CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP018145	Brevibacillus formosus strain NF2 chromosome, complete genome	2 crisprs	csa3,RT,DEDDh,cas14j,DinG,WYL,cas3	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP018145_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018145_1

5904416-5904500

Orphan

Consensus_repeat	Method
AAATCGTAATAATTACGTTTTGTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP018145_1

>merge|NZ_CP018145|1|5904416-5904500|CRISPRCasFinder
AAATCGTAATAATTACGTTTTGTGTTGACTTTGAATATTTTGATGCGTTATGATAACCAACAAATCGTAATAATTACGTTTTGAG

>NZ_CP018145|1|1|5904416-5904500|CRISPRCasFinder
AAATCGTAATAATTACGTTTTGTG	TTGACTTTGAATATTTTGATGCGTTATGATAACCAAC
AAATCGTAATAATTACGTTTTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018145.1\|WP_007726119.1\|5895110_5895578_+\|cytochrome-b5	unknown	unknown	gnl\|CDD\|259980
NZ_CP018145.1\|WP_088910423.1\|5905762_5905912_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|179075
NZ_CP018145.1\|WP_088910424.1\|5906037_5907171_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP018145.1\|WP_088911044.1\|5901754_5903119_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_007726169.1\|5914727_5915321_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378968
NZ_CP018145.1\|WP_088910417.1\|5895593_5897267_+\|b(o/a)3-type-cytochrome-c-oxidase-subunit-1	unknown	unknown	gnl\|CDD\|238830
NZ_CP018145.1\|WP_088910419.1\|5898372_5899005_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380314
NZ_CP018145.1\|WP_088910415.1\|5894066_5894723_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP018145.1\|WP_088910422.1\|5904523_5905738_+\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|223597
NZ_CP018145.1\|WP_088910418.1\|5897489_5898245_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235506
NZ_CP018145.1\|WP_088910420.1\|5899628_5901053_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP018145.1\|WP_088910421.1\|5903373_5904330_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_088910426.1\|5910947_5912111_-\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223551
NZ_CP018145.1\|WP_088910428.1\|5912897_5913188_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_088910427.1\|5912341_5912686_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|369571
NZ_CP018145.1\|WP_088910416.1\|5894919_5895087_+\|cytochrome-c-oxidase-subunit-2A	unknown	unknown	unknown
NZ_CP018145.1\|WP_047073866.1\|5901009_5901717_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP018145.1\|WP_088910425.1\|5907167_5908166_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|131952
NZ_CP018145.1\|WP_088910430.1\|5913818_5914577_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|225130
NZ_CP018145.1\|WP_088910429.1\|5913286_5913700_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|214628

Protein	Function_ID	Function_description	E-value
NZ_CP018145.1\|WP_007726119.1\|5895110_5895578_+\|cytochrome-b5	gnl\|CDD\|259980	cd13913, ba3_CcO_II_C, C-terminal cupredoxin domain of Ba3-like heme-copper oxidase subunit II. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea, which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that archaea acquired heme-copper oxidases through gene transfer from gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead, they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively.	3.94059e-61
NZ_CP018145.1\|WP_088910423.1\|5905762_5905912_+\|50S-ribosomal-protein-L33	gnl\|CDD\|179075	PRK00595, rpmG, 50S ribosomal protein L33; Validated.	2.4309e-20
NZ_CP018145.1\|WP_088910424.1\|5906037_5907171_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	7.17461e-57
NZ_CP018145.1\|WP_088910427.1\|5912341_5912686_+\|cupin-domain-containing-protein	gnl\|CDD\|369571	pfam07883, Cupin_2, Cupin domain. This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel).	6.61345e-15
NZ_CP018145.1\|WP_007726169.1\|5914727_5915321_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|378968	pfam12840, HTH_20, Helix-turn-helix domain. This domain represents a DNA-binding Helix-turn-helix domain found in transcriptional regulatory proteins.	5.03878e-10
NZ_CP018145.1\|WP_088910417.1\|5895593_5897267_+\|b(o/a)3-type-cytochrome-c-oxidase-subunit-1	gnl\|CDD\|238830	cd01660, ba3-like_Oxidase_I, ba3-like heme-copper oxidase subunit I. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively. For general information on the heme-copper oxidase superfamily, please see cd00919.	0
NZ_CP018145.1\|WP_088910419.1\|5898372_5899005_+\|nitroreductase-family-protein	gnl\|CDD\|380314	cd02137, MhqN-like, nitroreductase family protein similar to the NAD(P)H nitroreductase MhqN. A diverse subfamily of the nitroreductase family containing uncharacterized proteins; includes nitroreductases MhqN, YodC, YdgI, DrgA. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer.	3.45915e-60
NZ_CP018145.1\|WP_088910415.1\|5894066_5894723_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	6.61553e-78
NZ_CP018145.1\|WP_088910422.1\|5904523_5905738_+\|GTP-binding-protein	gnl\|CDD\|223597	COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only].	1.7786e-121
NZ_CP018145.1\|WP_088910418.1\|5897489_5898245_-\|SDR-family-oxidoreductase	gnl\|CDD\|235506	PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	2.39463e-86
NZ_CP018145.1\|WP_088910420.1\|5899628_5901053_-\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.38968e-65
NZ_CP018145.1\|WP_088910426.1\|5910947_5912111_-\|cation:proton-antiporter	gnl\|CDD\|223551	COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism].	2.49433e-69
NZ_CP018145.1\|WP_088910425.1\|5907167_5908166_+\|phosphotransferase	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	6.29528e-33
NZ_CP018145.1\|WP_047073866.1\|5901009_5901717_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.89324e-87
NZ_CP018145.1\|WP_088910430.1\|5913818_5914577_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|225130	COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only].	1.95496e-16
NZ_CP018145.1\|WP_088910429.1\|5913286_5913700_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|214628	smart00344, HTH_ASNC, helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli).	9.9525e-29

>NZ_CP018145.1|WP_088910421.1|5903373_5904330_+|hypothetical-protein
MKAWHKTMAAVLCSGAVLMASGIGADPVQASGTQSQAYAPVVLLQPEQNIPFTIQFVDGFVAKVTNTKTKATSTVDISDNKATYVKQGIYHGNGKLQKATNGYTQKLAELVPFRDAKGNLRYMGKQTLWGLNTEDRLAVATSVWNVGDKQPQLLQVTVQKADWDNMPSPDVRINSGFSMSSDSTFVLDTKYADVTGDNIKDLILLVGDKMGVSMNQTAHNLRVVVREGKDNQQTFISVGKRDSGILPKLAITDGNADQVKDILVTMPTATGHVYSQLTWKENRPQPVVEQGKLNDRQAYQPVIGVYGEAIEMNKAKKQ
>NZ_CP018145.1|WP_088911044.1|5901754_5903119_-|hypothetical-protein
MKKAWLVTTALCVSLVSGCGLTDTPNELMRAPSADGDQKSINQAVMQFLPAGSQLSVPLHPAEASAVSLQDLNGDGVAEVVAFYKTEKTDYEIGVLVLTQQQGNWEKLSSFTGVGSELDFVSFQDLTGDKIPEMLIGMGGGEDLNKELSVYSLANNMTQELMKQPYSIMAVGDLTGDDHADLALVVLDKNNFTSKAELYGAANGTIAKKTELALDGSVNGYYQAIIGKASPTRNGLFIDAGLGAHSASTELLLWENGQLSNPLPKIEGEMDLTFKPYSLESEDINGDGIIEIGTKIQPAGTEDLAMVEIPWVSSYFQWDGKTGLKHIEDHYQNYTQGLDLKIPAKWGKKYTISINQDTNPFLIRFLYYGANGKNKADLLTLQSIPQNEWTKFESGLKQKQVPYILLREEGNQVLIAILPQTTPTLGKAALAEYRSMQLTAEEVRRLYKPVTNRE
>NZ_CP018145.1|WP_047073866.1|5901009_5901717_-|response-regulator-transcription-factor
MKVLLLEDEKSIRDFVRINLKREGYEVIEAGTGEEALDLADQQSDIVIAILDVMLPGIDGFEVCGQLRKKYPRLGIIMLTAKSQELDKVMGLEFGADDYVSKPFSPAELLARVKALHRRLTPIPEAEDKNEINIAPFTLLLDERKLTRAEQEIDLTPKEFAIIKLLAENANKAISRDEILTAVWGQFFVGDLKIVDVNIRRIRQKIEDDPAHPAFLETVWGYGYLWRKDVPDERH
>NZ_CP018145.1|WP_088910420.1|5899628_5901053_-|sensor-histidine-kinase
MATCGERTSQMKGIKSRLVLHFGLILLLIVLLLEGLFYWAVHTYYIGTATEALVTRSTTFTNFINKYATGYRLKDKARYILENVSNQEYAKIEVLDPGGKVILNSYGFQTGEIINTPDAMDALKGQSGLYIGKSPQSWERVIAVSNPLTYSGQFVGVLRYTISAEPLYQAVNRIALYGAGVGTSVVVLAFALSLLMAKRIVDPIEELTNAAKQMAEGNFGVRAPKRFDDEVGTLADTFNYMATEIGKNEKLKNDFISSVSHELRTPLTSIKGWGETLISGGLEEPEETMLGLEVISKETDRLIGLVEELLDFSKFQSGEMKLSREGMDIRELLHDLHLQFSVRANAKQIELKLETPPTPLMVMGDPNRLKQVFVNLLDNALKFTPQKGSIVIAASLSGDRLLVTVTDTGEGINPEDLPHVTEKFFKGRSKLSGSGLGLAICKEIIQLHAGRFSISSALGQGTSIMVDLPLLANQ
>NZ_CP018145.1|WP_088910419.1|5898372_5899005_+|nitroreductase-family-protein
MNSDLKITAEQVMEARHSVRKYDPNEEIPQGELNEILRLAASAPSSWNLQHWRFLVVTDPAIKEKLLPIAYNQQQVVEAYATIIILGDLEAYKSARPVYDEALAKGYVTEQVRETMIAQIEGAYNNNPEIARDEAIRNSSYAAMQLMLAAKAKGYDTCPMGGYNRDALIKELNIPSRYLPTLMLTLGKASVQAHSTSRFGLEQLVIQNSF
>NZ_CP018145.1|WP_088910418.1|5897489_5898245_-|SDR-family-oxidoreductase
MKYTDNIVIVTGGGQGIGRAIATMYATEGAHVVIAEYNRAAGEETASLINTTEAVKGTAHFEHIDVSVPAQIEQLMRTVDERWGRLDVLINNAGLSVWESPYELTVEVWDHILNTNLRSVFLASREAAKIMRRHGGGAILNLCSTRAHMSEPHSEAYAASKGGILSLTHALGVSLGPDGIRVNAISPGWIEHRDYAALRPGDHTQHPAGRVGTPDDIARACLFLTQKDNDFITGTELIVDGGMTRKMIYEP
>NZ_CP018145.1|WP_088910417.1|5895593_5897267_+|b(o/a)3-type-cytochrome-c-oxidase-subunit-1
MVIARKIDDTIPHVPVQRSAASLSLAYVWVAYIAFGLAAVAGMVQGMVRGGIMELPSWTNYYQILTAHGVLMALIFTTYFIVGFIFSGVARTTGGSLHGAALKFGWAGWILMTVGTLMAVVTILLNEASVLYTFYAPLKASPYFYIGSALLVVGSWLAGFGVFASYRKWKRENKGKTSPLFLYMGVTTYILWITATIPVAVEVLFQLIPWSLGLVPTINVMLSRTLFWFFGHPLVYFWLLPAYMAWYVCLPRIIGGHVFSDSLSRLAFICLLLFSIPVGFHHQLMEPGISPAWKMIHVTLTLIVVIPSLMTAFSMFAIFETTGRKKGGVGLFGWFKKLPWTDVRFFAPFVGMLFFIPGGAGGIINASNQINAVVHNTIWVTGHFHITVGAAVALTFFGVSFWLIPALTGRQLTKTANRMGMVQTVFWAVGMFLMSLAMHAMGLQGAPRRTDYTTYMDHPLALGWMDYQRVMAFGGGLLFVSAILLIVILLYLTFYAPKGNTEYPIAETETTQEVPKILERWPVWIGLVAFLIILAYGYPILEQIQHQAPGSPPFVTW
>NZ_CP018145.1|WP_007726119.1|5895110_5895578_+|cytochrome-b5
MHLHRYEKIWLMLGAGGLALFIVLLCVNAFAMGMAPPSNMEMIDPEKVTETPPFDKPGLKQVGDNEYDAYMTAFAFGFAPTKMEIPVGATVNFHVTSPDVIHGFQIPETNINFMVLPGHISSATHTFDEPGEYLILCNEYCGAGHQVMATTIIVK
>NZ_CP018145.1|WP_088910416.1|5894919_5895087_+|cytochrome-c-oxidase-subunit-2A
METQVDKAAKGKKSKSSKLQTDQEDLKGTFVAVLIVGGIILVGWLGVFGLFLDRA
>NZ_CP018145.1|WP_088910415.1|5894066_5894723_+|response-regulator-transcription-factor
MTIRVLIADDHAIVRSGLGMLINAQEDMEVVGYAADGKEACEKAWEIQPNVVLMDLSMPPGENGLTATARLKETAPDIQVLVLTMHDDEEYLFRVLQAGAAGYILKSAPDLDLITAIRSVNQGMAYLYPSATKSLIEEFLQMVKNGEEQAKYDILTDREKEVLVLIAKGFSNKEIAEQLTVSVKTVESHKAHIMEKLHLRTRPDLVRYAIKKGWLDFE
>NZ_CP018145.1|WP_088910422.1|5904523_5905738_+|GTP-binding-protein
MNMIENKIPVTVLSGYLGAGKTTLLNHVLNNRDGLRVAVIVNDLSEVNVDASLILSGSGLSRVDEKVVELSNGCICCTLREDLLTEVERLALEGRYDYILIESTGVGEPVPVAQTFTYVDEENGINLSSLCRLDTMVTVVDAYRFWHDFSSGENLLDRGQAVGAEDTREVADLLIDQIEFCDVLILNKCDRVAPDDLIQLEAVLRKLQPNARFIRAVRGQVDPQEILNTHLFDFETASQSAGWIAELQKEVHTPETDEYGISSFVYRSRRPFHPARLEKWLEDWPEEIVRAKGFFWLATRNDVAMTLSQAGPSIEIGTAGYWTAALSAEEQQAILVEEPNWQQTWHPVHGDRTTELVFIGIDLNQEQIVKHLDACLLNDEEYEADWSKLPDPLPTADAVIETTL
>NZ_CP018145.1|WP_088910423.1|5905762_5905912_+|50S-ribosomal-protein-L33
MRVNVTLQCTETGDRNYITSKNKRNHPERLELRKYSPRLKRYTIHRETK
>NZ_CP018145.1|WP_088910424.1|5906037_5907171_+|glycosyltransferase-family-4-protein
MQNDNKLKVLVMTNEYLPKIIGGLGIVATHLSIALSQNGVEVTVLCTGNSNQLTISKPNDNLRILRFPKSTRYFHRTKQSFKAKAILNTVSSKGFTKPDIIHVHSTDFADTAKLAKARFHVPIVYSCHSMASQGALSAPGKNQTKLIRSASRIIVPSKWQIGATRRRYPNTNINKFSVIPHGVKPGTSQSMAAPTNLLYVGRLIPSKGVDVLIRAIGLLSRTHKDVRLTIVGSGLISYQRKIRALTRQMGLTKRIRWVKKSKYGAVQRMYTSYGAVIVPSKKESFCLVALEAMANGVPLVSTLSGGLKEFVNDQNAQIISTVNSSEIARAIKAFWNNPSLTKNRVRNAHSTAARYNWSTITLQYESLFTNLNKVEGQ
>NZ_CP018145.1|WP_088910425.1|5907167_5908166_+|phosphotransferase
MIKHSINGVAKQFGVRVRQQMKIRAGIYRIVTPDGRTLSLKRMPKGVGRARWIDRMLLRVRQSGSLLAWRNPNRPEGRRAYHLSKKGEIFVLTPWISGRKPSPRSLADMRACGVALARFHEAGLTALKGNFAYSEMGTWFATLRKRHCYIQTKMANARRNGFSQPINRFIKQHGPEIIRYARQAEELLKSSGYLNYRRHPRKHGILCHGDGGPSNFILNDEGTYLIDFETLRVDLRAYDLYRIIYNSCKDYQWDFSIAKAILDGYRQVAYLDKRDYKLMSAWLRSPFSTYLVVSGFKRIPFTMKRLRWALDSERRIGPFLEELDEYAASPSS
>NZ_CP018145.1|WP_088910426.1|5910947_5912111_-|cation:proton-antiporter
MLIFQLAVILIASKIAGDISVRLGQPSVLGKLLIGIVLGPTVLGLVTDTEILKEISQIGVILLMFIAGLETDIDEFKRTAKSSTSVGVAGIVVPLALGYGAGIAIGLSNIEAIFLGLLLSATSVSISVQTLKELGKLKSREGATIMGAAVIDDVLVILALAFLMSFAGGDVNLGMVVLKKVAFFAIVIVLSWKVVPWVLKKFAPLQVTESVISAALIICFLFAYFAEYTGVAAIIGSYIAGVAISLTNYKQEVTHKVETISYAVFVPVFFTSIGVTAQFSGLLENLGLIVLLSVIAIVSKLIGGAFGAKITGFPWKNSMAIGAAMVSRGEVALIIAAIGLENNLLTQDMFAVLIVVVLLTTIVTPPMMKMFFSRTSQPEGIALKKNA
>NZ_CP018145.1|WP_088910427.1|5912341_5912686_+|cupin-domain-containing-protein
MAKISKENAEHYHWGAQCDGWHLVKGQELSVIHERMPGNTAEVRHYHERSRQFFFVLSGQAMLEVDGVRHVINRQEGVEVSPGVKHQMKNEGAEDVEFLVISQPTTRGDRIQAD
>NZ_CP018145.1|WP_088910428.1|5912897_5913188_-|hypothetical-protein
MEDMLLLLFSLEDFFALVALFVGCFTSAFYFRQCCLQNRALPQNVTDMYRPSINTLLVETYPMAARQPQRLRLFRRLQHTDSEMDTYGSFVLDHVA
>NZ_CP018145.1|WP_088910429.1|5913286_5913700_-|Lrp/AsnC-family-transcriptional-regulator
MLDQIDLSILALLRKNSRLQWKDIGEQVHLSGQAVGNRIRRMEEQGIIQGYTTLIDEAKIASFLTALVTMFMTTTDHSLFTRFIKSRSEIVEAHRISGEGCYTMVVNVPNQEALNHFLDALLPFGNYRVNLSINKLK
>NZ_CP018145.1|WP_088910430.1|5913818_5914577_+|MBL-fold-metallo-hydrolase
MQIQLVRHATLRVKYAGLTFLVDPMFSSKGEMPAVPNTPNQRPNPGVELPISVEEVLAGVDALLVTHTHFDHLDEAAIRLLPKHLPVFCQPPDREKLVQHGFEQVIAIEEEHTWQGVHLHRTGGQHGTGEIGQLMGPVSGFVLERAGEPTLYVAGDTIWCEEVEQAIVEYRPDAIVVFAGAARFLTGDPITMTKEDIVHVANAAPDSDILVAHLETWNHCMLSRRELNECLQEKQLSGRVHVPEDGEIISFH
>NZ_CP018145.1|WP_007726169.1|5914727_5915321_+|helix-turn-helix-transcriptional-regulator
MAHEQLETYVVEKPEQAMALLNPLRAEILSRLAEPASAAEVARGINEIPQRVNYHLKALEKVGLVRRVGSRQVRNLVEVLYLAIARTYVLSEGLNWGNDTVQQMKDQGSLSHLVQTAERIKRDAMLLLERSDQEVEVPSASLNASIQLASAEQRSAFVEEYVQLVNQLVAKYQPKEKGQETYQVVLAVYPKQGGDEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP018145_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP018145_2

5991480-5991596

Orphan

Consensus_repeat	Method
CTGCGACTGAATTCGCAAGTGAAACAAATG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP018145_2

>merge|NZ_CP018145|2|5991480-5991596|CRISPRCasFinder
CTGCGACTGAATTCGCAAGTGAAACAAATGCAGCAGAGGTTCGTCGTCAGAACCAACAATCCGCACAACGCGCTGCTTCTCAAGGTGCTGCGACTGAATTCGCAAGTGAGACAAATG

>NZ_CP018145|2|2|5991480-5991596|CRISPRCasFinder
CTGCGACTGAATTCGCAAGTGAAACAAATG	CAGCAGAGGTTCGTCGTCAGAACCAACAATCCGCACAACGCGCTGCTTCTCAAGGTG
CTGCGACTGAATTCGCAAGTGAGACAAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP018145.1\|WP_088910496.1\|5994244_5995327_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_088910497.1\|5995511_5995952_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_088910501.1\|5999706_6000033_+\|anti-sigma-factor-antagonist	unknown	unknown	gnl\|CDD\|273042
NZ_CP018145.1\|WP_088910491.1\|5988331_5988934_+\|gluconate-2-dehydrogenase-subunit-3-family-protein	unknown	unknown	gnl\|CDD\|379295
NZ_CP018145.1\|WP_088911045.1\|5982921_5983350_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_088910492.1\|5988920_5990540_+\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP018145.1\|WP_088910488.1\|5983365_5985411_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP018145.1\|WP_048036208.1\|5982076_5982850_+\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224042
NZ_CP018145.1\|WP_088910500.1\|5998681_5999683_+\|PP2C-family-protein-serine/threonine-phosphatase	unknown	unknown	gnl\|CDD\|225118
NZ_CP018145.1\|WP_088910494.1\|5991818_5992205_+\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NZ_CP018145.1\|WP_088910490.1\|5987914_5988304_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP018145.1\|WP_088910495.1\|5992468_5993506_+\|outer-membrane-lipoprotein-sorting-protein	unknown	unknown	gnl\|CDD\|225390
NZ_CP018145.1\|WP_012684236.1\|5990993_5991245_-\|NrdH-redoxin	unknown	unknown	gnl\|CDD\|239274
NZ_CP018145.1\|WP_088910489.1\|5986487_5987780_+\|arsenic-transporter	unknown	unknown	gnl\|CDD\|185342
NZ_CP018145.1\|WP_088910498.1\|5995954_5997157_+\|alanine-racemase	unknown	unknown	gnl\|CDD\|143481
NZ_CP018145.1\|WP_005830205.1\|5997690_5998041_+\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	unknown	unknown	gnl\|CDD\|367091
NZ_CP018145.1\|WP_047074001.1\|5990636_5990972_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP018145.1\|WP_088910499.1\|5998247_5998676_+\|anti-sigma-regulatory-factor	unknown	unknown	gnl\|CDD\|340411
NZ_CP018145.1\|WP_007721089.1\|5997387_5997687_+\|CopG-family-ribbon-helix-helix-protein	unknown	unknown	gnl\|CDD\|223932
NZ_CP018145.1\|WP_012684227.1\|5985641_5986394_+\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224042

Protein	Function_ID	Function_description	E-value
NZ_CP018145.1\|WP_088910491.1\|5988331_5988934_+\|gluconate-2-dehydrogenase-subunit-3-family-protein	gnl\|CDD\|379295	pfam13618, Gluconate_2-dh3, Gluconate 2-dehydrogenase subunit 3. This family corresponds to subunit 3 of the Gluconate 2-dehydrogenase enzyme that catalyzes the conversion of gluconate to 2-dehydro-D-gluconate EC:1.1.99.3.	1.79377e-23
NZ_CP018145.1\|WP_088910501.1\|5999706_6000033_+\|anti-sigma-factor-antagonist	gnl\|CDD\|273042	TIGR00377, Anti-sigma_F_factor_antagonist, anti-anti-sigma factor. This superfamily includes small (105-125 residue) proteins related to SpoIIAA of Bacillus subtilis, an anti-anti-sigma factor. SpoIIAA can bind to and inhibit the anti-sigma F factor SpoIIAB. Also, it can be phosphorylated by SpoIIAB on a Ser residue at position 59 of the seed alignment. A similar arrangement is inferred for RsbV, an anti-anti-sigma factor for sigma B. This Ser is fairly well conserved within a motif resembling MXS[STA]G[VIL]X[VIL][VILF] among homologous known or predicted anti-anti-sigma factors. Regions similar to SpoIIAA and apparently homologous, but differing considerably near the phosphorlated Ser of SpoIIAA, appear in a single copy in several longer proteins. [Regulatory functions, Protein interactions].	3.34259e-24
NZ_CP018145.1\|WP_088910498.1\|5995954_5997157_+\|alanine-racemase	gnl\|CDD\|143481	cd00430, PLPDE_III_AR, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase. This family includes predominantly bacterial alanine racemases (AR), some serine racemases (SerRac), and putative bifunctional enzymes containing N-terminal UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (murF) and C-terminal AR domains. These proteins are fold type III PLP-dependent enzymes that play essential roles in peptidoglycan biosynthesis. AR catalyzes the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. SerRac converts L-serine into its D-enantiomer (D-serine) for peptidoglycan synthesis. murF catalyzes the addition of D-Ala-D-Ala to UDPMurNAc-tripeptide, the final step in the synthesis of the cytoplasmic precursor of bacterial cell wall peptidoglycan. Members of this family contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. AR and other members of this family require dimer formation and the presence of the PLP cofactor for catalytic activity. Fungal ARs and eukaryotic serine racemases, which are fold types I and II PLP-dependent enzymes respectively, are excluded from this family.	4.52641e-177
NZ_CP018145.1\|WP_088910488.1\|5983365_5985411_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.32927e-42
NZ_CP018145.1\|WP_048036208.1\|5982076_5982850_+\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224042	COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism].	4.84332e-172
NZ_CP018145.1\|WP_088910500.1\|5998681_5999683_+\|PP2C-family-protein-serine/threonine-phosphatase	gnl\|CDD\|225118	COG2208, RsbU, Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription].	1.04018e-59
NZ_CP018145.1\|WP_088910492.1\|5988920_5990540_+\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	3.49718e-72
NZ_CP018145.1\|WP_088910494.1\|5991818_5992205_+\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	2.05736e-43
NZ_CP018145.1\|WP_088910495.1\|5992468_5993506_+\|outer-membrane-lipoprotein-sorting-protein	gnl\|CDD\|225390	COG2834, LolA, Outer membrane lipoprotein-sorting protein [Cell envelope biogenesis, outer membrane].	1.96314e-25
NZ_CP018145.1\|WP_012684236.1\|5990993_5991245_-\|NrdH-redoxin	gnl\|CDD\|239274	cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, could be a mechanism for regulating the oxidation state of the protein.	1.9609e-14
NZ_CP018145.1\|WP_088910489.1\|5986487_5987780_+\|arsenic-transporter	gnl\|CDD\|185342	PRK15445, PRK15445, arsenical efflux pump membrane protein ArsB.	0
NZ_CP018145.1\|WP_088910499.1\|5998247_5998676_+\|anti-sigma-regulatory-factor	gnl\|CDD\|340411	cd16934, HATPase_RsbT-like, Histidine kinase-like ATPase domain of the anti sigma-B factor Bacillus subtilis serine/threonine-protein kinase RsbT, and related domains. This family includes the histidine kinase-like ATPase (HATPase) domain of Bacillus subtilis serine/threonine-protein kinase RsbT, a component of the stressosome signaling complex of Bacillus subtilis. The stressosome is formed from multiple copies of three proteins, a sensor protein RsbR, a scaffold protein RsbS, and RsbT, and responds to environmental changes by initiating a protein partner switching cascade. Stress perception increases the phosphorylation of RsbR and RsbS, by RsbT. Subsequent dissociation of RsbT from the stressosome activates the sigma-B cascade, leading to the release of the alternative sigma factor, sigma-B.	2.26698e-41
NZ_CP018145.1\|WP_005830205.1\|5997690_5998041_+\|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin	gnl\|CDD\|367091	pfam02452, PemK_toxin, PemK-like, MazF-like toxin of type II toxin-antitoxin system. PemK is a growth inhibitor in E. coli known to bind to the promoter region of the Pem operon, auto-regulating synthesis. This family represents the toxin molecule of a typical bacterial toxin-antitoxin system pairing. The family includes a number of different toxins, such as MazF, Kid, PemK, ChpA, ChpB and ChpAK.	7.47696e-41
NZ_CP018145.1\|WP_047074001.1\|5990636_5990972_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	8.51552e-21
NZ_CP018145.1\|WP_007721089.1\|5997387_5997687_+\|CopG-family-ribbon-helix-helix-protein	gnl\|CDD\|223932	COG0864, NikR, Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain [Transcription].	3.24091e-21
NZ_CP018145.1\|WP_012684227.1\|5985641_5986394_+\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224042	COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism].	2.59684e-175

>NZ_CP018145.1|WP_012684236.1|5990993_5991245_-|NrdH-redoxin
MAHKVIIYTQVTCGPCQEEKMWLTSNNIAFEDRDIRQNEAFFQEAIQLGASMTPVTYIEKENGEQIVIHGFDKEELKKALDLN
>NZ_CP018145.1|WP_047074001.1|5990636_5990972_+|winged-helix-turn-helix-transcriptional-regulator
MEMDLMQVLFLSETYKLLGDKTRLTIMALLQVQSLCVRDLVEILQTSQPSVSQHLAKLKTHGLVKERRKGPWVYYSVNTECSPEVKQILSNLPDMSPVVKQKSVASEPSFG
>NZ_CP018145.1|WP_088910492.1|5988920_5990540_+|GMC-family-oxidoreductase
MTSHDHHTITHRPTPVDQRKYADDADICIVGAGAAGGVLAYELAKAGLRVVVLEAGPFWDPQHDFASDELSMRRLAWQETRLVAGKDPLRLGHNNSGRGIGGGTVHFTGVFLRFHESDFKTKTVDGVGEDWPITYQDLAPYYDKIEREIAVSGPNHFPWGSFQGPYPYPVREPISANAQLFREGCDKLGIESVVAPLAILSGPFDGRPPCINRGFCNQGCMPNAKYSGLIHHIPKAIAEGAEVLSDCMVTEILMAGDRVSGVVFNHNGLTHRQMARVVILAGFVVETPRLLLSSANAQFPQGLANSSGWVGKAIMPHSSHDVYGRLPEEVRLYKGTPVLALTQHFYETDRERGFARGYTLSAHGVRPVGMAAAIAAEREDGSYLWGKQLRETMLDYNMYARITLVGEVLPHPDNRVTLSGEKDEYGMPIPTVTFSYQENDKQLYKHAIGQMNRIIEAMGGQLEHVVSDTAHLMGGCRMGNDRETSVVNEYGQSHDIPNLFIAGASTFVTSSGSNPTNTVMALAARTADKIIEAMKKQDV
>NZ_CP018145.1|WP_088910491.1|5988331_5988934_+|gluconate-2-dehydrogenase-subunit-3-family-protein
MEKPRRYPSYDVWDQHTEWDAHTRKVVGARRMPAVANQFFTKPESLLLQTVVGVLVNDHRLEVLTFVVEHLDNTTASNIGESQRKVGVPPKKELYRSGLKGIDAESHAAYGTDFVALKLDQQEAVLQHVANGGIQNQEAWKDFAPADFFKRLLHDTVSAYYSHPLVWSDIGYGGPAYPRGYVRVEKGLTDPWEAKANDES
>NZ_CP018145.1|WP_088910490.1|5987914_5988304_+|hypothetical-protein
MWYGWPIERVLILFTGLAFALIAVQVTLFHSRQNFRHWAMWIPVLELPVFAVTAIVLSFVNAGWLRWVFALMMVVGMAGGLYGAYLHTVGVGQRVGGYSQGQNFLVGPPVILPLLITAMSALGLLALFW
>NZ_CP018145.1|WP_088910489.1|5986487_5987780_+|arsenic-transporter
MVWISLFLFLITLTMVIWQPRGLSIGYPAVGGALLALAIGVVTIGDVAEVTSIVWNATLALVGIIIISLVLDEIGFFEWAALHMARFAKGNGRLMFVYVILLGSLVSALFTNDGAALILTPIVLAQVRALKLDGKTVLAFVMASGFIADTSSLPFVISNLVNIVSADYFDIGFAAYAAKMIIPTLFSIGGSLLVLYLYFRKSIPAQVDLSHLKNPEEAIRDRRMFRLAWPILAVLLIGFFISESIHTPVSIIIAGAAIIFCLAARKSEAIAMGRIMKEAPWVVVVFSIGMYVVVWGLHNAKLTDLVKDALDWFMGHGLLATTLGTGFLAAALSSVMNNLPTVMFNALAIAGTQADGVLREAMIYANVIGSDLGPKMTPIGSLATLLWLHVLGRKDVTITWGQYFRTGVILTVPTLTITLLGLYLTLVYFS
>NZ_CP018145.1|WP_012684227.1|5985641_5986394_+|phosphate-ABC-transporter-ATP-binding-protein
MSVISVRELNLFYGNKQALYHINLDVESDSITALIGPSGCGKSTFLRTLNRMNDSVPNTKITGTVKVFDEDIYSSRVEVERLRKNIGMVFQHPNPFPKSIYDNITYGPRLHGMNDRNKLDELVETSLKAAALWDEVKDVLKKPATGLSGGQQQRLCIARALAVQPQIILMDEPTSALDPISTAKIEELLEELKNRYTIVIVTHNMQQAARISDKTAFFLNGELVEFDSTPTIFQNPRDKRTEDYITGRFG
>NZ_CP018145.1|WP_088910488.1|5983365_5985411_-|methyl-accepting-chemotaxis-protein
MPDIRKLWGHSSFHYRSIFTRLFAGIMGMVVCMMAIAAFFISYQSEATLNEKTKQQLQEASGAALQKVNSRVYDIVTALQSFASTYKNSKITNSQIFGIFTDLSTSNPTISELQIVTTDGRYLTFPGSPLDSSYDPRKMDWYEGALNQPQQGVFVSDVFQFSETEFPKIAVSLPLRNEDEEPVGVVVAFVSVPKLSESIGQIKLGETGYAMIVDQQGKLVAHPDQSYALQRPLLSELAIVQNVIAGQSGYEPSRINGVDSFAAYQFDPSLKWGVIVLQSVSEVKQEVRRLQLTILAVSLFGLAALALMLYVYVRRIIKPIKEAQQKMSAFSEGDLLQTMHVQSNDEIRQLADSFNRMSEQIRTIIGKIQYVISDVKQVADHVGKGSRHSHAMQSEVVTVTERLAQEMDNQQEQIDDIHATMADITQEMSRITDSMEKAIVQSRESRQQNAKAATSIDLLKENMQHISEDMQASMHAMSSMRESMSDINEMLGLISAISKRTKLLSFNARIEASRAGQAGVGFSVVADEIRLLSDQTEEASARIQKVIESGEERMEHVAACLQTTDHATVNGIQTLHQAASIFHNTIQLSEALTAQFESIRMLTGTISTQSQAISQRVDNLSASAQQVVSGTQQAVAANQESLSLSEQFLDDSLRLTEIVEDLEQTIKFFRAGETTPCLKNS
>NZ_CP018145.1|WP_088911045.1|5982921_5983350_-|hypothetical-protein
MNFTQTYPMKGDVWTLDKRSIHFYVIALIVLLAMSLLTFVKVFVHSHYLRYLFVAIFFVGLIVGYVRYLMKVKSENMQHQSKWYKYGFLLAFAIIYMAIKYGVKAVVGYEASSEDYGTVIAFFFLGLFISYYGLYTRYLRKS
>NZ_CP018145.1|WP_048036208.1|5982076_5982850_+|phosphate-ABC-transporter-ATP-binding-protein
MSVLTMQETIIQTNNVNVYYGEKHAVKNISMDIERNSVTAFIGPSGCGKSTLLRSLNRMNDLVPSCRVEGSIIVDGIDINSSQVNIESLRQVVGMVFQRANPFFKSIYENIAFAPRFHGMTNKRDLDELVESSLRKAALWDEVKDRLRDSALSLSGGQQQRLCIARAIAMQPTILLLDEPASALDPISTMKIEELVMQLKDEYTIVIVTHNLHQAARISEKTAFFLMGELIEMDETGKIFTSPENEKTEAYISGRFG
>NZ_CP018145.1|WP_088910494.1|5991818_5992205_+|holo-ACP-synthase
MIIGTGVDIVEIERIAILIKRQERAIKHFLTTDEQQLLQGKAETRQAEMVAGRFAAKEAGAKALGTGIGAVLSFLDMEILPNHSGKPVMTIKNEVYSKLDLDPARVHIHVSISHSQTHAIAQVIVEER
>NZ_CP018145.1|WP_088910495.1|5992468_5993506_+|outer-membrane-lipoprotein-sorting-protein
MKRVALPLVLLLVFTLFLGGCFGQKTPEDVVSDLNGALGKMTGYKSQAVLTMQTGSTPMEYDVQVWYEKPTNYRVALTSKQRGITQIILRNNEGVFVLTPHLNKSFRFQSGWPENNGPLYLYETLAKSIIDDTERQMKMEEKQYVFEVKANYSGNRSLTKQKIWLTEDFKPTHAEIMDASMNPLVRIDFTDFSFNPIFDKDAFDKERNMTTSSLATIPTMAQTNGQVVKQPNSQFGVIVPTYMPEGVTQGDIEPVTRDGERKVILTYKGTYNYKVIEGRPTAASVSYEQGMPVNLGFTVGVLAQTGENQRLLTWELDGIEYTIAGDLPEEEMVNVAQSTYGLSAK
>NZ_CP018145.1|WP_088910496.1|5994244_5995327_+|hypothetical-protein
MFSKTKMGMLMGTMAVVLSLGSIGGAMAADSAKPTSLNKPAEVKFKTGKMGHHGGVDFKENTELLSLLKLDAGKLKEELAAGKTLAAIAQAQGVDTADVVALLVDQQEAKLKEAVAAGKLTQEQADKLSENLSNRVKEQVENTKPDKGFGKGGFIGGFEKNEELLSLLKLDADKLQEELKADKSLSAIAEAQGVSVDDLVALLVKQQEAKLREAVTAGKLTQEQADKMNENASERVKEMVQNTHHGRGPGKGMGIEKNEELLSLLKLDADKLKEEQKAGKSLATIAKEQGVEVDDVIELLVGQHETKLKEAVEAGKLTQEQADKRSEELTAMVQKMVDGSFEKVVFPRHEKEEKNQEDTM
>NZ_CP018145.1|WP_088910497.1|5995511_5995952_+|hypothetical-protein
MKKPSNEVLYQEASTYKDMLLRKSWKMRINETVMFVLGMMILSQFFPTNDTRFKVLVFAIAIAVVGLSPFMYKSVLRPVYKLTKTHLIISMSGQEKSYPLSEVEQIYEGRHFYRVGGKKESLMVSRQFLSHLNERLFYYKKGNKRR
>NZ_CP018145.1|WP_088910498.1|5995954_5997157_+|alanine-racemase
MKSFCRDTWVEVDLDAIRANLETFKRHLPEKTGIMAVVKADGYGHGAVHVGKEALASGADSLAVALLDEATILRRAGITAPILVLGYTPVESIVTASELEVQLTAYSVEWITEANDILQKNDHKPVGIHVKTDTGMGRLGVRTKEDLLAVVGALEECSKLEWTGIFTHFACADEPDTTHVRRQHDLFQSFLQVLREANKTLPTVHCCNTAAAIAFPDWGYDTIRLGIGLYGLYPSLYMKERADVILAPVLALKTRIAQVKKADEPFTVSYGATYAAQPDEWIATLPIGYADGYSRLLSNRGEVLYNGSRYPIAGRVCMDQIMVSLNSTEAAVNDEVVLYGKQGDEEISLDEIADLLGTINYEVPCMLNYRIPRLYLRDQKVTDVFHPLTMKHSSHENVKN
>NZ_CP018145.1|WP_007721089.1|5997387_5997687_+|CopG-family-ribbon-helix-helix-protein
MVGGGFVLSKSNTKRIMISLPQHLLQEVDGVIQKEKSNRSEFIRQAMHLYLKERKKRTIRETMQKGYMEMAKINLNMASEAFGAEEEADHTLVRLVSGV
>NZ_CP018145.1|WP_005830205.1|5997690_5998041_+|type-II-toxin-antitoxin-system-PemK/MazF-family-toxin
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQIRTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
>NZ_CP018145.1|WP_088910499.1|5998247_5998676_+|anti-sigma-regulatory-factor
MVVADYSPETINIEQESDIVTARQVGRNMSKLFGFGTITQSRIATSISELARNIYLYAGTGTITISPIEREGVIGLQITANDSGPGIPDIRQALDDGYSTSGALGAGLPGVRRMMDEFEIHSTLGEGTRVIVVKWSDQAKEE
>NZ_CP018145.1|WP_088910500.1|5998681_5999683_+|PP2C-family-protein-serine/threonine-phosphatase
MVTRSFQEEYVKILRDYLSAQGEDQLYGAQQLGKWMLSRDISPEEITDLHAQALEQLGEVPEFVRSSFSILTEVMIEYGNEHRSVNSWRNRHQQMESEIAVAKAMQQSLLPSEVPVYPELEIGVVSIAAKQISGDYYDFIEQTEGRFGVAIADITGKGMPAAMCMSMVKYAIDSLGQLELGPDEMLHHLNRIVGRNIDPSMFVTMLFGSYDSKEHCFRYAMAGHEPGFLYRSAEGKFYDLEGRGNALGLCPNSEYEVQEIRLERNDVLILLTDGVTECKNNRYYLQREELVHHLQKEVGNSAQKMANGLYNRLLLLSQFDLLDDYTMIVLRRT
>NZ_CP018145.1|WP_088910501.1|5999706_6000033_+|anti-sigma-factor-antagonist
MDLLIKTTSLETEHRVVLGGDIDAFTAPKVKETLMSLVTKPDINHITVDLEAVEYMDSTGIGIFIGIMKECIQRNCTFEVHKLSPRVERLFRITGLYDHIAIRKGESE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2669435 : 2757468

102

Brevibacillus_phage(29.41%)

tRNA,tail,plate,head,portal,protease,holin,integrase,transposase,terminase,capsid

attL 2703171:2703203|attR 2745166:2745198

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157696764.1\|2669435_2670875_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_088907945.1\|2670816_2671584_-	hypothetical protein	NA	NA	NA	NA
WP_088907946.1\|2671599_2672967_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_088907947.1\|2673212_2674103_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007718970.1\|2674805_2675069_+	hypothetical protein	NA	NA	NA	NA
WP_088907948.1\|2675227_2675866_+	FusB/FusC family EF-G-binding protein	NA	NA	NA	NA
WP_088907949.1\|2675928_2676444_-	ATPase	NA	NA	NA	NA
WP_088907950.1\|2676475_2676820_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088910929.1\|2676992_2677973_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_088907951.1\|2678068_2678575_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_157696765.1\|2679874_2680012_+	hypothetical protein	NA	NA	NA	NA
WP_083995000.1\|2681495_2681582_+	sporulation protein YjcZ	NA	NA	NA	NA
WP_088907954.1\|2682091_2682574_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088907955.1\|2683110_2684103_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088907956.1\|2685260_2686292_-	Cfr family 23S rRNA (adenine(2503)-C(8))-methyltransferase	NA	NA	NA	NA
WP_088907957.1\|2688493_2688910_+	hypothetical protein	NA	NA	NA	NA
WP_088907958.1\|2689371_2689674_+	hypothetical protein	NA	NA	NA	NA
WP_088907959.1\|2690012_2690960_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_088907960.1\|2691323_2691962_+	flavin reductase family protein	NA	NA	NA	NA
WP_157696766.1\|2691964_2692108_-	hypothetical protein	NA	NA	NA	NA
WP_088907961.1\|2692212_2693010_+	putative protein N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_088907963.1\|2694196_2694574_-	PH domain-containing protein	A6N235	Microbacterium_phage	1.8e-13	34.6
WP_167385087.1\|2695004_2695208_-	hypothetical protein	NA	NA	NA	NA
WP_088907964.1\|2695363_2695846_-	hypothetical protein	NA	NA	NA	NA
WP_088907966.1\|2696810_2697113_+	hypothetical protein	NA	NA	NA	NA
WP_088907967.1\|2697689_2698199_+	hypothetical protein	NA	NA	NA	NA
WP_157696767.1\|2698341_2698491_-	hypothetical protein	NA	NA	NA	NA
WP_088907968.1\|2699067_2699376_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_088907969.1\|2699580_2699892_-	WGxxGxxG-CTERM domain-containing protein	NA	NA	NA	NA
WP_088907970.1\|2700702_2701248_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088907971.1\|2702023_2702848_+	hypothetical protein	NA	NA	NA	NA
2703171:2703203	attL	NA	NA	NA	NA
WP_088907972.1\|2703284_2703614_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_088910930.1\|2704612_2704957_+	hypothetical protein	NA	NA	NA	NA
WP_088907973.1\|2705344_2706031_-	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	1.2e-66	77.9
WP_088907974.1\|2706030_2706318_-\|holin	holin	NA	NA	NA	NA
WP_088907975.1\|2706314_2706680_-	hypothetical protein	NA	NA	NA	NA
WP_088907976.1\|2706847_2708182_-	hypothetical protein	NA	NA	NA	NA
WP_088907977.1\|2708199_2708742_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_088907978.1\|2708734_2709793_-\|plate	baseplate J/gp47 family protein	A0A0A7RUN3	Clostridium_phage	1.3e-59	41.0
WP_088907979.1\|2709792_2710098_-	hypothetical protein	NA	NA	NA	NA
WP_088907980.1\|2710097_2710535_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_088910931.1\|2710531_2710969_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_088907981.1\|2711007_2712024_-	hypothetical protein	NA	NA	NA	NA
WP_088910932.1\|2712028_2712442_-	hypothetical protein	A0A2H4J2N2	uncultured_Caudovirales_phage	3.5e-10	36.3
WP_088907982.1\|2712462_2714283_-	tape measure protein	M1HMP3	Bacillus_virus	1.6e-30	33.8
WP_088907983.1\|2714496_2714886_-	hypothetical protein	NA	NA	NA	NA
WP_088907984.1\|2714912_2715344_-\|tail	phage tail tube protein	A0A0A8WF55	Clostridium_phage	7.7e-16	38.5
WP_088907985.1\|2715363_2716422_-\|tail	phage tail sheath protein	A0A0A8WJL8	Clostridium_phage	7.8e-70	45.8
WP_088907986.1\|2716434_2716857_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_088907987.1\|2716849_2717284_-	hypothetical protein	NA	NA	NA	NA
WP_088907988.1\|2717285_2717609_-\|head	phage head closure protein	A0A286S2A2	Klebsiella_phage	1.4e-06	40.5
WP_088907989.1\|2717605_2717902_-\|head,tail	phage gp6-like head-tail connector protein	A0A2I7SBZ6	Paenibacillus_phage	2.6e-23	57.4
WP_088907990.1\|2717882_2718230_-	hypothetical protein	NA	NA	NA	NA
WP_088907991.1\|2718287_2719475_-\|capsid	phage major capsid protein	A0A2I7SBY4	Paenibacillus_phage	9.5e-141	65.3
WP_088910934.1\|2719511_2720093_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	3.9e-87	83.1
WP_088910933.1\|2720076_2721390_-\|portal	phage portal protein	A0A2I7SBY0	Paenibacillus_phage	1.1e-195	75.2
WP_088907992.1\|2721447_2723043_-\|terminase	terminase large subunit	A0A2I7SBY8	Paenibacillus_phage	5.2e-267	80.0
WP_088907993.1\|2723032_2723641_-\|terminase	terminase	A0A2I7SBY3	Paenibacillus_phage	1.6e-91	84.1
WP_088907994.1\|2723660_2724176_-	hypothetical protein	A0A2H4J6F5	uncultured_Caudovirales_phage	3.0e-22	40.8
WP_088910935.1\|2724268_2724661_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	8.8e-35	56.2
WP_088907995.1\|2724795_2725335_-	hypothetical protein	S5MNT8	Brevibacillus_phage	1.6e-42	51.4
WP_157696768.1\|2725380_2726625_-	DEAD/DEAH box helicase	A0A2I7QIK9	Bacillus_phage	1.8e-166	68.9
WP_088907996.1\|2726757_2727261_-	HNH endonuclease	A0A2I7QIM4	Bacillus_phage	2.4e-21	39.2
WP_088907997.1\|2727250_2727538_-	VRR-NUC domain-containing protein	S5MUC8	Brevibacillus_phage	1.3e-19	57.5
WP_088907998.1\|2727530_2727770_-	hypothetical protein	NA	NA	NA	NA
WP_088907999.1\|2728054_2730397_-	virulence protein E	S5M5Y2	Brevibacillus_phage	2.2e-298	62.6
WP_088908000.1\|2730436_2730808_-	hypothetical protein	A0A0A0YSW1	Flavobacterium_phage	2.4e-10	32.8
WP_088908001.1\|2730826_2731060_-	hypothetical protein	NA	NA	NA	NA
WP_088908002.1\|2731096_2731474_-	hypothetical protein	NA	NA	NA	NA
WP_088908003.1\|2731819_2732125_+	hypothetical protein	NA	NA	NA	NA
WP_088908004.1\|2732242_2732788_+	DUF218 domain-containing protein	NA	NA	NA	NA
WP_088908005.1\|2732875_2733268_+	hypothetical protein	NA	NA	NA	NA
WP_088908006.1\|2733281_2733464_-	hypothetical protein	NA	NA	NA	NA
WP_088908007.1\|2733552_2733735_+	hypothetical protein	NA	NA	NA	NA
WP_088908008.1\|2733829_2735788_-	DNA polymerase	S5M5X4	Brevibacillus_phage	2.0e-220	58.7
WP_088910936.1\|2736066_2736660_-	DUF2815 family protein	A0A2I7QIM8	Bacillus_phage	1.6e-67	69.4
WP_088908010.1\|2736835_2738032_-	DUF2800 domain-containing protein	S5MUB5	Brevibacillus_phage	6.7e-110	54.2
WP_088908011.1\|2738028_2738481_-	hypothetical protein	NA	NA	NA	NA
WP_088908012.1\|2738753_2738933_-	hypothetical protein	NA	NA	NA	NA
WP_088908013.1\|2738972_2739203_-	hypothetical protein	A0A0K2CZM7	Paenibacillus_phage	4.5e-07	48.1
WP_157696770.1\|2739199_2739496_-	hypothetical protein	NA	NA	NA	NA
WP_088910937.1\|2739611_2739848_-	group-specific protein	S5MC08	Brevibacillus_phage	1.8e-27	65.8
WP_088908015.1\|2739941_2740187_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088908016.1\|2740356_2740692_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088908017.1\|2741309_2742536_-	transcriptional regulator	S5MC02	Brevibacillus_phage	5.2e-49	30.0
WP_088908018.1\|2742754_2743564_-	helix-turn-helix domain-containing protein	S5M5V5	Brevibacillus_phage	3.0e-85	62.2
WP_088908019.1\|2743765_2743975_+	helix-turn-helix domain-containing protein	S5MNP8	Brevibacillus_phage	6.8e-18	59.4
WP_088908020.1\|2744031_2745165_+\|integrase	site-specific integrase	A0A0S2SXP1	Bacillus_phage	9.6e-66	67.8
WP_088908021.1\|2745270_2746605_-	type I glutamate--ammonia ligase	A0A1V0SJ53	Klosneuvirus	9.7e-09	26.3
2745166:2745198	attR	NA	NA	NA	NA
WP_007719086.1\|2746640_2747051_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_088908022.1\|2747219_2748497_-	methionine gamma-lyase family protein	NA	NA	NA	NA
WP_088910938.1\|2748504_2749797_-	GTPase HflX	NA	NA	NA	NA
WP_088908023.1\|2749882_2750800_-	RNA ligase family protein	U5J9W3	Bacillus_phage	1.8e-91	57.8
WP_088908024.1\|2750898_2751195_-	hypothetical protein	NA	NA	NA	NA
WP_088908025.1\|2751339_2752290_+	AAA family ATPase	G3MAX6	Bacillus_virus	1.2e-58	46.4
WP_088908026.1\|2752349_2753102_-	DUF4184 family protein	NA	NA	NA	NA
WP_088908027.1\|2753123_2753609_-	translation initiation factor IF-3	NA	NA	NA	NA
WP_167385169.1\|2753860_2754277_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_088908029.1\|2754324_2755557_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_088908030.1\|2755669_2756101_+	VOC family protein	NA	NA	NA	NA
WP_007719110.1\|2756239_2756479_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_088908031.1\|2756508_2757468_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA

DBSCAN-SWA_2

2874968 : 2934930

Bacillus_phage(26.92%)

tRNA,tail,portal,protease,capsid,holin,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088908113.1\|2874968_2876390_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	1.3e-40	26.5
WP_015891764.1\|2876386_2876929_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_088908114.1\|2876944_2877886_-	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	4.3e-35	32.2
WP_088908115.1\|2877947_2879261_-\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_088908116.1\|2879300_2881379_-	type I DNA topoisomerase	A0A1V0SB35	Catovirus	5.6e-104	36.1
WP_088908117.1\|2881485_2882604_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_015891769.1\|2882738_2883641_-	succinate--CoA ligase subunit alpha	NA	NA	NA	NA
WP_016743310.1\|2883794_2884955_-	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_088908118.1\|2885141_2886197_-	hypothetical protein	NA	NA	NA	NA
WP_088908119.1\|2886233_2887127_-	ATP-binding protein	NA	NA	NA	NA
WP_088908120.1\|2887211_2887550_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_088908121.1\|2887621_2887936_-	YbjQ family protein	NA	NA	NA	NA
WP_088908122.1\|2888059_2888872_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_017249346.1\|2888868_2889225_-	hypothetical protein	NA	NA	NA	NA
WP_088908123.1\|2889254_2889977_-	EAL domain-containing protein	NA	NA	NA	NA
WP_088908124.1\|2890470_2890779_+\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA
WP_157696841.1\|2891400_2891550_+	hypothetical protein	NA	NA	NA	NA
WP_088908126.1\|2891674_2891950_+	hypothetical protein	NA	NA	NA	NA
WP_088910941.1\|2892791_2893055_+	helix-turn-helix transcriptional regulator	A0A0K2CYN0	Paenibacillus_phage	1.9e-09	36.4
WP_088908127.1\|2893205_2893760_-	hypothetical protein	NA	NA	NA	NA
WP_088908128.1\|2893848_2895300_-	hypothetical protein	NA	NA	NA	NA
WP_088908129.1\|2895463_2895931_-	hypothetical protein	NA	NA	NA	NA
WP_088908130.1\|2895937_2896213_-	hypothetical protein	NA	NA	NA	NA
WP_088908132.1\|2897013_2897397_+	hypothetical protein	NA	NA	NA	NA
WP_088908133.1\|2897446_2897887_-	hypothetical protein	NA	NA	NA	NA
WP_167385088.1\|2898014_2898230_-	hypothetical protein	NA	NA	NA	NA
WP_088908134.1\|2898172_2898505_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_088908135.1\|2898799_2899210_+	oxidoreductase	NA	NA	NA	NA
WP_167385122.1\|2899568_2899739_+	hypothetical protein	NA	NA	NA	NA
WP_088910942.1\|2901562_2901835_+	helix-turn-helix transcriptional regulator	A0A0K2CYN0	Paenibacillus_phage	2.7e-11	41.7
WP_088908138.1\|2902243_2903611_+	helix-turn-helix transcriptional regulator	A0A0K2CP77	Brevibacillus_phage	5.7e-97	43.2
WP_088908139.1\|2903876_2904179_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_088908140.1\|2904419_2905004_+	hypothetical protein	NA	NA	NA	NA
WP_088908141.1\|2905070_2905865_+	hypothetical protein	NA	NA	NA	NA
WP_088908142.1\|2905919_2906381_+	hypothetical protein	NA	NA	NA	NA
WP_157696771.1\|2906502_2906655_-	hypothetical protein	NA	NA	NA	NA
WP_088908143.1\|2906660_2907467_-	N-acetylmuramoyl-L-alanine amidase	A0A0M4S688	Bacillus_phage	1.7e-32	53.9
WP_088908144.1\|2907469_2907928_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_167385123.1\|2908025_2908178_-	hypothetical protein	NA	NA	NA	NA
WP_157696772.1\|2908174_2908339_-	hypothetical protein	NA	NA	NA	NA
WP_088908145.1\|2908354_2911675_-	hypothetical protein	S5M9X7	Brevibacillus_phage	5.6e-13	50.7
WP_088908146.1\|2911690_2912023_-	hypothetical protein	NA	NA	NA	NA
WP_088908147.1\|2912036_2913158_-	hypothetical protein	F8WQ05	Bacillus_phage	8.6e-51	31.7
WP_088908148.1\|2913160_2915233_-	DUF4815 domain-containing protein	F8WQ05	Bacillus_phage	2.9e-129	36.3
WP_088910943.1\|2915245_2915737_-	hypothetical protein	A0A110A292	Bacillus_phage	2.2e-14	33.3
WP_088908149.1\|2916501_2917242_-	hypothetical protein	NA	NA	NA	NA
WP_088908150.1\|2917213_2917687_-	DUF2634 domain-containing protein	A0A2H4J4Q8	uncultured_Caudovirales_phage	3.2e-07	29.4
WP_088908151.1\|2917683_2917962_-	DUF2577 family protein	NA	NA	NA	NA
WP_088908152.1\|2917973_2918954_-	hypothetical protein	A0A249XXF8	Clostridium_phage	1.7e-10	21.4
WP_088908153.1\|2918959_2919400_-	hypothetical protein	NA	NA	NA	NA
WP_088908154.1\|2919432_2922072_-	hypothetical protein	A0A2H4ET74	Aeromonas_phage	1.4e-06	61.9
WP_088908155.1\|2922281_2922698_-	hypothetical protein	NA	NA	NA	NA
WP_157696773.1\|2922723_2923119_-\|terminase	terminase	NA	NA	NA	NA
WP_088908157.1\|2923186_2924263_-\|tail	phage tail sheath protein	A0A0A7S0D2	Clostridium_phage	2.7e-62	39.6
WP_088908158.1\|2924265_2924700_-	hypothetical protein	NA	NA	NA	NA
WP_088908159.1\|2924696_2925092_-	HK97 gp10 family phage protein	A0A0A7RVN8	Clostridium_phage	5.8e-18	37.7
WP_088908160.1\|2925091_2925454_-	hypothetical protein	A0A090EUC2	Clostridium_phage	5.9e-09	33.6
WP_088908161.1\|2925450_2925771_-	hypothetical protein	A0A0A7RTF6	Clostridium_phage	1.7e-07	31.5
WP_157696774.1\|2925802_2925976_-	hypothetical protein	NA	NA	NA	NA
WP_088908162.1\|2925975_2927064_-	DUF5309 family protein	A0A2H4J2M3	uncultured_Caudovirales_phage	5.9e-97	50.7
WP_088908163.1\|2927079_2927766_-	DUF4355 domain-containing protein	A0A1L2K2N1	Aeribacillus_phage	4.5e-42	49.2
WP_088908164.1\|2927859_2928885_-\|capsid	minor capsid protein	A0A090D822	Clostridium_phage	9.3e-68	40.4
WP_088910944.1\|2928881_2930282_-\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	4.1e-119	50.4
WP_157696775.1\|2930303_2931515_-\|terminase	PBSX family phage terminase large subunit	A0A1J0MC16	Streptomyces_phage	5.3e-46	31.7
WP_088908166.1\|2931504_2932455_-\|terminase	terminase	A0A1B1P7C9	Bacillus_phage	2.4e-33	39.9
WP_088908167.1\|2932961_2933198_-	hypothetical protein	NA	NA	NA	NA
WP_088908168.1\|2933333_2934377_-	DNA cytosine methyltransferase	A0A1B1P7C6	Bacillus_phage	3.6e-128	63.9
WP_088908169.1\|2934363_2934930_-	ParB N-terminal domain-containing protein	A0A1B1P7B5	Bacillus_phage	2.1e-53	59.6

DBSCAN-SWA_3

2945836 : 2954420

Clostridium_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167385124.1\|2945836_2945995_-	hypothetical protein	A0A2H4J977	uncultured_Caudovirales_phage	6.5e-05	45.8
WP_088908185.1\|2945991_2946201_-	hypothetical protein	NA	NA	NA	NA
WP_088910946.1\|2946188_2947586_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.3e-104	47.6
WP_157696778.1\|2947608_2948460_-	ATP-binding protein	A0A075KJB7	Lactobacillus_phage	1.1e-08	27.5
WP_088908187.1\|2948392_2949400_-	hypothetical protein	S5MUL0	Brevibacillus_phage	2.3e-26	43.0
WP_167385170.1\|2949419_2950154_-	hypothetical protein	A0A0A7RVR3	Clostridium_phage	1.3e-60	46.5
WP_167385171.1\|2950170_2951025_-	hypothetical protein	A0A0A7S0A9	Clostridium_phage	2.9e-91	64.8
WP_088908190.1\|2951481_2951703_-	hypothetical protein	NA	NA	NA	NA
WP_088908191.1\|2951686_2951950_-	hypothetical protein	NA	NA	NA	NA
WP_088908192.1\|2951999_2952431_-	hypothetical protein	NA	NA	NA	NA
WP_088908193.1\|2952423_2952975_-	hypothetical protein	NA	NA	NA	NA
WP_167385125.1\|2953414_2953573_-	hypothetical protein	NA	NA	NA	NA
WP_088908194.1\|2953585_2953840_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088908195.1\|2954018_2954420_+	helix-turn-helix transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	4.1e-11	39.1

DBSCAN-SWA_4

3119231 : 3127583

Arthrobacter_phage(50.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088908334.1\|3119231_3120731_-	glucose-6-phosphate dehydrogenase	M4SP85	Cyanophage	1.0e-78	36.9
WP_088908335.1\|3120829_3121450_-	arylformamidase	NA	NA	NA	NA
WP_088908336.1\|3121586_3122765_-	AAA family ATPase	R4TQL5	Phaeocystis_globosa_virus	7.5e-13	28.4
WP_088908337.1\|3122947_3123472_-\|tail	phage tail protein	A0A222ZG41	Arthrobacter_phage	7.2e-16	34.9
WP_088908338.1\|3123487_3123997_-\|tail	phage tail protein	A0A221J6G5	Arthrobacter_phage	7.4e-18	38.0
WP_088908339.1\|3124024_3124540_-\|tail	phage tail protein	A0A222ZG41	Arthrobacter_phage	8.6e-22	39.6
WP_088908340.1\|3124594_3125071_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007728447.1\|3125399_3125717_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088908341.1\|3125816_3126914_+	saccharopine dehydrogenase	NA	NA	NA	NA
WP_088908342.1\|3126947_3127583_-	orotate phosphoribosyltransferase	S4W4D9	Pandoravirus	3.5e-25	35.7

DBSCAN-SWA_5

3449333 : 3490863

Paenibacillus_phage(21.21%)

tail,plate,head,portal,protease,holin,integrase,terminase,capsid

attL 3445303:3445349|attR 3489721:3489767

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3445303:3445349	attL	NA	NA	NA	NA
WP_088908561.1\|3449333_3449792_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_088908562.1\|3449995_3451330_-	hypothetical protein	S6B1J7	Thermus_phage	1.2e-06	33.1
WP_088907977.1\|3451347_3451890_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_088908563.1\|3451882_3452941_-\|plate	baseplate J/gp47 family protein	A0A0A7RUN3	Clostridium_phage	4.0e-58	40.0
WP_088908564.1\|3452912_3453245_-	hypothetical protein	NA	NA	NA	NA
WP_088908565.1\|3453244_3453682_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_088910962.1\|3453678_3454116_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_088908566.1\|3454154_3455171_-	hypothetical protein	NA	NA	NA	NA
WP_088910963.1\|3455175_3455589_-	hypothetical protein	A0A2H4J2N2	uncultured_Caudovirales_phage	1.1e-11	37.0
WP_088908567.1\|3455609_3457430_-	tape measure protein	M1HMP3	Bacillus_virus	1.6e-30	34.1
WP_088908568.1\|3457643_3458033_-	hypothetical protein	NA	NA	NA	NA
WP_088908569.1\|3458059_3458494_-\|tail	phage tail tube protein	A0A0K2SUB8	Clostridium_phage	1.1e-17	42.3
WP_088908570.1\|3458510_3459572_-\|tail	phage tail sheath protein	A0A0A8WJL8	Clostridium_phage	1.5e-68	45.6
WP_088907986.1\|3459584_3460007_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_088908571.1\|3459999_3460434_-	hypothetical protein	NA	NA	NA	NA
WP_088908572.1\|3460435_3460759_-\|head	phage head closure protein	A0A286S2A2	Klebsiella_phage	3.7e-07	34.7
WP_088908573.1\|3460755_3461052_-\|head,tail	phage gp6-like head-tail connector protein	A0A2I7SBZ6	Paenibacillus_phage	2.8e-25	61.7
WP_088908574.1\|3461032_3461380_-	hypothetical protein	NA	NA	NA	NA
WP_088908575.1\|3461437_3462625_-\|capsid	phage major capsid protein	A0A2I7SBY4	Paenibacillus_phage	3.3e-141	65.6
WP_088908576.1\|3462661_3463243_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	1.9e-86	83.1
WP_167385173.1\|3463226_3464549_-\|portal	phage portal protein	A0A2I7SBY0	Paenibacillus_phage	7.7e-208	79.2
WP_088908577.1\|3464625_3465438_-	short-chain dehydrogenase	NA	NA	NA	NA
WP_088908578.1\|3465499_3467107_-\|terminase	terminase large subunit	A0A2I7SBY8	Paenibacillus_phage	1.2e-266	80.2
WP_088908579.1\|3467096_3467705_-\|terminase	terminase	A0A2I7SBY3	Paenibacillus_phage	9.3e-92	83.6
WP_088910965.1\|3468061_3468478_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	5.1e-33	52.3
WP_088908581.1\|3468611_3469157_-	hypothetical protein	S5MNT8	Brevibacillus_phage	3.4e-37	49.2
WP_088908582.1\|3469203_3470562_-	DEAD/DEAH box helicase	S5MA26	Brevibacillus_phage	6.6e-146	55.4
WP_088908583.1\|3470558_3470849_-	VRR-NUC domain-containing protein	A0A1L6BZE4	Pasteurella_phage	6.7e-16	46.0
WP_088908584.1\|3471128_3473525_-	virulence-associated protein E	A0A0A7RTG3	Clostridium_phage	8.7e-210	46.3
WP_088908585.1\|3473634_3474300_+	hypothetical protein	NA	NA	NA	NA
WP_088908586.1\|3474307_3475150_-	DUF3102 domain-containing protein	A0A2H4J025	uncultured_Caudovirales_phage	2.6e-23	35.6
WP_088908587.1\|3475146_3476712_-	PcfJ family protein	A0A2H4J308	uncultured_Caudovirales_phage	4.0e-22	44.7
WP_088908588.1\|3476724_3477093_-	hypothetical protein	A0A2H4J073	uncultured_Caudovirales_phage	2.6e-20	45.9
WP_088910966.1\|3477191_3477470_-	DUF3310 domain-containing protein	E2GLY2	Acinetobacter_phage	3.7e-11	53.3
WP_088908589.1\|3477995_3479969_-	DNA polymerase	H7BVQ1	unidentified_phage	2.4e-229	59.2
WP_088908590.1\|3479972_3480797_-	DUF2815 family protein	W8CPL2	Croceibacter_phage	3.3e-39	48.9
WP_088908591.1\|3480789_3481998_-	DUF2800 domain-containing protein	H7BVP9	unidentified_phage	1.5e-93	49.0
WP_088908592.1\|3481994_3482492_-	hypothetical protein	NA	NA	NA	NA
WP_088908593.1\|3482585_3482843_-	hypothetical protein	NA	NA	NA	NA
WP_088908594.1\|3483017_3483245_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	S5MA41	Brevibacillus_phage	4.4e-23	62.7
WP_088908595.1\|3483308_3483563_-	hypothetical protein	A0A0K2CZM7	Paenibacillus_phage	7.0e-09	45.3
WP_088908596.1\|3483603_3483936_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_088908597.1\|3484191_3484464_-	helix-turn-helix domain-containing protein	B3RH39	Bacillus_virus	3.1e-07	45.5
WP_088908598.1\|3484683_3485058_+	helix-turn-helix transcriptional regulator	A6XML9	Bacillus_virus	2.2e-06	34.7
WP_157696783.1\|3485436_3485598_-	hypothetical protein	NA	NA	NA	NA
WP_088908599.1\|3485624_3486881_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157696784.1\|3487205_3487856_-	hypothetical protein	S5M5V5	Brevibacillus_phage	4.8e-78	67.4
WP_088908601.1\|3488168_3488378_+	helix-turn-helix transcriptional regulator	S5MNP8	Brevibacillus_phage	2.7e-22	66.7
WP_088908602.1\|3488390_3489605_+\|integrase	site-specific integrase	S5MNZ2	Brevibacillus_phage	2.9e-113	52.9
WP_088908603.1\|3490269_3490863_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.2e-36	48.8
3489721:3489767	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4292034 : 4350656

Staphylococcus_phage(30.77%)

protease,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157696844.1\|4292034_4292928_+\|transposase	IS3 family transposase	A0A0C5AEA5	Paenibacillus_phage	1.0e-110	82.4
WP_088909242.1\|4293029_4293716_-	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	3.3e-61	76.1
WP_088909243.1\|4294027_4294330_-	hypothetical protein	A0A0S2GM64	Bacillus_phage	1.5e-10	45.9
WP_088909244.1\|4294709_4295726_-	hypothetical protein	NA	NA	NA	NA
WP_088910998.1\|4295824_4296367_-	YmfQ family protein	NA	NA	NA	NA
WP_157696800.1\|4296432_4297074_-\|plate	baseplate J/gp47 family protein	A0A0A7RUN3	Clostridium_phage	3.5e-41	46.8
WP_088909246.1\|4298242_4300459_-	S8 family serine peptidase	D7NW64	Streptomyces_phage	2.0e-06	34.0
WP_088909247.1\|4300728_4301181_-	hypothetical protein	NA	NA	NA	NA
WP_088909248.1\|4301262_4301715_-	hypothetical protein	NA	NA	NA	NA
WP_088909250.1\|4302647_4302956_+\|transposase	transposase	NA	NA	NA	NA
WP_157696801.1\|4302952_4303831_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.2e-44	40.2
WP_047073393.1\|4303970_4304600_-	transcriptional regulator	NA	NA	NA	NA
WP_088909251.1\|4304711_4305146_-	DUF86 domain-containing protein	NA	NA	NA	NA
WP_016742285.1\|4305156_4305264_-	hypothetical protein	NA	NA	NA	NA
WP_047073006.1\|4305545_4306520_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_088909252.1\|4306532_4306802_+	DUF3055 domain-containing protein	NA	NA	NA	NA
WP_088909253.1\|4306955_4307399_+	hypothetical protein	NA	NA	NA	NA
WP_088909254.1\|4307457_4308123_-	DUF1027 domain-containing protein	NA	NA	NA	NA
WP_088909255.1\|4308211_4309153_+	sporulation protein	NA	NA	NA	NA
WP_047073014.1\|4309225_4310128_-	lipoyl synthase	NA	NA	NA	NA
WP_088909256.1\|4310234_4312430_-	AAA family ATPase	NA	NA	NA	NA
WP_088909257.1\|4312426_4313554_-	DNA repair exonuclease	NA	NA	NA	NA
WP_015893041.1\|4313689_4314241_-	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_088909258.1\|4314448_4315456_+	M23 family metallopeptidase	A0A7K9	Microcystis_virus	3.3e-09	39.0
WP_088909259.1\|4315562_4316189_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_088909260.1\|4316192_4317725_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_088909261.1\|4317745_4318864_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_088909262.1\|4318860_4319949_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_088909263.1\|4319953_4321456_-	spore germination protein	NA	NA	NA	NA
WP_088909264.1\|4321582_4322047_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.3e-41	56.2
WP_088909265.1\|4322063_4323263_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.7e-108	51.3
WP_088909266.1\|4323279_4323936_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.4e-39	44.0
WP_088909267.1\|4323955_4325062_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	8.5e-59	41.3
WP_088909268.1\|4325668_4326337_-	HAD family hydrolase	NA	NA	NA	NA
WP_088909269.1\|4326975_4327701_-	sporulation protein YunB	NA	NA	NA	NA
WP_088911000.1\|4327768_4328938_-	MFS transporter	NA	NA	NA	NA
WP_088909270.1\|4329338_4329818_+	cysteine dioxygenase family protein	NA	NA	NA	NA
WP_088909271.1\|4329835_4331152_-	globin-coupled sensor protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-13	28.8
WP_088909272.1\|4331282_4332074_-	hypothetical protein	NA	NA	NA	NA
WP_088909273.1\|4332481_4333417_+	magnesium/cobalt transporter CorA	NA	NA	NA	NA
WP_088909274.1\|4333417_4334512_-	HD-GYP domain-containing protein	NA	NA	NA	NA
WP_047073052.1\|4335766_4336069_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_088909275.1\|4336139_4336379_-	hypothetical protein	NA	NA	NA	NA
WP_088909276.1\|4336426_4337881_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_088909277.1\|4337905_4338730_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_088909278.1\|4338751_4339609_-	DUF72 domain-containing protein	A0A1S5XY79	Kurlavirus	1.9e-13	26.9
WP_088909279.1\|4339661_4340168_+	M67 family metallopeptidase	NA	NA	NA	NA
WP_088909280.1\|4340098_4341502_-	aspartate kinase	NA	NA	NA	NA
WP_088909281.1\|4342463_4344005_-	flotillin family protein	NA	NA	NA	NA
WP_088909282.1\|4344004_4344544_-\|protease	serine protease	NA	NA	NA	NA
WP_088909283.1\|4344631_4346068_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_088909284.1\|4346214_4347156_+	DMT family transporter	NA	NA	NA	NA
WP_088909285.1\|4347205_4347712_-	NUDIX hydrolase	NA	NA	NA	NA
WP_088909286.1\|4347686_4348223_-	Suppressor of fused protein (SUFU)	NA	NA	NA	NA
WP_157696802.1\|4348467_4348839_-	hypothetical protein	NA	NA	NA	NA
WP_088909289.1\|4350047_4350656_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP018145

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection