKFKYVFLTGHHTLFMACLISAVFSTTGMKGATLVIVGSIILGALMVIFPALLQPYVRKITGMDDIAIGHFGSVGYLAAGFVGSKFGNKDKSTEQIKVPKSLGFLRDTSVSMSLTMAVLFFIVAPFAGKEFIETELSNGQNYLVYSFMQAITFAAGVYIILAGVRMLIAEIIPAFKGIADKLVPNAKPALDCPTIFPFAPNAVIIGFLTSFIAGLLSMFILSFIGLSVIVPGLIPHFFTGATAAVFGNATGGRRGAILGAFVNGLLISFLPAILLPILGGLGFENTTFGDSDFAVVGILISEIVKLVGYIF
>NZ_CP016316.1|WP_016717778.1|2731422_2731848_-|hypothetical-protein
MIFQNEIVSLHFEAVKYEFNNAFDTFDRNWLIIKVKLSEGNKVFETMDPFLQTSELQHMKEWFQTLPNPTYTRLDFIEPNLSFEFIGEKEETFQIIVRLSIELNPSWCKEEEYEFCITITQEDRKNIIRFIEEQHIKFPKR
>NZ_CP016316.1|WP_001107304.1|2746264_2746831_-|TetR/AcrR-family-transcriptional-regulator
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIVKGLLRPLPPVALIIIVYQPLEKLIKVIATGQLEYSKELVKELEESSWNAIRII
>NZ_CP016316.1|WP_001100979.1|2747051_2748209_-|GNAT-family-N-acetyltransferase
MNVIRLTEDKFREALRLSEYAFQYKVEEDRLQQQLTRMKESHEVYGIMEGNDLAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVAFYRKYGWELCANLLVCHMTKSDLVMKKQVNGTVKRFNKENHSEEVEKLYETFAERFSGMLVRNEKWWLQAVYDDLTLAIYYDENKTAAGYMLYKIEKSKMTVEEFVPLHNEARNGLWNFICQHDSMIKELEMTVSENEQLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNIQQEIILHITDSFAPWNNVSVRLANYEITIIEEPMDKGIKLDINALSTILLGYKRPLELNELELINGSEEEIRAFEKIVPVREAFIYDFF
>NZ_CP016316.1|WP_061183031.1|2748345_2749635_-|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVTNGLNGNITIPGDKSISHRAVMFGAIAEGKTTIKGFLPGADCLSTISCFKEMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDASIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLQNVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSALKGNTVNSYGDHRIGMMLAIAGCIAKGKTTIEDAEAVGVSYPTFFEELQKLAK
>NZ_CP016316.1|WP_016717784.1|2749651_2750752_-|prephenate-dehydrogenase
MRKKVVLIGTGLIGGSLALAIKKEHDVTITGYDIFQEQVERAKELHVVDEIAVNLQHACEEAHLIIFASPVEETKKLLHKLASFRLREDVIVTDVGSTKGTIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMHHVPNEDVEELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEDLYDTVSSGDAGEIQSYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAREEISITNLQILEAREGLLGVLRISFQREEDRMQAKLALGEEKYQTYETI
>NZ_CP016316.1|WP_061183030.1|2750744_2751845_-|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHAFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLQVQMEQVLCGSGLDEVIQIISRAALKAGDNIVTAGATFPQYRHHAIIEGCEVKEVPLNNGVYDLDEISSAVNNNTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAIGQEELIEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLQQYESFCKENDIPFYPSQTNFIFLPVENTGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLKQHFENKKRKSRDEANA
>NZ_CP016316.1|WP_061183029.1|2751863_2753036_-|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMNAIDHAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARHPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>NZ_CP016316.1|WP_001273581.1|2753315_2754392_-|3-deoxy-7-phosphoheptulonate-synthase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHKFMEELKGFKNKLS
>NZ_CP016316.1|WP_073530550.1|2755222_2758738_-|DUF4020-domain-containing-protein
MTFLGKGESWVWITSEVEIPDELIDHLEQGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKSKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAIKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNQSKLSPLLWRTICSYLSETKIEMDPLLFARWTLLLLETAEKDSKSIETISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDNTQESIELEESSRLPVSTFSYVEKIWNEKMKPHISYYAVPIMMMGIEKLRMLSLRQTALKKRDKENVEKEFQQNDLAFLIQIVKECLAYLCENNEKKANYYITEMIEASSILQNRIAIDAMNKNIFVSADEKMKWLLQEEILLDVTYKQEVFQLIKNHYALSLEKTKEEVIQIVLKNLAEERAFDVCLLLDLLFTCDSNSPSTAKGYELMKQKHPHFHSDRYSVKKRETTEQSITCNVTADGLLQLKDEEIMKQVRQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLGKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMLARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAKEQQKFWAAWLSIFLRERPKMGEITAREYVMLLRIILFMDEIVERGLSIICKSFSDVGGKGNQTELKQLFNEILEKTESIKMYKELYANVFFTLLQTLQEADLLETEIIQIKELLIGYKVEKCVINAIDNEIIRIGIVMENLQEEM
>NZ_CP016316.1|WP_001013099.1|2758888_2759326_+|YndM-family-protein
MNGFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSILSAIVFTLSEVIVHRFSNSHTRHHNDNIHINRRFAYGTEFAEEQNILDKDKKK
>NZ_CP016316.1|WP_041184760.1|2759668_2760199_-|cysteine-hydrolase
MKKALIVIDVQAGMYTAGMPVHNGEKFLEILQELIGECRSNDIPVIYVQHNGPKDHPLEKGTEGWKIHKAIAPLEGDCVVEKTTPDSFHKTDLKEVLQDKGIDHVIISGMQTQYCVDTTTRRAFSEGYKVTLVSDAHSTFDTEVLRAEDIVKHHNVVFGAFADVITLKDLKETVSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016316_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016316_3

3145294-3145496

Orphan

Consensus_repeat	Method
GGTCCCTGTATGCCTTGAATTCCTTGTGGACCGGTTGGACC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP016316_3

>merge|NZ_CP016316|3|3145294-3145496|PILER-CR
GGTCCCTGTATGCCTTGAATTCCTTGTGGACCGGTTGGGCCTGTTATGCCACTCGGTCCTTGTACTCCTTGGATTCCTTGAGGTCCAGTTGGTCCCTGTATGCCTTGAATCCCTTGTAGCCCCTGTAAACCAGTTGGACCTGTTTCTCCCCTTACCCCTTGCTCACCTTGTATGCCTTGAATTCCTTGTGGACCGGTTGGACC

>NZ_CP016316|3|1|3145294-3145496|PILER-CR
GGTCCCTGTATGCCTTGAATTCCTTGTGGACCGGTTGGGCC	TGTTATGCCACTCGGTCCTTGTACTCCTTGGATTCCTTGAGGTCCAGTT
GGTCCCTGTATGCCTTGAATCCCTTGTAGCCCCTGTAAACC	AGTTGGACCTGTTTCTCCCCTTACCCCTTGCTCACCTTGTATGCC
TTGAATTCCTTGTGGACCGGTTGGACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016316.1\|WP_062821795.1\|3149232_3149988_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP016316.1\|WP_000355458.1\|3135683_3136523_+\|DUF2785-domain-containing-protein	unknown	unknown	gnl\|CDD\|371322
NZ_CP016316.1\|WP_061183585.1\|3137491_3138520_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP016316.1\|WP_000539716.1\|3142922_3143171_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP016316.1\|WP_073530415.1\|3137049_3137430_-\|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|319905
NZ_CP016316.1\|WP_061183586.1\|3138856_3139420_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP016316.1\|WP_016718086.1\|3140987_3141350_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319909
NZ_CP016316.1\|WP_000540479.1\|3136540_3136990_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP016316.1\|WP_016718092.1\|3152036_3152414_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_000747680.1\|3152467_3152707_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806
NZ_CP016316.1\|WP_061183587.1\|3139630_3140629_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NZ_CP016316.1\|WP_000938438.1\|3152813_3153362_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NZ_CP016316.1\|WP_000285644.1\|3155475_3155883_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NZ_CP016316.1\|WP_073530421.1\|3150682_3151870_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP016316.1\|WP_142238311.1\|3150030_3150570_-\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378696
NZ_CP016316.1\|WP_000613878.1\|3153560_3153974_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP016316.1\|WP_061183589.1\|3143307_3143769_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP016316.1\|WP_073530422.1\|3154027_3155356_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP016316.1\|WP_142238310.1\|3146649_3149085_-\|collagen-like-protein	unknown	unknown	gnl\|CDD\|367362
NZ_CP016316.1\|WP_073530417.1\|3141737_3142859_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701

Protein	Function_ID	Function_description	E-value
NZ_CP016316.1\|WP_062821795.1\|3149232_3149988_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.36198e-22
NZ_CP016316.1\|WP_000355458.1\|3135683_3136523_+\|DUF2785-domain-containing-protein	gnl\|CDD\|371322	pfam10978, DUF2785, Protein of unknown function (DUF2785). Some members in this family are annotated as hypothetical membrane spanning proteins however this cannot be confirmed. The family has no known function.	1.65099e-39
NZ_CP016316.1\|WP_061183585.1\|3137491_3138520_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	2.04137e-22
NZ_CP016316.1\|WP_000539716.1\|3142922_3143171_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	3.00047e-09
NZ_CP016316.1\|WP_073530415.1\|3137049_3137430_-\|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.56274e-61
NZ_CP016316.1\|WP_061183586.1\|3138856_3139420_-\|maltose-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	3.61095e-98
NZ_CP016316.1\|WP_016718086.1\|3140987_3141350_-\|glyoxalase	gnl\|CDD\|319909	cd07245, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.14403e-20
NZ_CP016316.1\|WP_000540479.1\|3136540_3136990_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.91744e-58
NZ_CP016316.1\|WP_000747680.1\|3152467_3152707_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	9.29742e-13
NZ_CP016316.1\|WP_061183587.1\|3139630_3140629_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0
NZ_CP016316.1\|WP_000938438.1\|3152813_3153362_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	6.88941e-83
NZ_CP016316.1\|WP_000285644.1\|3155475_3155883_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	7.57424e-62
NZ_CP016316.1\|WP_073530421.1\|3150682_3151870_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.9772e-70
NZ_CP016316.1\|WP_142238311.1\|3150030_3150570_-\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	8.33239e-18
NZ_CP016316.1\|WP_000613878.1\|3153560_3153974_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	2.04431e-07
NZ_CP016316.1\|WP_061183589.1\|3143307_3143769_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.76676e-13
NZ_CP016316.1\|WP_073530422.1\|3154027_3155356_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	3.34782e-160
NZ_CP016316.1\|WP_142238310.1\|3146649_3149085_-\|collagen-like-protein	gnl\|CDD\|367362	pfam03157, Glutenin_hmw, High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.	7.99101e-07
NZ_CP016316.1\|WP_073530417.1\|3141737_3142859_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.41053e-58

>NZ_CP016316.1|WP_061183589.1|3143307_3143769_+|GNAT-family-N-acetyltransferase
MIQKLITTSHKTATSILSIQIPAYEIEAKYINSTAIPRLYDTVADIQSCDEIFYGYFYEDTLAGFISFKMDEEAVDIHRLVVSPDHFHKGIATKLLLYVFDMFSPSKTYIVQTGKENTPALSLYKKHGFIEVKEIILPDGVVLTSLKKSENNK
>NZ_CP016316.1|WP_000539716.1|3142922_3143171_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIAGSITGKDFPAGMFGNIIAGLLGAWLGGKLFGDWGPSLGGIHIIPALLGSIVLVLIVSFVVKAARK
>NZ_CP016316.1|WP_073530417.1|3141737_3142859_-|AI-2E-family-transporter
MEKVSLRKRDKLKKFFREHNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVASMVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRRPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPAMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NZ_CP016316.1|WP_016718086.1|3140987_3141350_-|glyoxalase
MILGLHHVQITIPKGAELEGKKFYCEILGLTEKEKPESLKGRGGFWLKVADREVHIGTEDDFDRLKTKAHIAYQVEDISYWRNVLEQNEIQIIEGVPIPGFERFEFRDPFGNRVEMIQEM
>NZ_CP016316.1|WP_061183587.1|3139630_3140629_-|tryptophan--tRNA-ligase
MSDKIMLTGIKPTGYPHLGNYIGAIKPALQMSKKNEGKALYFIADYHALNAVHDPSQFSSYTKEVAATWLSLGLGEDVIFYRQTEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFKLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQEKLRKLIFKIKTDSSLPNEPKELETLFTIYKEFATEGEMQSLREKYETGIGWGDVKKELFRVVDRELARPREKYTMYMNEPNLLYEALEKGAEKARAIAKVNLTEIKKRIGFERER
>NZ_CP016316.1|WP_061183586.1|3138856_3139420_-|maltose-O-acetyltransferase
MKTEKEKMLAGEMYIADDEELVTDRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSADGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHSLHPIERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NZ_CP016316.1|WP_061183585.1|3137491_3138520_-|ROK-family-protein
MSEQFVTQKSIKETILRGIRKVLLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSMLIDTGVNILSKHIEGLITTFPKISSISIGVPGSVDNGRIFYIPGYEKFQNFNLKSHLEEQFSIPVVIENDMNAAVLGYHKNTGNNENSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYDNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHAFIFCDDEVNQFVIDQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NZ_CP016316.1|WP_073530415.1|3137049_3137430_-|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein
MKIEHVAIWVNDLVGMRDFYKQYFNGEENSLYHNSKKQFKSYFITFEGGARLELMKRVGIEDALQTETIGYAHIAFSVGSKEKVNELTNTLREAGYAVLNGPRTTEDGYYESVVSDPEGNQIEITI
>NZ_CP016316.1|WP_000540479.1|3136540_3136990_+|NUDIX-hydrolase
MGYIEDMRNLVGNHPLILIGSHAIIVNEKNEILLQLRTDFNRWGIIGGALEYNETLEDALKREVYEETGLIIKNPELFRTYSGPDFFQIYPNGDQVHGVLVVYICREFHGELVCDQTESKELRFFPLDELPSTLHPVIEGILRDFHHSN
>NZ_CP016316.1|WP_000355458.1|3135683_3136523_+|DUF2785-domain-containing-protein
MDITALQQQLELIQQNDYTQLRHIDINELTLHMLQYIGTTDSYVRYQLIYKCFVHFIHHEFLMDDQLKLLLQTCLSDEYLYCDIYSPHSDGVFTRSYTVSLIALILQFANSHYFCTEEDIEEIKNKLITYTNLETDFRGYIENKGWAHCLAHVSDAFTEIVHNSYTTFEWYEELIHCLLNKIFIPSDLFHNNEDERIVTPLLAMLYHDFPQDELISIIQKKIKRLPQIRKRLSLNEYCILCANIKTFLRTLFFRTKDDHNLAFTARKTERMLKELPNYY
>NZ_CP016316.1|WP_142238310.1|3146649_3149085_-|collagen-like-protein
MRHHRKCKKFGVALPLPLIGATGPTGNSGPIGPTGGHEGPVGPTGVTGPTGATGSQGPQGIRGIQGPRGTTGAQGIQGAVGDTGEQGVTGPTGLQGPQGLIGNQGPTGDIGVQGLEGIQGITGPTGSQGIQGPQGIQGEIGERGQTGAQGMQGVIGEAGITGVTGPQGPQGAQGIQGEDGTTGIQGEEGPPGIQGITGEQGHQGDQGIQGVVGPTGSTGIQGPQGISGIKGITGVTGPQGPQGVQGIQGVSGSTGFQGAKGVRGITGATGPTGTQGVEGPPGGPTGATGPIGPSSGVTGPSGPPGPPGGPTGPTGETGARGVTGGTGAIGAQGLQGITGPTGPQGVRGAQGAQGVVGAVGFQGAQGPQGLQGITGATGVEGPQGIQGPQGEIGPTGAEGPKGVQGIQGITGPTGAQGIQGLQGIIGQAGITGAAGAQGTQGIQGVTGPAGAQGIQGAQGIRGETGAAGVQGTQGVQGIQGTTGLTGPQGAQGPQGVQGIIGPTGAIGMQGPQGIQGIVGPTGAQGSQGMQGIQGITGPTGAQGIRGPQGNLGENGITGPQGVQGTQGIEGPEGPQGIQGVQGIMGIQGSTGMTGPTGATGVTGIQGVQGIQGIQGPTGASGITGASGSQGPAGAQGSQGSIGAVGPTGATGSQGSIGFLGIVGATGATGLPSGGGYFFSTATSTIAANALIPINSGSTVFGSGVSLTNATTVTLSTPGIYLVSYYFQGDPNGGNETISVRLTLNGTQVAGSFIFYVTGGVFILEPAVSNTMVIEVTSSNATLSLQNGPLAIGHVTTLSGVITASLNVLKIV
>NZ_CP016316.1|WP_062821795.1|3149232_3149988_-|class-I-SAM-dependent-methyltransferase
MKGTQMLALNKKCWDTVAPYFFQVDCLPKYGPYTASEDEIHLFDSIKGKKVLDIGCGSGHSLQYMAEHGAEEVWGLDLSSEQIKTANETLKSWDSKLICGAMEEEGDIPKDYFDIVYSIYALGWTSDLRKTLELIYSYVKPGGSFVFSWEHPVYSNLMYGTEEIALSSSYHEETPITFETFKGENVQATLYKRKISTYINELNRAGFTIERIEEPEPSSSFDEELVEPSTKYYSLYKARMVPTTFIIKARK
>NZ_CP016316.1|WP_142238311.1|3150030_3150570_-|CGNR-zinc-finger-domain-containing-protein
MSQNAPNELEYIREFLNTWRIPNDTREAIDLLQTEEDIKLFMKEYFHEEFPFHTIEELKSFREDIRAAIEGEGSLQKWLEKYPFHVHVMEDMKGITYEPIHEETVYTKVLSIVLIAVQENLWGRLKACPDCRWVFYDNSRNGSKRWCGMYAGEEGRACGTIAKVKNYRAKRKGRSDYNV
>NZ_CP016316.1|WP_073530421.1|3150682_3151870_+|MFS-transporter
MKSFSIPIRFMLISSFFMSFGYFAVYAFLAIYLLSFLHFSTFQVGTVLTVIIITSRVIPLFSGLIADKIGYIIMMIAGLFLRGIGFIALGMCSDFYTVSISSALIGFGTAFYEPAARAIFGSQPAHLRKNLFTYLNLSFNCGAIIGPIAGGFLLLLDPIYAFSLTGSLMLLFALIFYLLKNHFQVTTESTSIALGIQTILQNKSFLLFSFIMIFFYIMFTQLTVALPLHMKNISNSNQLATLVITINAITGVIFMVLFRKLFHKYNTLSFIKYGILLMSISFLLIPLFQHPYWLFICVIFFTIGETLVLPNADIAIANYSNESYTATFFGFYQLSLAFGFIIGNYTGTWFKSKLNGMYTPWLIFGGIGLIGFISLHILNIKKERSKEDIYLLEKY
>NZ_CP016316.1|WP_016718092.1|3152036_3152414_+|hypothetical-protein
MKKKLIVLLFTGIILSGCSAIAENSLETGNGSMALLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDDHNDGEIVTFKQVRYTVKN
>NZ_CP016316.1|WP_000747680.1|3152467_3152707_+|DUF3923-family-protein
MKKRWISWWIGNIFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSISLIVLLIAFIIPVFFQVIWLIINLRMSRKNNYTI
>NZ_CP016316.1|WP_000938438.1|3152813_3153362_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEHAS
>NZ_CP016316.1|WP_000613878.1|3153560_3153974_-|ATP-synthase-subunit-I
MIQEALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANMQVVKEEEKKREHASKNIEL
>NZ_CP016316.1|WP_073530422.1|3154027_3155356_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKVRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAEGVTLLLAGPLMMFYKVMYPFIWVLNGSARVVTGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIIGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEEEQEEEKAATV
>NZ_CP016316.1|WP_000285644.1|3155475_3155883_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAVETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHRLEAELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP016316_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP016316_4

4529294-4529377

Orphan

Consensus_repeat	Method
AATCGCCGATATAATTTGATTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP016316_4

>merge|NZ_CP016316|4|4529294-4529377|CRISPRCasFinder
AATCGCCGATATAATTTGATTTACGGTCGATATATTATAAAAATCGTTGATATATTTAAATAATCGTCGATATAATTTGATTTA

>NZ_CP016316|4|3|4529294-4529377|CRISPRCasFinder
AATCGCCGATATAATTTGATTTA	CGGTCGATATATTATAAAAATCGTTGATATATTTAAAT
AATCGTCGATATAATTTGATTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP016316.1\|WP_061183695.1\|4525339_4526455_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_014893459.1\|4528303_4528453_+\|YtzI-protein	unknown	unknown	gnl\|CDD\|380227
NZ_CP016316.1\|WP_000071211.1\|4537183_4537999_-\|DUF4247-domain-containing-protein	unknown	unknown	gnl\|CDD\|379437
NZ_CP016316.1\|WP_061183693.1\|4528454_4528685_+\|DUF3953-domain-containing-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_016718746.1\|4535903_4536776_+\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP016316.1\|WP_073530073.1\|4526684_4527224_-\|DUF3267-domain-containing-protein	unknown	unknown	gnl\|CDD\|378690
NZ_CP016316.1\|WP_000368793.1\|4524056_4524863_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NZ_CP016316.1\|WP_000017662.1\|4532383_4533412_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP016316.1\|WP_000051759.1\|4538011_4538518_-\|DUF4178-domain-containing-protein	unknown	unknown	gnl\|CDD\|379368
NZ_CP016316.1\|WP_000965225.1\|4534678_4535716_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP016316.1\|WP_000276389.1\|4527338_4527818_-\|antimutator-8-oxo-(dGTP/GTP)ase	unknown	unknown	gnl\|CDD\|131752
NZ_CP016316.1\|WP_001286198.1\|4531044_4532394_+\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP016316.1\|WP_001141369.1\|4529421_4529895_-\|S-ribosylhomocysteine-lyase-LuxS	unknown	unknown	gnl\|CDD\|179399
NZ_CP016316.1\|WP_000435820.1\|4527902_4528220_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_049113375.1\|4522280_4523288_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|223787
NZ_CP016316.1\|WP_000809329.1\|4530023_4530260_+\|membrane-protein-insertion-efficiency-factor-YidD	unknown	unknown	gnl\|CDD\|178815
NZ_CP016316.1\|WP_000838160.1\|4530256_4530820_-\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|239474
NZ_CP016316.1\|WP_000849109.1\|4524897_4525125_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP016316.1\|WP_011040784.1\|4533578_4533812_-\|spore-germination-protein	unknown	unknown	gnl\|CDD\|371190
NZ_CP016316.1\|WP_000009044.1\|4523299_4524064_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213260

Protein	Function_ID	Function_description	E-value
NZ_CP016316.1\|WP_014893459.1\|4528303_4528453_+\|YtzI-protein	gnl\|CDD\|380227	NF033232, small_YtzI, YtzI protein. Members of this family include YtzI from Bacillus subtilis, and homologs widely distributed in the Firmicutes. The pattern of sequence conservation suggests the protein begins with a hydrophobic stretch without any basic residue near the initiator Met residue. Members of this family average about 53 residues in length. At the time this model was constructed, members were included in Pfam model PF12606.6 (Tumour necrosis factor receptor superfamily member 19), seemingly in error. This model was constructed to separate the two families.	7.29973e-14
NZ_CP016316.1\|WP_000071211.1\|4537183_4537999_-\|DUF4247-domain-containing-protein	gnl\|CDD\|379437	pfam14042, DUF4247, Domain of unknown function (DUF4247). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 143 and 271 amino acids in length.	4.52859e-27
NZ_CP016316.1\|WP_000965225.1\|4534678_4535716_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	5.9414e-44
NZ_CP016316.1\|WP_000838160.1\|4530256_4530820_-\|carbonic-anhydrase	gnl\|CDD\|239474	cd03379, beta_CA_cladeD, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	1.81846e-65
NZ_CP016316.1\|WP_000276389.1\|4527338_4527818_-\|antimutator-8-oxo-(dGTP/GTP)ase	gnl\|CDD\|131752	TIGR02705, conserved_hypothetical_protein, nucleoside triphosphatase YtkD. The functional assignment to the proteins of this family is contentious, with papers disagreeing in both interpretation and enzyme assay results. This protein belongs to the nudix family and shares some sequence identity with E. coli MutT but appears not to be functionally interchangeable with it. [DNA metabolism, DNA replication, recombination, and repair].	4.16449e-94
NZ_CP016316.1\|WP_000051759.1\|4538011_4538518_-\|DUF4178-domain-containing-protein	gnl\|CDD\|379368	pfam13785, DUF4178, Domain of unknown function (DUF4178).	6.69713e-31
NZ_CP016316.1\|WP_016718746.1\|4535903_4536776_+\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	6.32444e-72
NZ_CP016316.1\|WP_000017662.1\|4532383_4533412_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	1.80616e-92
NZ_CP016316.1\|WP_001286198.1\|4531044_4532394_+\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP016316.1\|WP_001141369.1\|4529421_4529895_-\|S-ribosylhomocysteine-lyase-LuxS	gnl\|CDD\|179399	PRK02260, PRK02260, S-ribosylhomocysteine lyase.	2.56355e-81
NZ_CP016316.1\|WP_000368793.1\|4524056_4524863_+\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	2.33316e-61
NZ_CP016316.1\|WP_049113375.1\|4522280_4523288_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|223787	COG0715, TauA, ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism].	9.87467e-51
NZ_CP016316.1\|WP_000809329.1\|4530023_4530260_+\|membrane-protein-insertion-efficiency-factor-YidD	gnl\|CDD\|178815	PRK00041, PRK00041, hypothetical protein; Validated.	3.49162e-45
NZ_CP016316.1\|WP_000009044.1\|4523299_4524064_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213260	cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters. NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	2.46363e-113
NZ_CP016316.1\|WP_011040784.1\|4533578_4533812_-\|spore-germination-protein	gnl\|CDD\|371190	pfam10676, gerPA, Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor.	6.156e-16
NZ_CP016316.1\|WP_073530073.1\|4526684_4527224_-\|DUF3267-domain-containing-protein	gnl\|CDD\|378690	pfam11667, DUF3267, Putative zincin peptidase. This family of proteins has a conserved HEXXH motif, suggesting the members are putative peptidases of zincin fold.	8.63683e-14

>NZ_CP016316.1|WP_061183693.1|4528454_4528685_+|DUF3953-domain-containing-protein
MFRILRIGIALTVIIISAIGLYTGQNTFLPLSQFLLGALMFVIAIEQIKKKDSGTGFICIGAGVFTWIVLIISHIK
>NZ_CP016316.1|WP_014893459.1|4528303_4528453_+|YtzI-protein
MFKILIIGIIIVLVILVLSIMTINKGYAYKHSVDKLEDNPYTKNNKENS
>NZ_CP016316.1|WP_000435820.1|4527902_4528220_-|hypothetical-protein
MEQKKTYYISIGNGQISQVKTADTYNFEISANDEEITELREYFDQAYVEDLGSFVRSHVPFVEYHHDSNNDRYDEQLQKAYKMIYDLGNHETKELVAQMGIINGL
>NZ_CP016316.1|WP_000276389.1|4527338_4527818_-|antimutator-8-oxo-(dGTP/GTP)ase
MYKFKDYYHNTVQLSFERYPFSPEPKHVWVVCRYGDQWLLTHHLRRGLEFPGGKVELGETPEEAAVREVHEETGGIVSDLTYLGQYKVSGKDKIIIKNIYFATISAVEQHTHYEETKGSVLLTDIPDNIKTDRKFSFIMRDDVLARTMKHIEEIGCFTK
>NZ_CP016316.1|WP_073530073.1|4526684_4527224_-|DUF3267-domain-containing-protein
MDKRKETTVTVSMVKLNIYAFLIIFALAFGIGYLHIFLSGGVRIEITLLTMFLFIIALLVLVCIHEAIHPIGFHYIGGVPWSELKWGVNWKLGVAYAHSKKEITVKQMKKVLMLPFLPTGILPIVLGLAMNLEPLSFLGILLTAGCMGDIALYQKVSKFPDDALVIDHPSKPQFTVYES
>NZ_CP016316.1|WP_061183695.1|4525339_4526455_-|hypothetical-protein
MKRLYGKLVGVIVAIGLLAGCESSMKSVKEKEVCKTEKECVEIGDKKLQKVYEKIDGLSELEAVEDYEIEEHESANMKKAERKKEDDDENYFFLASYYIDGDEIVDPYFEKIERKRLNKVFANDKEAKEEVLQQRQDRGYHEDLWDMYRTLIPAKYRGNITEFDLITDGYDGVVAHVMPSIENPKDWTLSLDTLDSAVNIDEVMKTLIHETAHVLTLGHKQIPVDENYVKDFEEDKDISTYRNKCGTLFLQEGCAKENSYINQFYNSFWKPIEQEWTEKKVEESEETQIAFFKEKHDEFVSQYGTTNVAEDIADTFTAFILQDSKKVKEGSELKYKKIAFFYQFPELVKMRAEVLAGLYDVSKTIEQQSGN
>NZ_CP016316.1|WP_000849109.1|4524897_4525125_-|hypothetical-protein
MKTILAVAGLIWVMSHGFPIFEGEQIRSALDKKFNDYHVIDRKDNVVTVRVKDCFHTVTVADGNVKNETKMCDKK
>NZ_CP016316.1|WP_000368793.1|4524056_4524863_+|ABC-transporter-permease
MDNIKQLHEQFRKKERRRAWLARSLQLLLLILFFALWEIASKKEWIDPLLFSSPSSIWELFLSKWMDGSLLVHIWTTLLETGLGFILGTVLGAIIATFLWWLPLLARVLDPYLVVLNAMPKVALGPIIIVIFGPNISSSIAMGVIISIIITILVIYSAFQEVDSNYIKVMDTFGANKWQCYKQVVLPASFPAIISTLKVNVGLSWVGVIFGELLVSKQGLGYLISYGFQVFNFTLVLLSVLLTCVLATLMYVFVEAFEKLLIGKRKRS
>NZ_CP016316.1|WP_000009044.1|4523299_4524064_+|ABC-transporter-ATP-binding-protein
MSFLQIRNVSHCFFAKENAKLILEDMSLQVEEGEFISILGPSGCGKTTLLSIIAGLLDPIEGIVFLDGEPITTKTSSMGYMLQQDYLFPWKTIEENIMLGLHIRKIYDEQTKEHTLQLLKQVGLHDVEQQYPRELSGGMRQRAALVRTLATDPKILLLDEPFSALDYQTKLKLEDLVFSLLHKYKKTSLLVTHDIEEAIAMSDRIYLLQANPGKIAKTFIVPESIRSLSPLESRHHHDFPSLFQNIWKELERLG
>NZ_CP016316.1|WP_049113375.1|4522280_4523288_+|ABC-transporter-substrate-binding-protein
MKKLIAVFCIMLLAVFTFAACSSKKEDTKEQTQNVRVGEVTHSLFYAPLYVGIEKGFFKDEGLHVDLQTTAGGDKTMTALLSGGIDIALVGSETSIYVHQQGAKDPVINFAQLTQTDGTFLVSRKKLDSFNWNDVKGVTFLGQRKGGMPQMVGEYVLKKNGIDPHKDTNLIQNIEFANIANAFASGTGEFVQLFEPTASIFEKEGKGYIVASFGNESGTVPYTTFMAKESFLKKDKAAAEKFTRALYKAQQWVDTHSPEEIADAVSPLFKDTSKDITVKVIERYKKQHSYATNPLLDAEEWKQLQTIMKDAGELQKEVPHEALVNTKIAESVIKK
>NZ_CP016316.1|WP_001141369.1|4529421_4529895_-|S-ribosylhomocysteine-lyase-LuxS
MPSVESFELDHTIVKAPYVRHCGVHNVGSDGIVNKFDIRFCQPNKQAMKPDVIHTLEHLLAFNLRKYIDRYPHFDIIDISPMGCQTGYYLVVSGTPTVREIIDLLELTLKDAVQITEIPAANETQCGQAKLHDLEGAKRLMNFWLSQDKDELEKVFG
>NZ_CP016316.1|WP_000809329.1|4530023_4530260_+|membrane-protein-insertion-efficiency-factor-YidD
MKQIFIGIIRFYQKFISPMTPPTCRFYPTCSHYGLEAFQKHGAFKGFWLTCKRILKCHPFHPGGFDPVPDKKDDKVHS
>NZ_CP016316.1|WP_000838160.1|4530256_4530820_-|carbonic-anhydrase
MKSLEEILQYNEKFVEEKKYEEFVAGKFPNKKMVIISCMDTRLVELLPKAMNMRNGDVKIIKVAGAVISHPFGSIMRSILVAVYELGADEVCVVGHHDCGMAKIQASSTIEKMKERGITEEKLDMLRYSGIDLEQFLRGFSSVEESVEHSVSVLRNHPLLPEEVPVHGLVIDPDTGKLDLVVNGYEN
>NZ_CP016316.1|WP_001286198.1|4531044_4532394_+|cytochrome-ubiquinol-oxidase-subunit-I
MSDVLLLSRFQFAITVFYHFLFVPLTIGLVILVACMETQYARTLNPTYRKMANFWGKLFTINFVMGIITGITMEFQFGTNWSEYSKYMGDIFGSPLAIEALVAFFLESTFMGIWLFGKDKISPKFRAFCMWMVALGTNISALWIITANGFMQNPVGYVVRNGRAELNDFWALVTNPYAWNMFFHTVVGCYIVGAFFVMAISAYHLLRKNEVEFFKKSFKFGLMLGLFAATITPFMGHQSGVSAAKYQPAKGAAMEAVWETGKGQGFSIVQIPDVKNEKNFEFLTIPKLGSFFYTNSFDGEIVGLKDIPKEDRPNVNLVYYSFRLMVALGMFFMALTWYGFYLNRKGKLENSKRYLKITIWSVLLPYIAINAGWIVAEVGRQPWTVYKLMRTAESVSPISVPQIWFSLISLILFYTLLLIADVYLMLKFAKKGPAALEEPATEGGAAHVS
>NZ_CP016316.1|WP_000017662.1|4532383_4533412_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MSHDMLAIIWFGLWGVIWTVYFILDGYALGNGMIFPFVTKDRQERNQLQEAIGPFWGGNEVWLITAGGATFAAFPVTYANMFSYLYTPLFLVLLALFARAAGLEFMHKDDSPIWQKTCKWAFAIGSFLIAFLFGVTFANLYYGLQIGKNGYEGNLLSLLNHYGILGGLFFTAIFVVSGALWVMIKTTGEVSDRAYKIARPFSMAAAIILAIFYVATANRTNLFQNFTEYPVLFILPVLAMLMSVLALIMVYKHKIGLAFTFVCLTIAMFMTTGFAGMFPRMLPSRINDAYSTTLYNAAGSQLNLKIMFFVAMVMVPIVIGYQLWSYSIFKNKIHKDSAKGYH
>NZ_CP016316.1|WP_011040784.1|4533578_4533812_-|spore-germination-protein
MKVGDKMPSVVEGVIIENCNGTINLGDKYNVQPIEKTKAYNGSGSSNTGMKVQTFSGISTADVGDSDVNDQGIQFTL
>NZ_CP016316.1|WP_000965225.1|4534678_4535716_+|YdcF-family-protein
MLYFGIIPLILFIIFLISYLRDPRKIINGFLFNTFICFFLLFCVIISVNSSSDVLRYIIILPILALLIMLPFGIIALMFGLFLNARILMKREGRRFTNCLTLLAAFGILFFMLLPIISPASLFSSHFQPIFAGISLITVYFFIHLSNFLSAYFLYQFNRPRRNQDFIIVLGSGLINDKVPPLLASRIHKAIDFYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGKYNSIFTTNNFHLFRAGIYARQAGLNSQGIGSKTAFYYWPNAMIREYVAIVVMGRKRHMKICGTILGFALFLTVLSFIIS
>NZ_CP016316.1|WP_016718746.1|4535903_4536776_+|YitT-family-protein
MEKIIKNKPNKLRIASKALMIIIGAFITAYGLEAVLIPNNVSDGGVTGLSIVSSTLFGLPLGALIAIINIPFVWLGYKQIGKSFAIYSIIGIASLAIGTVVMHDIPAIIEGDTLLVTVVGGIIIGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFLNMFVFIFVSTVFGLQGAILSAIAYFIASKVIHIVEVGLSGSKAFKIITKEPELMVETIRDRLGRSATYNEVYGGYSKEKFKEISCVINRLEESKMKELINEIDPHAFITVYDVAEVKGGNFKKRDIH
>NZ_CP016316.1|WP_000071211.1|4537183_4537999_-|DUF4247-domain-containing-protein
MSNRLFTMIKSFVIPILAIVTLLVVAGYALSGCQGGQTKSIQDRYPLESVAKEGKQESYVYRAANRSVPEVAKELMNEREPKQASKEDENQMFLVYSDKIYNLQKDKEKPSDTLIEISNKEFVRQNYQPSFLQGYIMGSILNDIFGSRKSSYGDYRGYNDRQNHKPVIPERPPTKEEKKTPPPITKEGKGSIIKRGDNVDSKSSVGDTGSITKKGSSTPPPSTGSKGKITKTPGGSSGSDVKPKSSIKTPPRNTSPPKTRVGGSGKITKRR
>NZ_CP016316.1|WP_000051759.1|4538011_4538518_-|DUF4178-domain-containing-protein
MSLFKRIKNIMKSPEPPKPEKSLLTLAPGDMVEVSLVMYELIGKTSMHSRKEIVLTLQDGKDIRYLKIEDRENTYYKLYTPIDGRLDSIDEIPTTIEMDDTEYHMEEQYNGRVVVMGKTPFSASEEQYVWEFQSDNRKLLRIEWQNGRTMMYEGEAIIPADVQIIRAT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP016316_1	1.1\|865630\|46\|NZ_CP016316\|CRISPRCasFinder	865630-865675	46	NZ_CP009650	Bacillus pseudomycoides strain BTZ plasmid pBTZ_1, complete sequence	126364-126409	3	0.935
NZ_CP016316_1	1.1\|865630\|46\|NZ_CP016316\|CRISPRCasFinder	865630-865675	46	NZ_CP007625	Bacillus pseudomycoides strain 219298 plasmid unnamed, complete sequence	101388-101433	3	0.935
NZ_CP016316_4	4.1\|4529317\|38\|NZ_CP016316\|CRISPRCasFinder	4529317-4529354	38	NZ_CP050185	Bacillus thuringiensis strain HER1410 plasmid pLUSID2, complete sequence	93778-93815	7	0.816
NZ_CP016316_4	4.1\|4529317\|38\|NZ_CP016316\|CRISPRCasFinder	4529317-4529354	38	NZ_CP050185	Bacillus thuringiensis strain HER1410 plasmid pLUSID2, complete sequence	93819-93856	8	0.789
NZ_CP016316_4	4.1\|4529317\|38\|NZ_CP016316\|CRISPRCasFinder	4529317-4529354	38	NZ_CP050185	Bacillus thuringiensis strain HER1410 plasmid pLUSID2, complete sequence	93860-93897	8	0.789

1. spacer 1.1|865630|46|NZ_CP016316|CRISPRCasFinder matches to NZ_CP009650 (Bacillus pseudomycoides strain BTZ plasmid pBTZ_1, complete sequence) position: , mismatch: 3, identity: 0.935

tgttaatgtctttagtgaagacacttgcttgcagaccgaactctga	CRISPR spacer
tattaatgtcttttgtgaagacacttgcttgcagaccgaaatctga	Protospacer
*.*********** ************************** *****

2. spacer 1.1|865630|46|NZ_CP016316|CRISPRCasFinder matches to NZ_CP007625 (Bacillus pseudomycoides strain 219298 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.935

tgttaatgtctttagtgaagacacttgcttgcagaccgaactctga	CRISPR spacer
tattaatgtcttttgtgaagacacttgcttgcagaccgaaatctga	Protospacer
*.*********** ************************** *****

3. spacer 4.1|4529317|38|NZ_CP016316|CRISPRCasFinder matches to NZ_CP050185 (Bacillus thuringiensis strain HER1410 plasmid pLUSID2, complete sequence) position: , mismatch: 7, identity: 0.816

cggtcgatatattataaaaatcgttgatatatttaaat	CRISPR spacer
tgatagatatattttaaaaatcgttgatatattgtaag	Protospacer
.*.* ******** *******************  **

4. spacer 4.1|4529317|38|NZ_CP016316|CRISPRCasFinder matches to NZ_CP050185 (Bacillus thuringiensis strain HER1410 plasmid pLUSID2, complete sequence) position: , mismatch: 8, identity: 0.789

cggtcgatatattataaaaatcgttgatatatttaaat	CRISPR spacer
tgatagatatattttaaaaatcgttgatatattgtgag	Protospacer
.*.* ******** *******************  .*

5. spacer 4.1|4529317|38|NZ_CP016316|CRISPRCasFinder matches to NZ_CP050185 (Bacillus thuringiensis strain HER1410 plasmid pLUSID2, complete sequence) position: , mismatch: 8, identity: 0.789

cggtcgatatattataaaaatcgttgatatatttaaat	CRISPR spacer
tgatagatatattttaaaaatcgttgatatattgtgag	Protospacer
.*.* ******** *******************  .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

320651 : 329024

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625677.1\|320651_321959_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5
WP_001170542.1\|322047_322767_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278826.1\|322759_323014_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_061183753.1\|323010_323694_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_073531305.1\|323677_325897_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	4.8e-162	41.0
WP_073531304.1\|325881_327297_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.4
WP_001262449.1\|327399_328440_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.9
WP_000088580.1\|328436_329024_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1

DBSCAN-SWA_2

1894249 : 1903595

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016717230.1\|1894249_1895548_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	1.0e-10	30.5
WP_001194311.1\|1895645_1896410_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_073530003.1\|1896649_1898410_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.0e-267	96.1
WP_142238278.1\|1898498_1899176_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.5e-119	94.2
WP_016717233.1\|1899172_1900246_+	sensor histidine kinase	W8CYF6	Bacillus_phage	6.3e-176	90.2
WP_142238279.1\|1900226_1900853_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|1901049_1901769_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_029141106.1\|1901917_1902589_+	O-methyltransferase	W8CYT3	Bacillus_phage	5.0e-62	88.3
WP_016717235.1\|1902722_1903595_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.8e-64	44.0

DBSCAN-SWA_3

4286704 : 4294390

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016718626.1\|4286704_4287628_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-45	43.5
WP_014893492.1\|4287754_4288690_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.1e-22	26.2
WP_000018053.1\|4288691_4289384_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_001014318.1\|4289727_4289922_+	YwbE family protein	NA	NA	NA	NA
WP_001255958.1\|4289961_4291161_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.2
WP_000587815.1\|4291459_4291783_+	heme oxygenase	NA	NA	NA	NA
WP_001086113.1\|4291849_4292614_-	class B sortase	NA	NA	NA	NA
WP_088883330.1\|4292646_4293417_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.4e-13	25.7
WP_001036817.1\|4293406_4294390_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.1e-17	26.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP016317

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP016316

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection