CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP022274	Citrobacter freundii strain 18-1 plasmid pA18-1, complete sequence	0 crisprs	csa3	2
NZ_CP022277	Citrobacter freundii strain 18-1 plasmid pD18-1, complete sequence	0 crisprs	NA	0
NZ_CP022276	Citrobacter freundii strain 18-1 plasmid pCKPC18-1, complete sequence	0 crisprs	NA	0
NZ_CP022273	Citrobacter freundii strain 18-1 chromosome, complete genome	2 crisprs	DinG,cas3,DEDDh,RT,csa3,WYL	359
NZ_CP022275	Citrobacter freundii strain 18-1 plasmid pBKPC18-1, complete sequence	0 crisprs	NA	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

75935 : 88100

Escherichia_phage(100.0%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|75935_76640_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000124732.1\|76857_77100_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_000277490.1\|77092_77377_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_001567660.1\|77928_78951_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_088903415.1\|79836_80541_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	7.6e-138	99.1
WP_041205587.1\|80700_81387_+	hypothetical protein	NA	NA	NA	NA
WP_005326786.1\|81383_81845_+	membrane protein	NA	NA	NA	NA
WP_059593932.1\|81857_83024_+	beta-aspartyl-peptidase	NA	NA	NA	NA
WP_088903417.1\|83125_83845_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.9e-136	99.6
WP_001567322.1\|84708_85359_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001567320.1\|86082_86742_-	hypothetical protein	NA	NA	NA	NA
WP_001567660.1\|87077_88100_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

93998 : 144900

Escherichia_phage(28.57%)

tail,integrase,transposase,lysis

attL 109552:109566|attR 142524:142538

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903419.1\|93998_95003_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_004393997.1\|95623_96334_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-31	38.3
WP_022652303.1\|96335_97541_-	ABC transporter permease	NA	NA	NA	NA
WP_016236501.1\|97537_98689_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004393990.1\|98685_99294_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000427619.1\|99481_100486_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
WP_000493286.1\|101089_101419_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_000780222.1\|101399_101681_+	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_157676232.1\|101958_102117_+	hypothetical protein	A0A077SK28	Escherichia_phage	6.2e-08	63.5
WP_024015041.1\|102073_105103_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_010465829.1\|105086_105689_-	recombinase family protein	A0A0C4UR34	Shigella_phage	1.6e-40	50.3
WP_001067855.1\|105984_106689_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_023307208.1\|107702_110600_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	5.5e-182	37.8
109552:109566	attL	NA	NA	NA	NA
WP_000509966.1\|110694_111300_+	DNA resolvase	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_001164109.1\|111600_112128_+\|tail	tail fiber assembly protein	A0A077SK10	Escherichia_phage	8.1e-92	97.1
WP_001446476.1\|112131_112563_-	chromosome partitioning protein ParB	A0A2I7RQE2	Vibrio_phage	1.3e-34	54.6
WP_001393986.1\|112700_114158_-	trk system potassium uptake protein trkG	NA	NA	NA	NA
WP_000092276.1\|114295_114760_-\|lysis	lysis protein	A0A0K2FJD0	Enterobacteria_phage	1.3e-72	96.1
WP_000484485.1\|114962_115127_+	DUF1317 family protein	A0A1U8QQC1	Enterobacteria_phage	7.9e-22	100.0
WP_000548514.1\|115099_115291_+	DUF1382 family protein	A0A0P0ZC67	Stx2-converting_phage	2.1e-26	98.4
WP_001395510.1\|115301_115583_+	cell division protein ZapA	A0A0P0ZE02	Stx2-converting_phage	2.5e-47	100.0
WP_000763369.1\|115681_115903_+	TraR/DksA family transcriptional regulator	A0A0N7C211	Escherichia_phage	5.5e-34	95.9
WP_000111054.1\|115899_116151_+	ead/Ea22-like family protein	A0A0K2FJF6	Enterobacteria_phage	5.8e-32	92.3
WP_000748282.1\|116449_117064_+	hypothetical protein	NA	NA	NA	NA
WP_001129736.1\|117357_117696_+	hypothetical protein	A0A0F6TJR3	Escherichia_coli_O157_typing_phage	6.4e-50	86.6
WP_000762732.1\|117724_118153_+	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_001310555.1\|118491_119508_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_088903422.1\|119512_121261_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_000783215.1\|121278_121641_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_001114073.1\|121688_122042_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-23	50.0
WP_000002674.1\|122541_123417_-	DNA replication terminus site-binding protein	NA	NA	NA	NA
WP_157676233.1\|123757_124258_-	hypothetical protein	NA	NA	NA	NA
WP_001161555.1\|124495_124798_+	hypothetical protein	NA	NA	NA	NA
WP_088903423.1\|125169_126810_-	hypothetical protein	NA	NA	NA	NA
WP_000395773.1\|127008_127947_+	hypothetical protein	NA	NA	NA	NA
WP_039272364.1\|128122_128617_-	hypothetical protein	NA	NA	NA	NA
WP_024134513.1\|128613_129921_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_039272366.1\|129930_130182_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001553091.1\|130544_131549_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	1.7e-42	35.5
WP_001132404.1\|131551_132115_-	hypothetical protein	NA	NA	NA	NA
WP_031604062.1\|132133_132454_-	hypothetical protein	NA	NA	NA	NA
WP_000427623.1\|133677_134682_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_032736817.1\|134855_135455_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000427623.1\|135720_136725_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_032736819.1\|137381_137588_+	hypothetical protein	NA	NA	NA	NA
WP_032736820.1\|137602_138298_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_088903424.1\|138498_139609_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.2e-48	40.1
WP_003026799.1\|140326_140593_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_003026803.1\|140580_141063_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001567368.1\|141263_142667_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
142524:142538	attR	NA	NA	NA	NA
WP_001567369.1\|142695_143328_-	hypothetical protein	NA	NA	NA	NA
WP_077253535.1\|143553_144900_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP022273

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022273_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022273_1

719229-719315

Orphan

Consensus_repeat	Method
ATGAGCCTGCTTCAGCTGCTCCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022273_1

>merge|NZ_CP022273|1|719229-719315|CRISPRCasFinder
ATGAGCCTGCTTCAGCTGCTCCAGTGCGTCGGCGTGCTCTTTGTCTTTCACTTCAGCGTCCGAATGAGCCTGCTTCAGTTGCTCCAG

>NZ_CP022273|1|1|719229-719315|CRISPRCasFinder
ATGAGCCTGCTTCAGCTGCTCCAG	TGCGTCGGCGTGCTCTTTGTCTTTCACTTCAGCGTCCGA
ATGAGCCTGCTTCAGTTGCTCCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022273.1\|WP_088902283.1\|717718_718159_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088903351.1\|715336_715588_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902284.1\|718161_718518_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902282.1\|717338_717722_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902290.1\|722708_723455_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902292.1\|724423_725899_-\|DUF1073-domain-containing-protein	unknown	unknown	gnl\|CDD\|368870
NZ_CP022273.1\|WP_088902281.1\|716517_717273_-\|immunoglobulin-domain-containing-protein	unknown	unknown	gnl\|CDD\|372822
NZ_CP022273.1\|WP_094544857.1\|714619_714997_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902288.1\|720665_721094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902289.1\|721097_722480_-\|DUF2213-domain-containing-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_143759628.1\|728839_729373_+\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|308985
NZ_CP022273.1\|WP_088902295.1\|728061_728673_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902294.1\|727468_728041_-\|terminase-small-subunit	unknown	unknown	gnl\|CDD\|377071
NZ_CP022273.1\|WP_088902277.1\|711646_714559_-\|tail-protein-(tape-measure)	unknown	unknown	gnl\|CDD\|274008
NZ_CP022273.1\|WP_088902279.1\|714993_715326_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902287.1\|719559_720654_-\|phage-coat-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902291.1\|723501_724497_-\|phage-head-morphogenesis-protein	unknown	unknown	gnl\|CDD\|309383
NZ_CP022273.1\|WP_088902293.1\|725909_727472_-\|terminase	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902280.1\|715782_716457_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902285.1\|718690_719071_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022273.1\|WP_088902277.1\|711646_714559_-\|tail-protein-(tape-measure)	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	2.58459e-10
NZ_CP022273.1\|WP_088902294.1\|727468_728041_-\|terminase-small-subunit	gnl\|CDD\|377071	pfam03592, Terminase_2, Terminase small subunit. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site.	1.57917e-37
NZ_CP022273.1\|WP_088902291.1\|723501_724497_-\|phage-head-morphogenesis-protein	gnl\|CDD\|309383	pfam04233, Phage_Mu_F, Phage Mu protein F like protein. Members of this family are found in double-stranded DNA bacteriophages, and in some bacteria. A member of this family is required for viral head morphogenesis in bacteriophage SPP1. This family is possibly a minor head protein. This family may be related to the family TT_ORF1 (pfam02956).	6.58158e-07
NZ_CP022273.1\|WP_088902292.1\|724423_725899_-\|DUF1073-domain-containing-protein	gnl\|CDD\|368870	pfam06381, DUF1073, Protein of unknown function (DUF1073). This family consists of several hypothetical bacterial proteins. The function of this family is unknown.	2.19383e-14
NZ_CP022273.1\|WP_088902281.1\|716517_717273_-\|immunoglobulin-domain-containing-protein	gnl\|CDD\|372822	pfam13927, Ig_3, Immunoglobulin domain. This family contains immunoglobulin-like domains.	0.00409248
NZ_CP022273.1\|WP_143759628.1\|728839_729373_+\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|308985	pfam03692, CxxCxxCC, Putative zinc- or iron-chelating domain. This family of proteins contains 8 conserved cysteines. It has in the past been annotated as being one of the complex of proteins of the flagellar Fli complex. However this was due to a mis-annotation of the original Salmonella LT2 Genbank entry of 'fliB'. With all its conserved cysteines it is possibly a domain that chelates iron or zinc ions.	0.00149951

>NZ_CP022273.1|WP_088902285.1|718690_719071_-|hypothetical-protein
MADPITAADVQAFLGELGYSIPGALLDPILCVVNKIIPCLDGAGYDDCTAKLILMYAAALMATSSGARRIKSQGAPSGASRSFEYGDDSITWLRDSLARLDTSGCTSDLPISAGNSVGMFMVVGGC
>NZ_CP022273.1|WP_088902284.1|718161_718518_-|hypothetical-protein
MSATANWSYTAKATIWRKGAGGRDENGDPINGYEAPVVIMVDYEGGLSKRIGSLGTEIVVKNTVWTEYALADAGDYLLIGESTDADPVAAGADEVRQVIRYADTFERVADDFAILTGV
>NZ_CP022273.1|WP_088902283.1|717718_718159_-|hypothetical-protein
MGIKVKGISQAKKHLNDLINDVQGRKAVRAIQSALILIGARAAYYTPIDTSTLVNSQFREIDASGVIITGRVGYSANYAAYVHEASGKLKGQPRAHFGTTRAGQEFGGGSGTGNYWDPHGEPQFLTKGANEERDAIDAVMRKELSL
>NZ_CP022273.1|WP_088902282.1|717338_717722_-|hypothetical-protein
MTPMMHERVRNMFGDAGLTAGFTVQKLMYDDPEDLTQAVMVFRPNGGSNIRHDLGSEHHVLVDVIGAKDKRGDAADAVQRIVDYVQANPMADECVGYIQNMGAIPAPVLTAEGRIVFRLQFACTYGE
>NZ_CP022273.1|WP_088902281.1|716517_717273_-|immunoglobulin-domain-containing-protein
MANCPNSNERLFGGAVVLEVSDGCPDAKPLEADWLALAAGTNKGFDFNPNAVTSDADDGGGYVESIITNSDFTISFEGEVRKKDKLDQYGIGKFITYFAAELAARRQPGIWVRMPYGPVTFIGYMVVTALSSDGGTNDIVTFSTEFKVGDASTIEVIDNSAASALVFVADLPSTKTAAVGDDFSLGVQVSGGVAPYKYDWYKNGIHTGLSTSTTTIDFDNATTADNGVRQVKVTDYNGNTITSTPNTLTVS
>NZ_CP022273.1|WP_088902280.1|715782_716457_-|hypothetical-protein
MTALIDIGEFSVSDGREGGKDYLLRPSLMAMTRIGTPAEIVQAYATVHGSDVAAVIQFCTDTLGRFPDWLSPSMNRIAERLLSLSMHIMQACCDDDLTPMIGEWKGWSRYVVYRPGQMPRNDIIVLAQHLMQHGIVGKASVRRLQRHESGETTDEFKAFDYISAARSHFGMSRDEAAALTMTEFQLMLAQKYPDQKGFTREEYDAVADDYLKKQAARRAQANQK
>NZ_CP022273.1|WP_088903351.1|715336_715588_-|hypothetical-protein
MAASGSYPEQESPVTKSVESVSFERCKQDTYGVYNQVAGNYPAQEVVNTGILYIVKIWTNDGVIMVSCSGPDGKKLVTQSSYR
>NZ_CP022273.1|WP_088902279.1|714993_715326_-|hypothetical-protein
MSEQEQLQRLSEEVARAYLRHLEATTGGNTVTYDGVTRSITLEELVFGLIGVAHFNAKNHPNDEILKDPYKHLSHMIDILSKPYVITEFGLKVIEHMNEISIHKQRGVLM
>NZ_CP022273.1|WP_094544857.1|714619_714997_-|hypothetical-protein
MKTGAMCLSLLFLISGCDDGGKGSVANGADTAITMFKSSMSEGDHPPFEYQRLVFKPDQQNSSKVISGWVCGDGSMKRDDKTFNFKVRGHVIKSEDISYVGDIAALLSYTEMVKYDILYNKNCKE
>NZ_CP022273.1|WP_088902277.1|711646_714559_-|tail-protein-(tape-measure)
MAKEQNAGSVVYTVSAEIEPLLIAGKQAIDVLDKLDAAAQQSGKGMDSLDQSTSHTGSAFNELAGYANSMDNQLRKLNTNVSGIARAMEEARSGTGGANSEFNRAESIIEALGNQLAILDEAQENGARSAAVLAAQLRAGSKATDEEKQKIGELTGRLYDMKTSVDAGSKGHGNWKTSMQQAGYQVQDFIVQVQGGQSALVAFAQQGSQLAGAFGPGGAVVGAVLALSTVVAGALITSLNGGKTAMDALKDAAEAMDKVITISQNGVAALSDKYAMLAKTNAEAATILRNQAIIEYNSAVSKIPKAIGDAAASVIDFGDKALSAFSGGYASIKGFSDRLASLNITTDDYTEAMKQAYGAGQAFQATASSIGNTVGSVASKFAISEQAAFKLVKQMDEVQRTKSTEALQRLVIELQNTKSSSDSGTNAIIEFLKPLTELVGAAGMAKVNLAGMNLEMDNLTAGQKNLIKQTERNLALSKLQGEERARLQAQYAAEDAGFAKDDPHAKRMEDDAAATYRNTQAQKTLQSEQKKGASQAESIAQKLENLKQQAELAAGSTQQLSREQAILTAQQSLGAAATQKDLELAGQYAAAKWDTANALKAQAAAEKLLPEARENASYKQDVADLNTALTAKKISQEQYNETAERLEATHQTNLAKIRAQQAVTPQQEAAGTVDPVQQLANENARKLALIQQYEQQGVLTHQNALALRAAADTEYEQARIAAQWEIYRNQSAGNELLATSLEGLQSGATNALTGLINGTQSLQEAMANVGSTIINSVIGSLVEMGMQWVKNQVMGQAAAAASLASTMAQATAAASAWAPAAMSASIATYGSAAAVGESAYAASLLSAKGLAVAGAREHGGPVSASSMYRVGEGGKPEIFKASNGSQYMIPGDNGRVISNRDIGGGGGAFNFSPIINLNGDYSAQQQAMLEAAVKRGAQQGYAMAVSDVASGKGKLSNALATNFNTSQRIT
>NZ_CP022273.1|WP_088902287.1|719559_720654_-|phage-coat-protein
MLVYSKSLGEKTGNLAVNQYQFGMLSQERDAALNHQGINVMQEMADRINAVNNLNGINAVRSPADLYKAFDQTVLRQFQPNTEFTLFNDLMPLSRSVRINQTVYEYAKSGGRMWAHTSMSGQIGAALDAVQYQYDGTMVPVHDTGFKFHWREPRLNNPDAFDIISDAQFESTNEVRRQYVDYIYNGYRDAEGTYIKFDDKTWKGLKNDERVAMVDLGASGLNIDFTSTSATAEAIRNAAIKLRDTLKLTNNQYAEQTWYVSSAIISNLERYFSDNYQSDTILQELLKLSGIAAIKEDAQLTGNQILIVPLTAGVIAPIVGQAFGTVADPRPFYNSDYIWRTWGAAGLMVKTDINSKKSVIYAHS
>NZ_CP022273.1|WP_088902288.1|720665_721094_-|hypothetical-protein
MAKDGKHVIHAGGVFPNPTLNREGRATAVKPGTLGFFDAGVFKVSVDGSEKAIIYAADYDYLRCKTVDDTYAVDDLLVAIHPLPGMFLNVRAAAGTYKKGDALSIVNGQVKKQAGTEADRAYCDEERAITAAAGDLIRVVIK
>NZ_CP022273.1|WP_088902289.1|721097_722480_-|DUF2213-domain-containing-protein
MKLSSIHVKSLAINASNISTTTINGQEHYVIRGAVPIVDDIVMNSGLYPAEEINNSYQTMEGKLMPLPHPMVDGKYVSANDPRAINAYHVGAWAQNVSKSGEQVVMDVYINKAVAETKPDGKRLINRLDEMIAGTNTDPIHLSTGLLTNKEKKSGESKEKKYTWIARNMQFDHIAILLDEPGAGTPEEGVGMFVNADGQEGEVETASLIDAANSLKDGLVNKVKFFLTHNSDASFDEIYQMLREAIRAPSGSDVYRYVVTVWPDKFIYEEGSKLFQQKYLIDDSTVTLVGDAVEVVRKPTEYEVKTNGEQNPMKQKMIATLNAAGVTTEGLTDDQVWDAYNEQMKKSASDDKKDGGDDIDDAGKSKKKEPAANNEEMPAWAKVLTEQVTALNSQINANAETEKGNMRAAVKAKFGMTDVAVNALDGEPLKELFAQCQTSTGLNGAFRQATNNQSVSEMPE
>NZ_CP022273.1|WP_088902290.1|722708_723455_-|hypothetical-protein
MSEGIGFFVRTFSEEKYRDDFIKGNLYMNTIKYFREYEDSHSGNVGDKHEALSAWLQPANIRMIIKHPDGDIVIPGSEIAAPIALRRNRFDSINVFCLTVLHSHGITSDDYVSEEDFEKLKAYFTLPDDVCNLGRYAAVIPNTGLFLERVRTAAQALVDAEEAVRLICQQVTYYDPEESLSLEDENDAIFHKQKNYEHQREFRIAFDRGSEVAEPFTLKIGDISDIAIPVLTADINKYVKLERYKADN
>NZ_CP022273.1|WP_088902291.1|723501_724497_-|phage-head-morphogenesis-protein
MILFPMTPEQKTKVGTPVVPRSKVDPTRSAKQVTAMFRDIEKRYLGIKRALKALFDQRLTGREREVNSHSWHFLCHVNGEDQRLYQVNAGKFIYDMTPQELAELLEAVQSILDDYLLDGGENNQWAMDYVAAEARRGTLEAFNNLSQQSLAYASQTTLQQLLSSPGYQNQIASARLTTFSDWKAISDAARADLTGVITDAVARGVSPRETASVISKRLDVSMSRAKAIAQTEQVGALRQAQWNETDWAADRLGLNTGLLHLSALKPTTRTTHAFWHGKVRTVQEVRDWYAVDGNKYHCYCGQIPVLLNDDGSIFNVGLADKLAKERKQWNS
>NZ_CP022273.1|WP_088902292.1|724423_725899_-|DUF1073-domain-containing-protein
MSNDTEMQVLAGLIVNSLNEVSRSRQLYAAGFNKSGNTKRHHLWCEFGYPERLDFDHFYNMYERNGAAFGAVHKLLDACWSDSPVIVDGDETKKAKKTTPWEKKVTKLMKKYWAKVKDADRRNLVGHYSALILQFADSREWYEPVNRDVMRKSRERGLVKMIPAWESQVKPGELEQDQKSPDYAMPKFYYFQEQPVGDSGNIVGPMRSIKIHPERIIMFCEGSEDESSLAGIPFLRAGYNDLLDMAKTSGGSAEGFLKNASRQLGINMSKDTKIEKIMEDAKKAGYSGLAEALNAAIQKLNSGTDSALVTQDGEAKVLSVAAADPSPTWTVSANQFSSSVQMPFTILFGQQTGRLASDQDKNDFAKRCNGRRNGFQTDRASAVIERLWTVEVIEPPKSGEITLTWSDLLAPSEKEKIANMKEMAAVAKDTQQAYGTPAVDENEVREAGELEPREDVKPPDPGKKVTTDDPLSDDAGAKDEGGDAGSSAQQS
>NZ_CP022273.1|WP_088902293.1|725909_727472_-|terminase
MNYKAVWKPLSGSQSLSLSCPCNEILYEGTRGPGKTAAQLARFRRLVGLGYGSFWRGVIFDTEYKNLTDIITQSKRMYRLFNDGARYLASASELRWVWPTGEELLFRFGKEEGDYWDYHGQEFPFIGFNELTKQQSAEFYEMMFSCRRSSFRPENYPRDDGSLLKPIPLETFSTTNPFGIGHTWVKKRFIEPAPRGTIIRETQKVFNPQTEREEDVTLTRVAIHGSFKENPYLDPQYIATLMAIKDPNRRKAWVEGSWDVTSGGRFDHLWNESLHVIKPFRIPDSWTVDRSHDWGESKPFSNLWWAQADGTAAELPDGRQFCPPAGSLILIGEWYGCPPDELNKGLNMSSTNVAKGVAWIDKRLTGDDVDEPEEIQLDGVTQGQLNIMPGICSEVIPGPADSAIFNTGDDELSIGQKMENQGVEWLEANKKPGSRVNGASVFADMLEAVVEGKKLESGIPEKPAFYVFEHCRGWISRIPVLVRDSKNPDDVDTQQEDHDWDATRYRVLHSPRRSGAIFFT
>NZ_CP022273.1|WP_088902294.1|727468_728041_-|terminase-small-subunit
MALNTKQDMFCREYLIDLNATQAAIRAGYSVKTANRIAAQLLSKLDIQNRIVELKTKRNEDVGIDADYVLRRLVEIDQMDVLDILNDDGSLKAISLWPKSWRTTLTGLDISTTIQNFDEDTAETILKKIKWPDKVKNLELLGKHVRVQAFKEQVEQKVVATHNVMLVPTSDNVDSWEAAAQKQQSEVLGG
>NZ_CP022273.1|WP_088902295.1|728061_728673_+|hypothetical-protein
MEKNTGFSSLIDTLKQNKDVIADACDAGLEAAESIPFVGWALKLWNVKNTYQERKLYRNTKAFWEASQIKDPEALRTKFATQEAAEEFTDTLVQVLIDSEKPYKATMVSNVTNALAMGVLTHEEANDMILIILNASVPALKSLRKFYPRLHDGKYIPTALLEDTDKDGTHSMLNSMGLIYRWADQTALSKVGRNIAQIAYRGL
>NZ_CP022273.1|WP_143759628.1|728839_729373_+|YkgJ-family-cysteine-cluster-protein
MSLEKLLIKNRKCGSCSVCCTSLRIEQPTLKKLADVPCQHLKPQGGCSIYDERPSVCRTWYCGWRILDIGPEMRPDRSGVLIRYDGSSLCFQPVDKNRVSALIEPEPLRILGGLIAQGMKVEISVPTKEGYCSSNINVTEHMSEVVKSREYAKMRSALLAAIQFASQAKTDPVEPLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022273_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022273_2

1552161-1552254

Orphan

Consensus_repeat	Method
TGGACAACTGTTGGACATTCGTTGGACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022273_2

>merge|NZ_CP022273|2|1552161-1552254|CRISPRCasFinder
TGGACAACTGTTGGACATTCGTTGGACAGATGCCCTGCTCAGGCCTTTCAGGATGCGGTGTTGCGTTGGACAACTGTTGGACAGTCGTTGGACA

>NZ_CP022273|2|2|1552161-1552254|CRISPRCasFinder
TGGACAACTGTTGGACATTCGTTGGACA	GATGCCCTGCTCAGGCCTTTCAGGATGCGGTGTTGCGT
TGGACAACTGTTGGACAGTCGTTGGACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022273.1\|WP_088902574.1\|1557463_1558432_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP022273.1\|WP_088902563.1\|1547590_1547905_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902567.1\|1550327_1551761_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|274672
NZ_CP022273.1\|WP_088902569.1\|1552812_1553112_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|336083
NZ_CP022273.1\|WP_088903365.1\|1553256_1553499_-\|transcriptional-regulator	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902573.1\|1556255_1556525_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902565.1\|1548538_1549258_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902572.1\|1555803_1556100_+\|regulator	unknown	unknown	unknown
NZ_CP022273.1\|WP_088903364.1\|1549297_1549699_-\|DUF2591-domain-containing-protein	unknown	unknown	gnl\|CDD\|378491
NZ_CP022273.1\|WP_057059849.1\|1557160_1557394_+\|cell-division-protein-FtsZ	unknown	unknown	gnl\|CDD\|236900
NZ_CP022273.1\|WP_088903366.1\|1555493_1555760_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376179
NZ_CP022273.1\|WP_088902560.1\|1545735_1546380_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902571.1\|1554759_1555113_+\|antitermination-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902566.1\|1550025_1550328_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902564.1\|1548338_1548542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022273.1\|WP_088902570.1\|1553604_1554360_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225484
NZ_CP022273.1\|WP_049040442.1\|1549768_1550029_-\|DUF4752-family-protein	unknown	unknown	gnl\|CDD\|339554
NZ_CP022273.1\|WP_088902561.1\|1546384_1547170_-\|DUF551-domain-containing-protein	unknown	unknown	gnl\|CDD\|367946
NZ_CP022273.1\|WP_088902562.1\|1547166_1547589_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|131694
NZ_CP022273.1\|WP_023277200.1\|1556676_1557183_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|379158

Protein	Function_ID	Function_description	E-value
NZ_CP022273.1\|WP_088902574.1\|1557463_1558432_+\|hypothetical-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	1.64422e-09
NZ_CP022273.1\|WP_023277200.1\|1556676_1557183_+\|HNH-endonuclease	gnl\|CDD\|379158	pfam13392, HNH_3, HNH endonuclease. This is a zinc-binding loop of Fold group 7 as found in endo-deoxy-ribonucleases and HNH nucleases.	5.79452e-08
NZ_CP022273.1\|WP_088902569.1\|1552812_1553112_-\|hypothetical-protein	gnl\|CDD\|336083	pfam05269, Phage_CII, Bacteriophage CII protein. This family consists of several phage CII regulatory proteins. CII plays a key role in the lysis-lysogeny decision in bacteriophage lambda and related phages.	3.70963e-31
NZ_CP022273.1\|WP_088902567.1\|1550327_1551761_-\|AAA-family-ATPase	gnl\|CDD\|274672	TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily. Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model. [Mobile and extrachromosomal element functions, Prophage functions].	0
NZ_CP022273.1\|WP_088902570.1\|1553604_1554360_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225484	COG2932, COG2932, Predicted transcriptional regulator [Transcription].	9.17747e-30
NZ_CP022273.1\|WP_088902562.1\|1547166_1547589_-\|HNH-endonuclease	gnl\|CDD\|131694	TIGR02646, Hypothetical_protein_SMc04429, TIGR02646 family protein. Members of this uncharacterized protein family are found exclusively in bacteria. Neighboring genes in various genomes are also uncharacterized or may annotated as similar to restriction system proteins. [Hypothetical proteins, Conserved].	6.1185e-05
NZ_CP022273.1\|WP_088902561.1\|1546384_1547170_-\|DUF551-domain-containing-protein	gnl\|CDD\|367946	pfam04448, DUF551, Protein of unknown function (DUF551). This family represents the carboxy terminus of a protein of unknown function, found in dsDNA viruses with no RNA stage, including bacteriophages lambda and P22, and also in some Escherichia coli prophages.	1.70148e-11
NZ_CP022273.1\|WP_049040442.1\|1549768_1550029_-\|DUF4752-family-protein	gnl\|CDD\|339554	pfam15944, DUF4752, Domain of unknown function (DUF4752). This family of proteins is found in bacteria and viruses. Proteins in this family are typically between 90 and 105 amino acids in length. There is a conserved GLA sequence motif.	1.27475e-26
NZ_CP022273.1\|WP_088903364.1\|1549297_1549699_-\|DUF2591-domain-containing-protein	gnl\|CDD\|378491	pfam10765, DUF2591, Protein of unknown function (DUF2591). This bacterial family of proteins has no known function.	0.000195417
NZ_CP022273.1\|WP_057059849.1\|1557160_1557394_+\|cell-division-protein-FtsZ	gnl\|CDD\|236900	PRK11354, kil, FtsZ inhibitor protein; Reviewed.	4.80879e-35
NZ_CP022273.1\|WP_088903366.1\|1555493_1555760_+\|hypothetical-protein	gnl\|CDD\|376179	pfam18757, Nmad5, Nucleotide modification associated domain 5. An alpha+beta fold domain associated with DNA base modifying genes in prokaryotes, and likely to be involved in modified DNA base biosynthesis.	2.48624e-29

>NZ_CP022273.1|WP_088902567.1|1550327_1551761_-|AAA-family-ATPase
MTSEMITVPHNPEAEQSVIGGLLLDDDSSERIQRVLAMLKPESFYNRAHQILFAEMRQMFRDNKPVDGLTVFDSLESKGLTEQVGGFAYIAQIAKNTPSAANIVAYAASVRESAMERYGIQRMNEATELLYARNGMSATEKYEAIQSIFTQLTDHSKTGSRRGLRSFGDVMEDWVTDLEKRFDPSGEQRGMSTGIPSLDRMLAPKGLVKGSLFVIGARPKMGKTTLYGQMAINCAVRERKPALMFSLEMPGDQILEKLIGQKSGVNPSIFYMPVTDDADDQYQGDYDGDFKKAMATAGRLSEIDMLYIDDTPGLSLAHIVSESRRIKREKGVVGMILVDYLTLMTAEKADRNDLAYGMITKGLKNLAKELGCVVVLLTQLNRELEKRVNKRPLPSDSRDTGQIEQDCDYWVGIHREGAFDDSVPAGETELILRLNRHGNTGTVYCNQYNGAIYDTDQQSAAATRRGRETKPKQKGGF
>NZ_CP022273.1|WP_088902566.1|1550025_1550328_-|hypothetical-protein
MEKELRNTREIIEQEYGEFPETILHAELCRACARVDGRSIKKSLKAFALARIEKVESKPLKGALEQMASSMFPETEIARIRACVGRMESALVKTFGVKRA
>NZ_CP022273.1|WP_049040442.1|1549768_1550029_-|DUF4752-family-protein
MTEATAIMHFVLASVGMLYVMCKAGEWVVSMTMKQWCKRRKESVKQKAVNDLYDAFELEKITAGETVKIATKSNLVIMMYREKPHD
>NZ_CP022273.1|WP_088903364.1|1549297_1549699_-|DUF2591-domain-containing-protein
MKVKTSDLVGTQLDVAVALALGGVITRPQDAQVYLNEMHQLCGESAKRHSRYVFSPSTDWQQCGELMESLPVSCYQYKDPSTGKFFHWVGVNESGHPGKRRGLIADNPRVAICRAAVFSKLGDEVDLPDELKN
>NZ_CP022273.1|WP_088902565.1|1548538_1549258_-|hypothetical-protein
MTSREKFEAFLVSEYEWGNDALNAANFHGDDATGYYTGGDFIYDGQSCSECLFWAWRGWQAAELASEQKLTDMAVQLANAESKCRELAAENAEMRSSIDATIGWQESTDPENGESVRMLVDIKTPATDAFLAEVRASAVSDYANKRGFSFHHGSIHAHFGNGDVMVGSVTFDNGDAGINFAPVREKTGGVGTHYEWTKGKTAEQVDSVFVIASSNAEGLEVIRDKLADAIAQLRQGGAV
>NZ_CP022273.1|WP_088902564.1|1548338_1548542_-|hypothetical-protein
MTRIRNFGWNRLKLATLSYEELGTLEEQVKQEHACSDGIHMYDKSGRDKLDSLSWAVYNKQKQESAQ
>NZ_CP022273.1|WP_088902563.1|1547590_1547905_-|hypothetical-protein
MTKSTDVHDLLTAYQKQARKIPAKGVYASRHRQVEVNAAHVRKIMRKRRRSVGKSNKLGCRFTAEMRVALICDMNFLALVCRSNRQNASPEKYVAVAGIGVKGE
>NZ_CP022273.1|WP_088902562.1|1547166_1547589_-|HNH-endonuclease
MALTKKQRAELRMKFGGRCAYCGCELPEKGWHADHVEAVHRKLVIDEEARLKGKWKLKQTGEVYRPQYDNYGNLFPACAPCNLFKSVFDIEEFRNQIAMQAGRALKTSVNFRTAERFGLVEVIEKPVVFWFEKYQEGATS
>NZ_CP022273.1|WP_088902561.1|1546384_1547170_-|DUF551-domain-containing-protein
MSTITKELAKLFRKITNSEIDAEGNAHVVLSPADSLLINNARIALASLETEASGRNPVLAYADSYRDMANQGVESIPVWSVITDLERNIAPLFTAPPPPLSVPAAMEMDDDFDSAFEHGKAVGWNACRAAMLQGAEPVTTDYKLPFDQWLSQQTGTIDVECGCVMTEVFFHWLRVAYEAGKSPVIPDGWVACSERMPEKDDFVYIWPRPDFGVELHVAQYGKFDKRDAGWYAQVYEQNFGIEYHPITVTHWMPLPAAPQQE
>NZ_CP022273.1|WP_088902560.1|1545735_1546380_-|hypothetical-protein
MNAAEIDAYLEARKPKSRHKSVVFGVASNDAAFAVTGLIDGKSESHHGYKAWTQMIMRCYDPSYLNKKPSYRDAYVCKEWMAFTPFLEWWKGAHIDGFHLDKDLLITGNKVYRPEACIYIPPELNTFTADNRSVRGEHPIGVCWHKGDRRFQSEVMGPGGKRIHLGRFKTALEAHETWFEKKLELAQRFKPICDELHPQLYDGLIAKIHSMRVA
>NZ_CP022273.1|WP_088902569.1|1552812_1553112_-|hypothetical-protein
MENSINRNKVNARRIESWLLNRIAMKGGNNVAKEIGVDKAQITRWKETWLPKMAMLLAVLEWGVVDDDMARLAREVAAVLTKKNRPAATERSDQITMDF
>NZ_CP022273.1|WP_088903365.1|1553256_1553499_-|transcriptional-regulator
MNDLLRWRKQASKEDWEKLATLANTTPGNLDQLAYGYRGASPKKARDIANASLKFRFPKPVTKEAIAFPPVRKASKANAA
>NZ_CP022273.1|WP_088902570.1|1553604_1554360_+|helix-turn-helix-domain-containing-protein
MHIYRHAKKWDYLGMDIKDIRRTNLRYQQNLAIKQGLSKADFAEKVGSSASTISQILGSNAVRNLGDDLARKIESQLGLSHGWLDQQHPETTSETGEARIIGDIEPWDSETTLDDDEVEVPFLKEVQLAAGAGSAFREDHNGFKLRFAKSTLRKLNVQFDNAVCVEVIGNSMEPVLPNGSTVGVDMGCRCIKDGKMYAIDYGDLLRVKLLYEMPGGMVRIRSYNDDEHPEELRPIDDIRVIGRVFWSSVTY
>NZ_CP022273.1|WP_088902571.1|1554759_1555113_+|antitermination-protein
MIKQQNIKGNARSRRDSRRKVKQEVFAKANPMLVGRKYDVDTSPVEIECKPGYEPAPIKFVAQDAVWQQQEYKRQLERAAIVYSNEFGNKLLDSGMCLPDVALYAAGHRSSKSVTAR
>NZ_CP022273.1|WP_088903366.1|1555493_1555760_+|hypothetical-protein
MFAAEHEITTRFDEVFAAEAKLEARKKDIETTVWAALNSVTTIKRLIEVWPESKELIPDGVDTAKQTLPALKVEDLNRLIGLPTEQVA
>NZ_CP022273.1|WP_088902572.1|1555803_1556100_+|regulator
MEGDVQRIDSMMNILRNMKHDMKRQQKLSSINSLELTPKQAQKRNADAEWIAMEQIKRRHELHALSVELGFAERRDSYAPFELTDGWHRFNHKPREPQ
>NZ_CP022273.1|WP_088902573.1|1556255_1556525_+|hypothetical-protein
MAIDFEVKATGIDVSTSGYRDHVNLEVRGVELSDLVSEIEVYALFQEIDLDDYIDWAEATGHIEDIFERLDADEVIAWLRSNGHLETES
>NZ_CP022273.1|WP_023277200.1|1556676_1557183_+|HNH-endonuclease
MMRKHKLPSAEEIDSLLDYNPETGVFTWKVTKSGWVVKGRPAGSKNNNGYLRVGIGRRHYFLSRIAFFLCTGESPEEVDHINGDRTDNRACNLRAASRHENCLNKSVRSDSRTGVKGVSWRPDVKKWSARSTDSSGKRVFLGYYRTIRDAVAVLNDFRREQHGEFAKN
>NZ_CP022273.1|WP_057059849.1|1557160_1557394_+|cell-division-protein-FtsZ
MVSLQKISSNLHYGTTPLIRQCITPGMMAMHEGRTYRVSAVIQERKWVYLHTDAEIIRLSDCVIDVLLDGHGNPIQH
>NZ_CP022273.1|WP_088902574.1|1557463_1558432_+|hypothetical-protein
MSEVTDLVVIEKQNAMAVFTTKEQLDPIIEAIEKEARSLVPDVSTRKGRDAIASMAHKVARSKTYIDNAGKDLVAELKALPKQIDESRRIVRERLDALKDEVRRPLTEWEAEQERIKAEEAMNAMHAEALEMNIRFDQELAAKFEADHEMALLMNKDYDRDREEQRRQAEQAKREHEERIKREAAEQARRDAEAMHKAEIEAAARREAEEKARAELAERQRVEAEQRAAREKQEAEERARREKEEAVAAERRRQEEAEAARLAEEQRKAEEEARRAADKEHRRTVNRRVYADLIAQGIPEEFAQKAVLAIAGGKVQHAHIKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 36003

Enterobacteria_phage(27.27%)

tail,integrase

attL 13749:13762|attR 32533:32546

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157676215.1\|2930_3158_+	hypothetical protein	K7PGT6	Enterobacteria_phage	1.9e-10	58.2
WP_008784478.1\|5626_6025_+\|tail	tail protein	K7PHM6	Enterobacterial_phage	4.0e-43	62.8
WP_071596416.1\|7218_7539_+\|tail	phage tail assembly protein T	K7PHE1	Enterobacteria_phage	9.4e-35	70.8
WP_088902110.1\|10035_10383_+\|tail	phage tail protein	K7PJT2	Enterobacteria_phage	2.3e-39	69.6
WP_048216156.1\|10379_11135_+\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	1.9e-131	86.9
WP_088902111.1\|11136_11847_+	peptidase P60	K7PGR2	Enterobacteria_phage	2.2e-137	91.9
WP_088902112.1\|11877_12213_+	hypothetical protein	NA	NA	NA	NA
WP_088902113.1\|12264_12867_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	6.6e-74	72.3
WP_088902114.1\|12921_16125_+	host specificity protein J	O64335	Escherichia_phage	0.0e+00	87.5
13749:13762	attL	NA	NA	NA	NA
WP_088902115.1\|16126_17071_+	hypothetical protein	H6WRW5	Salmonella_phage	5.3e-118	65.8
WP_088902116.1\|17080_18484_+\|tail	phage tail protein	A0A1V0E5M2	Salmonella_phage	2.6e-113	52.0
WP_088902117.1\|18622_18865_-	DinI family protein	Q6UAW0	Klebsiella_phage	4.4e-29	77.9
WP_088902118.1\|18943_19309_+	DNA polymerase V	A0A222YZE2	Escherichia_phage	3.5e-46	73.1
WP_088902119.1\|19961_20585_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_088902120.1\|21059_21608_+	hypothetical protein	NA	NA	NA	NA
WP_029397131.1\|21586_22222_+	hypothetical protein	NA	NA	NA	NA
WP_157676216.1\|22440_22755_-	hypothetical protein	NA	NA	NA	NA
WP_088902121.1\|22789_23458_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	6.2e-81	60.4
WP_044711151.1\|23885_24416_+	hypothetical protein	NA	NA	NA	NA
WP_044711150.1\|24585_24768_+	hypothetical protein	NA	NA	NA	NA
WP_044711149.1\|25364_26030_+	hypothetical protein	NA	NA	NA	NA
WP_088902122.1\|26041_27025_-\|integrase	tyrosine-type recombinase/integrase	A0A192Y7M7	Salmonella_phage	1.7e-164	82.0
WP_044711145.1\|27029_27251_-	DUF4224 domain-containing protein	Q8HAA9	Salmonella_phage	3.0e-24	70.3
WP_044711143.1\|27427_28252_-	DUF2303 family protein	U5P439	Shigella_phage	8.0e-147	97.4
WP_072211986.1\|28317_28698_-	hypothetical protein	U5P4J6	Shigella_phage	5.3e-61	97.6
WP_044711136.1\|29115_29820_+	hypothetical protein	NA	NA	NA	NA
WP_044711135.1\|29865_30537_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	3.1e-72	54.5
WP_003839058.1\|31300_31633_+	EmrE family multidrug efflux SMR transporter	NA	NA	NA	NA
WP_044711132.1\|31735_32914_-	porin	Q1MVN1	Enterobacteria_phage	9.9e-106	55.7
32533:32546	attR	NA	NA	NA	NA
WP_071696977.1\|33355_34048_+	phosphohydrolase	A0A1D6Y7U0	Golden_Marseillevirus	1.9e-08	28.7
WP_044711130.1\|34124_35555_+	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	5.6e-103	55.4
WP_044711129.1\|35535_36003_+	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	3.4e-33	47.6

DBSCAN-SWA_2

51331 : 54058

Salmonella_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087878944.1\|51331_52774_-	hypothetical protein	E7C9N7	Salmonella_phage	1.0e-11	23.0
WP_088902125.1\|52763_53699_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	4.1e-147	84.2
WP_032949546.1\|53695_54058_-	GtrA family protein	I1TED9	Salmonella_phage	1.2e-46	76.7

DBSCAN-SWA_3

65984 : 66737

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030477.1\|65984_66737_+	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	6.4e-26	34.4

DBSCAN-SWA_4

84843 : 85860

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001407551.1\|84843_85860_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	4.4e-187	100.0

DBSCAN-SWA_5

89634 : 96412

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902136.1\|89634_91158_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.6e-87	38.7
WP_088902137.1\|91147_92395_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_000779013.1\|92391_93075_+	YecA family protein	NA	NA	NA	NA
WP_088902138.1\|93127_96412_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	4.7e-65	27.4

DBSCAN-SWA_6

109648 : 110674

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839115.1\|109648_110674_-	patatin	A0A1B2LRS3	Wolbachia_phage	8.7e-42	34.0

DBSCAN-SWA_7

122329 : 123844

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902147.1\|122329_123844_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	4.8e-12	26.6

DBSCAN-SWA_8

135636 : 141282

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936849.1\|135636_137292_+	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-08	24.8
WP_003034646.1\|137335_138937_+	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9
WP_003034649.1\|138956_139829_+	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_003839158.1\|139825_140875_+	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	1.8e-05	32.0
WP_003034656.1\|140892_141282_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3

DBSCAN-SWA_9

149294 : 237736

106

Enterobacteria_phage(19.57%)

capsid,plate,holin,integrase,portal,tRNA,protease,head,terminase,tail

attL 141163:141177|attR 169398:169412

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
141163:141177	attL	NA	NA	NA	NA
WP_003844166.1\|149294_151028_-\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	1.7e-85	33.6
WP_003034677.1\|151266_151833_+	VOC family protein	NA	NA	NA	NA
WP_088902153.1\|151835_152582_+	copper homeostasis protein CutC	NA	NA	NA	NA
WP_003839177.1\|152825_153794_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_003034686.1\|153790_154534_-	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	3.2e-25	31.3
WP_003034689.1\|154574_154970_-	membrane protein	NA	NA	NA	NA
WP_088902154.1\|155022_155796_-	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.0e-55	78.7
WP_088902155.1\|155774_157088_-\|integrase	site-specific integrase	Q8W658	Enterobacteria_phage	2.8e-234	89.2
WP_016150522.1\|157143_157380_-	excisionase family protein	Q8W657	Enterobacteria_phage	4.2e-40	94.9
WP_016150521.1\|157535_157847_-	hypothetical protein	NA	NA	NA	NA
WP_088902156.1\|157846_158476_-	hypothetical protein	A0A1B5FPC7	Escherichia_phage	7.9e-94	81.3
WP_088902157.1\|158472_158697_-	hypothetical protein	A0A1B5FPG2	Escherichia_phage	5.6e-18	65.3
WP_016150517.1\|158693_159260_-	hypothetical protein	A0A088C4R7	Shewanella_sp._phage	1.2e-29	39.4
WP_088902158.1\|159256_160087_-	DNA-binding protein	A0A2L1IV39	Escherichia_phage	4.3e-31	46.6
WP_088902159.1\|160098_160605_-	hypothetical protein	F1C5A2	Cronobacter_phage	1.9e-53	57.1
WP_143759624.1\|160601_160820_-	hypothetical protein	A0A286S1P6	Klebsiella_phage	3.7e-27	88.4
WP_088902160.1\|160791_161043_-	hypothetical protein	A0A286SGR4	Klebsiella_phage	4.3e-27	70.2
WP_088902161.1\|161042_161399_-	hypothetical protein	A0A1B5FPB3	Escherichia_phage	1.6e-22	48.7
WP_088902162.1\|161498_161789_-	hypothetical protein	NA	NA	NA	NA
WP_050484865.1\|161850_162096_-	hypothetical protein	NA	NA	NA	NA
WP_088902163.1\|162424_163102_-	helix-turn-helix domain-containing protein	A0A1B5FPF4	Escherichia_phage	4.3e-98	76.3
WP_088902164.1\|163245_163506_+	Cro/Cl family transcriptional regulator	A0A1B5FPK9	Escherichia_phage	2.9e-18	56.4
WP_088902165.1\|163536_164364_+	transporter	Q8W644	Enterobacteria_phage	1.5e-92	60.0
WP_088902166.1\|165271_166153_+	cell division protein ZapE	Q8W641	Enterobacteria_phage	1.5e-79	62.0
WP_047721768.1\|166149_167508_+	replicative DNA helicase	Q8W640	Enterobacteria_phage	1.8e-175	68.4
WP_032652461.1\|167518_167830_+	hypothetical protein	NA	NA	NA	NA
WP_088902167.1\|167826_168609_+	antitermination protein	F1C595	Cronobacter_phage	4.8e-109	76.0
WP_088902168.1\|168899_169586_+	Rha family transcriptional regulator	A0A192Y918	Salmonella_phage	1.4e-99	78.1
169398:169412	attR	NA	NA	NA	NA
WP_088902169.1\|169701_170235_+	hypothetical protein	NA	NA	NA	NA
WP_001568784.1\|170680_170959_+\|holin	holin	K7PGZ9	Enterobacteria_phage	5.1e-45	97.8
WP_088902170.1\|170930_171479_+	lysozyme	K7PM52	Enterobacteria_phage	1.2e-98	94.5
WP_088902171.1\|171457_171991_+	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	3.4e-05	32.1
WP_000990801.1\|171987_172218_+	hypothetical protein	NA	NA	NA	NA
WP_024174517.1\|172608_172806_+	hypothetical protein	K7PHC3	Enterobacterial_phage	2.2e-26	90.8
WP_000066494.1\|173378_173591_+	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	4.6e-22	72.9
WP_057069020.1\|173601_173790_+	hypothetical protein	NA	NA	NA	NA
WP_000756041.1\|173863_174094_+	hypothetical protein	NA	NA	NA	NA
WP_001100119.1\|174298_174472_+	addiction module toxin, GnsA/GnsB family	NA	NA	NA	NA
WP_088902172.1\|175195_175423_+	hypothetical protein	NA	NA	NA	NA
WP_088902173.1\|175403_175643_-	DUF1883 domain-containing protein	NA	NA	NA	NA
WP_072667361.1\|175820_176459_+	hypothetical protein	NA	NA	NA	NA
WP_032652440.1\|176469_176973_-	hypothetical protein	NA	NA	NA	NA
WP_000210383.1\|177263_177833_+	hypothetical protein	NA	NA	NA	NA
WP_072667360.1\|177774_179898_+\|terminase	terminase	A0A0C5ABH4	Bacteriophage	1.8e-97	35.6
WP_000483309.1\|179906_180170_+	hypothetical protein	NA	NA	NA	NA
WP_001045359.1\|180169_181807_+\|portal	phage portal protein	A0A291AUL8	Sinorhizobium_phage	3.3e-91	35.2
WP_001052909.1\|181803_182670_+	S49 family peptidase	A0A2D1GN02	Marinobacter_phage	4.8e-49	37.9
WP_072667359.1\|182671_183262_+	hypothetical protein	NA	NA	NA	NA
WP_001472189.1\|183261_183666_+\|head	head decoration protein	NA	NA	NA	NA
WP_001472190.1\|183763_184813_+\|capsid	major capsid protein	V5Q8G6	Xylella_phage	1.6e-51	33.7
WP_001515588.1\|184784_185195_+	hypothetical protein	NA	NA	NA	NA
WP_000537794.1\|185199_185559_+	hypothetical protein	NA	NA	NA	NA
WP_072667357.1\|185555_186101_+	ATP-binding protein	NA	NA	NA	NA
WP_000497745.1\|186104_186302_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_023157310.1\|186298_187801_+\|tail	bacteriophage Mu tail sheath protein	B5TK67	Pseudomonas_phage	1.9e-101	42.4
WP_000896638.1\|187804_188176_+\|tail	phage tail protein	NA	NA	NA	NA
WP_000807719.1\|188177_188456_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_001139208.1\|190799_192203_+	hypothetical protein	NA	NA	NA	NA
WP_001515585.1\|192199_193285_+	hypothetical protein	M1PVV2	Vibrio_phage	7.6e-44	31.5
WP_000900614.1\|193323_193866_+\|plate	baseplate assembly protein	A0A077KAY0	Edwardsiella_phage	5.9e-05	30.8
WP_001279799.1\|193862_194300_+	hypothetical protein	B5TK74	Pseudomonas_phage	4.0e-12	45.8
WP_016237005.1\|194301_195444_+\|plate	baseplate J/gp47 family protein	A0A0A8WEY6	Clostridium_phage	4.7e-12	34.8
WP_001515583.1\|195440_196034_+	YmfQ family protein	NA	NA	NA	NA
WP_143759625.1\|196780_197062_+	hypothetical protein	NA	NA	NA	NA
WP_088902175.1\|197277_197694_-\|tail	phage tail protein	B6SCW7	Bacteriophage	1.4e-19	44.0
WP_088902176.1\|197696_198104_-	hypothetical protein	NA	NA	NA	NA
WP_072667354.1\|198133_198376_-	DinI family protein	Q6UAW0	Klebsiella_phage	1.2e-29	79.2
WP_024199385.1\|198454_198844_+	DNA polymerase V	Q1MVE7	Enterobacteria_phage	3.9e-51	72.1
WP_088902177.1\|199438_200005_-	hydrolase	NA	NA	NA	NA
WP_032935372.1\|200293_202066_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_003844155.1\|202067_202511_+	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_003034865.1\|202539_203283_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003034867.1\|203317_203839_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
WP_003844153.1\|203919_204531_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003034872.1\|204539_205550_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.6e-08	25.4
WP_003034874.1\|205628_206414_-	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_003034877.1\|206410_207166_-	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	6.5e-18	28.3
WP_049002353.1\|207244_208189_+	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_003034883.1\|208204_209524_+	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	36.8
WP_003841672.1\|209643_210615_+	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
WP_003034890.1\|210658_212101_-	pyruvate kinase	NA	NA	NA	NA
WP_003034893.1\|212219_213089_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003034896.1\|213456_214932_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.3e-78	37.1
WP_003841668.1\|215165_216977_+	phosphogluconate dehydratase	NA	NA	NA	NA
WP_003034901.1\|217011_217653_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_003034904.1\|217719_218898_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_003034906.1\|219029_219320_+	DNA damage-inducible protein YebG	NA	NA	NA	NA
WP_003034909.1\|219441_219795_+	hypothetical protein	NA	NA	NA	NA
WP_054528502.1\|219889_220549_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_088902179.1\|220611_222690_+	oligopeptidase B	NA	NA	NA	NA
WP_003841659.1\|222680_223343_-	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	9.1e-08	30.6
WP_003841657.1\|223366_224023_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_003034925.1\|224129_224360_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.0e-14	60.3
WP_044711069.1\|224503_224878_+	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_049002332.1\|224881_225754_+	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_003833793.1\|225774_226113_+	YebY family protein	NA	NA	NA	NA
WP_058842357.1\|226525_227167_+	protein-serine/threonine phosphatase	Q8HA16	Enterobacteria_phage	8.1e-54	47.4
WP_003034941.1\|227167_227359_-	YebW family protein	NA	NA	NA	NA
WP_003034943.1\|227461_227701_-	DUF1480 family protein	NA	NA	NA	NA
WP_072211987.1\|227798_229220_-	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
WP_003034947.1\|229299_231933_-	PqiB family protein	NA	NA	NA	NA
WP_088902180.1\|231901_233185_-	membrane integrity lipid transport subunit YebS	NA	NA	NA	NA
WP_003034953.1\|233313_233811_+	GAF domain-containing protein	NA	NA	NA	NA
WP_003034957.1\|233907_234594_+	RNA chaperone ProQ	NA	NA	NA	NA
WP_088902181.1\|234613_236662_+	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-87	33.7
WP_003034964.1\|236854_237736_+\|protease	protease HtpX	NA	NA	NA	NA

DBSCAN-SWA_10

240882 : 243235

Staphylococcus_prophage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|240882_241830_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_003841991.1\|241948_242233_+	hypothetical protein	NA	NA	NA	NA
WP_003034983.1\|242869_243013_+	YobF family protein	NA	NA	NA	NA
WP_001062678.1\|243025_243235_+	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_11

250732 : 252292

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844070.1\|250732_252292_+	CNNM family cation transport protein YoaE	A0A0R6PEZ3	Moraxella_phage	5.1e-41	45.4

DBSCAN-SWA_12

256160 : 263510

Pandoravirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902188.1\|256160_257525_-	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	6.4e-40	40.2
WP_003020986.1\|257605_257785_+	YoaH family protein	NA	NA	NA	NA
WP_003020984.1\|257791_258136_-	RidA family protein	NA	NA	NA	NA
WP_003020980.1\|258276_260187_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	9.1e-93	33.1
WP_088902189.1\|260245_260941_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	A0A0R6PI74	Moraxella_phage	4.4e-05	36.9
WP_003020975.1\|261035_261620_+	Slp family lipoprotein	NA	NA	NA	NA
WP_003020970.1\|261824_263510_+	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	3.4e-35	25.3

DBSCAN-SWA_13

286921 : 287683

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902194.1\|286921_287683_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.3e-13	30.1

DBSCAN-SWA_14

301755 : 302487

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048232160.1\|301755_302487_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	5.4e-54	49.7

DBSCAN-SWA_15

315394 : 321134

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902201.1\|315394_316780_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	7.4e-28	26.4
WP_003841330.1\|316795_318259_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_003020797.1\|318379_320062_-	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	1.3e-21	22.5
WP_001518537.1\|320186_321134_-	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	8.6e-44	37.8

DBSCAN-SWA_16

324381 : 328388

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020786.1\|324381_325464_+	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	4.3e-07	38.8
WP_049016285.1\|325463_326297_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003020779.1\|326293_326686_+	SirB family protein	NA	NA	NA	NA
WP_003020775.1\|326688_327498_+	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_049016283.1\|327533_328388_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.4e-45	38.8

DBSCAN-SWA_17

341608 : 352204

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902205.1\|341608_343147_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.8e-19	40.5
WP_003020745.1\|343143_343854_+	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_003020743.1\|343853_344531_+	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_003020737.1\|345832_346675_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	9.8e-15	48.8
WP_060854809.1\|346730_347186_-	YchJ family protein	NA	NA	NA	NA
WP_003020732.1\|347297_348209_+	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_003841305.1\|348299_349313_+	two-component system response regulator RssB	NA	NA	NA	NA
WP_003020727.1\|349517_350426_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.7e-60	47.5
WP_003020723.1\|350562_350976_-	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
WP_003020720.1\|351586_352204_+	thymidine kinase	A0A0A0YP64	Citrobacter_phage	8.6e-53	54.3

DBSCAN-SWA_18

360634 : 363531

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003833364.1\|360634_361648_+	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppD	G9BWD6	Planktothrix_phage	4.5e-14	29.4
WP_003020696.1\|361644_362649_+	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G3M9Y6	Bacillus_virus	6.8e-15	30.2
WP_003020693.1\|362694_363531_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.4e-08	40.0

DBSCAN-SWA_19

372522 : 378995

Acinetobacter_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841287.1\|372522_373995_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.2e-17	30.4
WP_044710930.1\|374027_374834_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_003020645.1\|374833_376027_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_088903345.1\|376037_377396_-	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.9e-38	41.2
WP_003020639.1\|377399_378995_-	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	3.2e-51	38.6

DBSCAN-SWA_20

383973 : 389361

Chrysochromulina_ericina_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902209.1\|383973_384735_-	YciK family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	4.4e-06	23.2
WP_003843986.1\|384956_386003_+\|protease	protease SohB	NA	NA	NA	NA
WP_003020616.1\|386113_386365_-	YciN family protein	NA	NA	NA	NA
WP_003840713.1\|386763_389361_+	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	2.5e-85	34.7

DBSCAN-SWA_21

394205 : 394796

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020601.1\|394205_394796_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.7e-43	48.4

DBSCAN-SWA_22

402700 : 404635

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840726.1\|402700_404635_-	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	5.9e-07	24.5

DBSCAN-SWA_23

408024 : 409825

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020558.1\|408024_408831_-	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.3e-13	27.4
WP_003020556.1\|408832_409825_-	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	4.7e-08	24.7

DBSCAN-SWA_24

427782 : 428865

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700116.1\|427782_428865_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-23	34.7

DBSCAN-SWA_25

441149 : 444261

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003843948.1\|441149_441920_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.6e-18	29.1
WP_003840800.1\|442040_442424_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_088902219.1\|442757_443165_+	cupin domain-containing protein	NA	NA	NA	NA
WP_088902220.1\|443208_444261_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	2.7e-86	46.4

DBSCAN-SWA_26

447931 : 460398

Streptococcus_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049003283.1\|447931_448447_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.5e-23	53.5
WP_003843940.1\|448672_449236_+	DNA endonuclease SmrA	NA	NA	NA	NA
WP_003843938.1\|449248_450481_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	9.0e-17	34.4
WP_088902222.1\|450548_452663_-	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	3.4e-16	31.0
WP_088902223.1\|453074_454184_+	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-09	23.0
WP_003020379.1\|454336_455320_+	zinc transporter ZntB	NA	NA	NA	NA
WP_003843930.1\|455791_457165_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.6e-53	32.0
WP_003833209.1\|457258_458194_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.1e-139	93.8
WP_003020369.1\|458392_458827_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	9.4e-30	52.1
WP_003020366.1\|458908_459121_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_003843927.1\|459267_460398_-	porin OmpC	Q1MVN1	Enterobacteria_phage	1.4e-112	56.2

DBSCAN-SWA_27

465375 : 466365

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020354.1\|465375_466365_-	2-hydroxyacid dehydrogenase	M1HMI7	Paramecium_bursaria_Chlorella_virus	3.3e-70	42.8

DBSCAN-SWA_28

476978 : 480881

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902228.1\|476978_480881_+	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	7.6e-54	29.7

DBSCAN-SWA_29

485689 : 488083

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902230.1\|485689_486220_+	cytochrome b561	A0A0U2QLA7	Escherichia_phage	6.3e-20	44.9
WP_003020321.1\|486392_486812_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	3.9e-33	58.5
WP_048232098.1\|486814_488083_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	3.4e-197	78.4

DBSCAN-SWA_30

494838 : 497815

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836086.1\|494838_495957_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.1e-33	29.6
WP_049000740.1\|496126_497815_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-15	28.2

DBSCAN-SWA_31

513068 : 515030

Phage_TP(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902236.1\|513068_515030_+	U32 family peptidase	Q6DW11	Phage_TP	1.6e-23	27.8

DBSCAN-SWA_32

521299 : 522316

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020210.1\|521299_522316_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.5e-25	58.9

DBSCAN-SWA_33

551929 : 636004

Staphylococcus_prophage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|551929_552877_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_003020109.1\|553799_554480_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_003843701.1\|554476_555172_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_003020103.1\|555171_556716_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5
WP_088902243.1\|556712_560453_-	nitrate reductase subunit alpha	NA	NA	NA	NA
WP_003020098.1\|560502_561888_-	NarK family nitrate/nitrite MFS transporter	NA	NA	NA	NA
WP_046670695.1\|562099_562678_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_088902244.1\|562794_564279_+	MFS transporter	NA	NA	NA	NA
WP_085951544.1\|564282_564663_-	GFA family protein	NA	NA	NA	NA
WP_001161490.1\|565237_565798_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
WP_088902245.1\|565801_568768_+\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	99.9
WP_031285326.1\|569785_570733_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_003020082.1\|571401_572283_-	aromatic amino acid efflux DMT transporter YddG	NA	NA	NA	NA
WP_094544827.1\|572570_575618_+	formate dehydrogenase-N subunit alpha	NA	NA	NA	NA
WP_003833024.1\|575631_576516_+	formate dehydrogenase subunit beta	NA	NA	NA	NA
WP_088902248.1\|576508_577165_+	formate dehydrogenase-N subunit gamma	NA	NA	NA	NA
WP_003843693.1\|577294_577897_+	inorganic diphosphatase	A0A1B1ISK6	uncultured_Mediterranean_phage	4.5e-22	39.1
WP_088902249.1\|577976_579692_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	9.2e-36	25.9
WP_003836239.1\|580001_581699_-	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_003020039.1\|581878_582019_-	stationary-phase-induced ribosome-associated protein	NA	NA	NA	NA
WP_003020036.1\|582246_582678_+	peroxiredoxin OsmC	NA	NA	NA	NA
WP_088902250.1\|582725_583496_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_003020031.1\|583507_584899_-	GntP family permease	NA	NA	NA	NA
WP_003843687.1\|584939_585863_-	3-hydroxyacyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_016150251.1\|585852_587058_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_003020022.1\|587068_587725_-	CoA transferase subunit B	NA	NA	NA	NA
WP_003020020.1\|587727_588435_-	CoA transferase subunit A	NA	NA	NA	NA
WP_003020016.1\|588577_589468_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_057101492.1\|589487_590423_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.8e-14	29.2
WP_003836252.1\|590415_591402_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	32.0
WP_003836253.1\|591398_592295_-	D,D-dipeptide ABC transporter permease	NA	NA	NA	NA
WP_003020008.1\|592291_593314_-	ABC transporter permease	NA	NA	NA	NA
WP_003843680.1\|593358_594921_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003020004.1\|594936_595524_-	D-alanyl-D-alanine dipeptidase	NA	NA	NA	NA
WP_003843679.1\|595538_596405_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003019999.1\|596806_597136_+	acid-activated periplasmic chaperone HdeB	NA	NA	NA	NA
WP_044710762.1\|597291_599238_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-12	32.8
WP_044710761.1\|599414_599729_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088902251.1\|599721_600993_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_088902252.1\|601047_601569_+	hypothetical protein	NA	NA	NA	NA
WP_003836261.1\|601565_602933_-	glycoside hydrolase family 10 protein	NA	NA	NA	NA
WP_003019974.1\|602945_603233_-	DUF2132 domain-containing protein	NA	NA	NA	NA
WP_016150246.1\|603367_604693_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_088902253.1\|604695_606435_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	4.5e-30	34.6
WP_088902254.1\|606445_611776_-	heme peroxidase	NA	NA	NA	NA
WP_031285326.1\|612610_613558_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_003019947.1\|613868_614423_+	type 1 fimbrial protein	NA	NA	NA	NA
WP_003836267.1\|614467_615151_+	molecular chaperone	NA	NA	NA	NA
WP_088902255.1\|615137_617615_+	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_088902256.1\|617611_618955_+	fimbrial protein	NA	NA	NA	NA
WP_001407551.1\|619603_620620_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	4.4e-187	100.0
WP_088902257.1\|621124_624247_+	hypothetical protein	NA	NA	NA	NA
WP_088902258.1\|624424_626074_+	metallophosphoesterase	NA	NA	NA	NA
WP_000770925.1\|626070_626907_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_000248889.1\|627562_628342_+	DUF1837 domain-containing protein	NA	NA	NA	NA
WP_001542734.1\|628325_631859_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_001542733.1\|632438_632735_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000756958.1\|634142_634751_+	type 3 fimbria major subunit MrkA	NA	NA	NA	NA
WP_031285326.1\|635056_636004_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_34

640832 : 749710

114

Cronobacter_phage(18.18%)

terminase,integrase,holin,head,transposase,coat,tail

attL 683173:683188|attR 751864:751879

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001118619.1\|640832_641756_-\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	2.2e-177	100.0
WP_000043177.1\|642098_642575_-	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	4.1e-18	31.7
WP_001067855.1\|643711_644416_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001752509.1\|644742_645243_+	non-heme ferritin-like protein	NA	NA	NA	NA
WP_016947617.1\|645559_646540_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	6.8e-185	98.8
WP_112974666.1\|646584_646908_+	hypothetical protein	NA	NA	NA	NA
WP_044351353.1\|646904_647846_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_024223630.1\|648268_649435_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_000998254.1\|649987_651511_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	8.3e-89	38.7
WP_000248952.1\|651500_652685_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_000779017.1\|652681_653365_+	YecA family protein	NA	NA	NA	NA
WP_001077330.1\|653417_656702_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	8.1e-65	27.0
WP_001291050.1\|656698_657454_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_001088752.1\|657762_658323_-	hypothetical protein	NA	NA	NA	NA
WP_001542728.1\|658419_658752_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001140767.1\|658925_659429_-	hypothetical protein	NA	NA	NA	NA
WP_000169430.1\|661954_663625_-\|integrase	integrase	NA	NA	NA	NA
WP_000331940.1\|663587_665111_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_001567368.1\|665375_666779_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_001567369.1\|666807_667440_-	hypothetical protein	NA	NA	NA	NA
WP_001567368.1\|667658_669062_+\|transposase	ISNCY-like element ISKpn21 family transposase	NA	NA	NA	NA
WP_001567369.1\|669090_669723_-	hypothetical protein	NA	NA	NA	NA
WP_088902259.1\|670474_671233_+	trans-aconitate 2-methyltransferase	NA	NA	NA	NA
WP_088902260.1\|671365_671743_+	GFA family protein	NA	NA	NA	NA
WP_003843650.1\|671739_672687_-	hypothetical protein	NA	NA	NA	NA
WP_003843648.1\|672976_673864_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_088902261.1\|673878_674442_-	hypothetical protein	NA	NA	NA	NA
WP_057101501.1\|674460_675183_-	EAL domain-containing protein	NA	NA	NA	NA
WP_130714654.1\|675190_676015_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_088902262.1\|676310_678809_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_053088687.1\|678824_679529_-	molecular chaperone	NA	NA	NA	NA
WP_061549101.1\|679734_680286_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_046670673.1\|680885_682337_-	tagaturonate reductase	NA	NA	NA	NA
WP_049003240.1\|682443_682971_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088902263.1\|683052_683412_-	DUF4186 domain-containing protein	NA	NA	NA	NA
683173:683188	attL	NA	NA	NA	NA
WP_003032436.1\|683411_684338_-	glutaminase B	NA	NA	NA	NA
WP_088902264.1\|684400_685978_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.5e-12	21.3
WP_088902265.1\|686081_687470_-	succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003032431.1\|687573_688449_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003032430.1\|688671_689868_+	sugar transporter	NA	NA	NA	NA
WP_003032428.1\|689904_690570_-	MarC family NAAT transporter	NA	NA	NA	NA
WP_003832935.1\|690827_691262_+	multiple antibiotic resistance transcriptional regulator MarR	NA	NA	NA	NA
WP_003032424.1\|691280_691664_+	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	3.6e-09	32.3
WP_003032422.1\|691694_691913_+	multiple antibiotic resistance protein MarB	NA	NA	NA	NA
WP_088902266.1\|691943_692843_-	O-acetylserine/cysteine exporter	NA	NA	NA	NA
WP_061549097.1\|693041_694229_+	efflux MFS transporter YdeE	NA	NA	NA	NA
WP_054528371.1\|694272_694971_-	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	2.6e-13	25.6
WP_032935768.1\|694980_695778_-	urea ABC transporter ATP-binding protein UrtD	A0A285PWH2	Cedratvirus	2.1e-11	27.5
WP_044712398.1\|695777_696851_-	urea ABC transporter permease subunit UrtC	NA	NA	NA	NA
WP_088902267.1\|696850_698425_-	urea ABC transporter permease subunit UrtB	NA	NA	NA	NA
WP_003032408.1\|698468_699740_-	urea ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003032406.1\|700226_700322_+	protein MgtS	NA	NA	NA	NA
WP_088902268.1\|700606_701533_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.7e-18	36.0
WP_061549091.1\|701694_702351_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_088902269.1\|702971_703292_-	hypothetical protein	K7PGV5	Enterobacterial_phage	9.4e-19	47.1
WP_088902270.1\|703291_703531_-	hypothetical protein	K7P7N3	Enterobacteria_phage	4.8e-28	71.8
WP_088902271.1\|703622_703916_-	hypothetical protein	NA	NA	NA	NA
WP_088903350.1\|703908_705624_-\|tail	tail fiber domain-containing protein	A0A291NX30	Escherichia_phage	2.7e-43	47.0
WP_088902272.1\|706403_709487_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	53.9
WP_088902273.1\|709483_709864_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	9.1e-53	77.0
WP_154311465.1\|709897_710068_-	hypothetical protein	NA	NA	NA	NA
WP_088902274.1\|710071_710626_-	hypothetical protein	NA	NA	NA	NA
WP_088902275.1\|710681_711170_-	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	5.8e-52	64.3
WP_088902276.1\|711166_711637_-	hypothetical protein	A0A286S298	Klebsiella_phage	7.8e-54	57.4
WP_088902277.1\|711646_714559_-\|tail	tail protein (tape measure)	A0A2P1MXA9	Escherichia_phage	2.0e-83	38.9
WP_094544857.1\|714619_714997_-	hypothetical protein	NA	NA	NA	NA
WP_088902279.1\|714993_715326_-	hypothetical protein	NA	NA	NA	NA
WP_088903351.1\|715336_715588_-	hypothetical protein	H6WRV3	Salmonella_phage	1.7e-31	77.1
WP_088902280.1\|715782_716457_-	hypothetical protein	A0A1W6JNX2	Morganella_phage	9.4e-53	51.4
WP_088902281.1\|716517_717273_-	immunoglobulin domain-containing protein	F1C5E5	Cronobacter_phage	2.9e-74	81.7
WP_088902282.1\|717338_717722_-	hypothetical protein	F1C5E4	Cronobacter_phage	8.9e-40	63.8
WP_088902283.1\|717718_718159_-	hypothetical protein	A0A291AXD9	Shigella_phage	6.0e-32	48.6
WP_088902284.1\|718161_718518_-	hypothetical protein	G0ZNE2	Cronobacter_phage	8.8e-34	61.5
WP_088902285.1\|718690_719071_-	hypothetical protein	F1C5E2	Cronobacter_phage	7.0e-29	54.5
WP_088902286.1\|719147_719549_-	hypothetical protein	NA	NA	NA	NA
WP_088902287.1\|719559_720654_-\|coat	phage coat protein	F1C5E1	Cronobacter_phage	2.9e-120	62.5
WP_088902288.1\|720665_721094_-	hypothetical protein	F1C5E0	Cronobacter_phage	3.1e-41	60.8
WP_088902289.1\|721097_722480_-	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	1.6e-131	58.5
WP_088902290.1\|722708_723455_-	hypothetical protein	NA	NA	NA	NA
WP_088902291.1\|723501_724497_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	5.4e-105	63.7
WP_088902292.1\|724423_725899_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	1.4e-154	59.9
WP_088902293.1\|725909_727472_-\|terminase	terminase	G8C7P3	Escherichia_phage	2.7e-292	89.2
WP_088902294.1\|727468_728041_-\|terminase	terminase small subunit	I6PDJ6	Cronobacter_phage	9.1e-65	80.6
WP_088902295.1\|728061_728673_+	hypothetical protein	NA	NA	NA	NA
WP_143759628.1\|728839_729373_+	YkgJ family cysteine cluster protein	M4SZX9	Cyanophage	4.3e-08	28.9
WP_088902296.1\|729661_729934_-	hypothetical protein	G8C7W1	Escherichia_phage	6.1e-19	61.6
WP_088902297.1\|729930_730473_-	glycoside hydrolase family 108 protein	A0A0U2I1S0	Escherichia_phage	4.6e-74	71.2
WP_088902298.1\|730469_730748_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_088902299.1\|730744_731143_-	hypothetical protein	NA	NA	NA	NA
WP_088902300.1\|731631_732414_-	antitermination protein	K7PKS8	Enterobacteria_phage	4.2e-105	71.7
WP_088902301.1\|732410_732551_-	YlcG family protein	A0A0M5M7B2	Salmonella_phage	2.1e-07	76.3
WP_088902302.1\|732547_732766_-	hypothetical protein	NA	NA	NA	NA
WP_088902303.1\|732762_733395_-	hypothetical protein	H6WRY9	Salmonella_phage	4.7e-46	49.1
WP_088902304.1\|733397_733598_-	hypothetical protein	S4TNP0	Salmonella_phage	1.9e-14	54.5
WP_088902305.1\|733602_734202_-	DUF1367 family protein	A0A0M4QX23	Salmonella_phage	4.7e-96	85.8
WP_088902307.1\|735032_736895_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	2.6e-193	54.6
WP_088902308.1\|736891_737638_-	class I SAM-dependent methyltransferase	H9C170	Pectobacterium_phage	3.6e-69	79.7
WP_088902309.1\|737643_738066_-	hypothetical protein	NA	NA	NA	NA
WP_088902310.1\|738062_738500_-	hypothetical protein	A0A2H4N7F5	Pectobacterium_phage	1.1e-14	61.7
WP_088902311.1\|738492_738756_-	DUF977 family protein	H6WRX9	Salmonella_phage	3.2e-25	68.8
WP_088902312.1\|738768_739458_-	phage replication protein	G8C7U6	Escherichia_phage	3.3e-77	59.8
WP_088903352.1\|739441_740428_-	replication protein	A5VW95	Enterobacteria_phage	9.9e-51	76.4
WP_088902313.1\|740612_741170_-	hypothetical protein	K7P7P2	Enterobacteria_phage	1.0e-20	39.6
WP_088902314.1\|741172_741403_-	hypothetical protein	H6WRX5	Salmonella_phage	1.4e-11	44.0
WP_088902315.1\|741517_741931_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_088902316.1\|742126_742333_+	hypothetical protein	NA	NA	NA	NA
WP_088902317.1\|742332_742530_+	DUF1482 family protein	NA	NA	NA	NA
WP_088903353.1\|742781_743069_+	DNA breaking-rejoining protein	H6WRX2	Salmonella_phage	9.6e-31	56.8
WP_088902319.1\|743196_746178_+	exodeoxyribonuclease VIII	K7PJT5	Enterobacteria_phage	1.1e-311	67.2
WP_088903354.1\|746192_747302_+	recombinase RecT	K7PKR8	Enterobacteria_phage	1.0e-184	88.9
WP_143759627.1\|747336_748047_+	hypothetical protein	M1F3E2	Salmonella_phage	1.3e-65	57.9
WP_088902320.1\|748033_748273_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	1.0e-30	89.7
WP_072140054.1\|748332_748590_+	hypothetical protein	NA	NA	NA	NA
WP_088902321.1\|748570_749710_+\|integrase	tyrosine-type recombinase/integrase	Q77Z04	Phage_21	1.7e-91	47.6
751864:751879	attR	NA	NA	NA	NA

DBSCAN-SWA_35

753755 : 759779

Salmonella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003032393.1\|753755_753959_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	2.9e-13	55.2
WP_088902323.1\|754034_755501_-	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	1.2e-44	32.2
WP_044712387.1\|755665_757045_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.3e-29	26.1
WP_088902324.1\|757097_758117_-	Zn-dependent oxidoreductase	NA	NA	NA	NA
WP_003032386.1\|758130_759345_-	starvation-sensing protein RspA	Q6A202	Oenococcus_phage	2.5e-48	29.9
WP_003032384.1\|759452_759779_-	YnfA family protein	A0A218MNG8	uncultured_virus	2.2e-23	54.9

DBSCAN-SWA_36

764596 : 766727

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902326.1\|764596_765214_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.6e-75	59.1
WP_088902327.1\|765215_766070_+	dimethylsulfoxide reductase	NA	NA	NA	NA
WP_003028918.1\|766112_766727_+	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	4.0e-26	36.0

DBSCAN-SWA_37

773384 : 775594

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902329.1\|773384_774875_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.1e-24	30.3
WP_049002684.1\|774871_775594_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-35	36.1

DBSCAN-SWA_38

806522 : 808115

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902340.1\|806522_808115_+	PTS maltose transporter subunit IICB	A0A2I7SAJ6	Vibrio_phage	1.7e-07	45.9

DBSCAN-SWA_39

823144 : 824419

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836431.1\|823144_824419_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.0e-87	42.6

DBSCAN-SWA_40

831336 : 831861

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049015502.1\|831336_831861_-	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	6.0e-47	56.0

DBSCAN-SWA_41

836963 : 848005

Streptomyces_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032935840.1\|836963_837794_+	C40 family peptidase	A0A2H5BM69	Streptomyces_phage	2.4e-18	41.6
WP_003029205.1\|837921_838503_+	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	3.4e-43	46.0
WP_088902345.1\|838542_839712_-	MFS transporter	NA	NA	NA	NA
WP_003029209.1\|839887_839977_-	stress response protein YnhF	NA	NA	NA	NA
WP_003029211.1\|840274_841300_+	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	8.2e-32	31.3
WP_003029215.1\|841296_842229_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003843529.1\|842342_843548_+	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003029219.1\|843838_844987_+	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.2e-84	44.9
WP_088902346.1\|845028_845676_-	riboflavin synthase subunit alpha	A0A2I2L4R9	Orpheovirus	1.2e-23	37.3
WP_003836464.1\|845893_847267_+	multidrug efflux MATE transporter MdtK	NA	NA	NA	NA
WP_057101523.1\|847306_848005_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.1e-08	29.4

DBSCAN-SWA_42

854624 : 858286

Canarypox_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902350.1\|854624_855107_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.3e-23	41.4
WP_003836479.1\|855272_856382_+	AI-2E family transporter	NA	NA	NA	NA
WP_088902351.1\|856501_858286_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.8e-19	35.0

DBSCAN-SWA_43

862056 : 863118

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902353.1\|862056_863118_+	DUF262 domain-containing protein	A0A0R6PJX3	Moraxella_phage	4.3e-52	37.4

DBSCAN-SWA_44

871073 : 883716

Staphylococcus_phage(11.11%)

transposase,integrase

attL 873739:873753|attR 878565:878579

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075335826.1\|871073_872234_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.0e-39	36.4
WP_088902365.1\|872322_873096_-	hypothetical protein	G9IA57	Pseudomonas_phage	8.0e-40	39.6
WP_085950818.1\|873198_874319_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
873739:873753	attL	NA	NA	NA	NA
WP_088902366.1\|874482_875490_-	DUF968 domain-containing protein	A0A1W6JP62	Morganella_phage	4.2e-57	36.0
WP_088902367.1\|875473_876052_-	S-adenosylmethionine-binding protein	A0A193GYV6	Enterobacter_phage	2.9e-79	71.7
WP_088902368.1\|876391_876709_+\|integrase	tyrosine-type recombinase/integrase	A0A0U2JGI6	Escherichia_phage	2.7e-26	57.0
WP_088902369.1\|877186_877909_+	solute-binding protein	NA	NA	NA	NA
WP_003836510.1\|877895_878648_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.9e-09	25.5
878565:878579	attR	NA	NA	NA	NA
WP_088902370.1\|878644_879649_-	iron ABC transporter permease	NA	NA	NA	NA
WP_003029285.1\|879635_880691_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003843512.1\|880871_882134_-	4-aminobutyrate transaminase	A0A1V0SKB7	Klosneuvirus	8.0e-21	25.4
WP_088902371.1\|882240_883716_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.6e-15	28.1

DBSCAN-SWA_45

893650 : 898197

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029322.1\|893650_894469_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-37	43.6
WP_088902374.1\|894468_895254_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003029326.1\|895243_895921_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003836540.1\|895930_896743_-	hypothetical protein	A0A077K9W7	Edwardsiella_phage	6.8e-05	32.5
WP_003029330.1\|896746_897532_-	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_088903357.1\|897528_898197_-	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	1.6e-23	37.2

DBSCAN-SWA_46

901878 : 902826

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|901878_902826_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_47

906162 : 906915

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085951548.1\|906162_906915_+	tetrathionate reductase subunit TtrB	A0A077SL61	Escherichia_phage	8.7e-23	40.0

DBSCAN-SWA_48

912332 : 916412

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902377.1\|912332_913301_+	hypothetical protein	A0A2H4J6N0	uncultured_Caudovirales_phage	2.0e-16	23.8
WP_003836560.1\|913269_913686_+	hypothetical protein	NA	NA	NA	NA
WP_155404704.1\|913725_913872_-	hypothetical protein	NA	NA	NA	NA
WP_088902378.1\|913894_914707_-	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003029361.1\|914728_915397_-	ABC transporter permease	NA	NA	NA	NA
WP_088902379.1\|915389_916412_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.7e-32	35.1

DBSCAN-SWA_49

925200 : 930291

environmental_halophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902381.1\|925200_926421_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.9e-96	42.9
WP_088902382.1\|926417_927689_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003029383.1\|927663_928410_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	5.8e-11	31.3
WP_088902383.1\|928426_929914_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_003029385.1\|929922_930291_-	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	5.6e-15	39.4

DBSCAN-SWA_50

950763 : 957181

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902389.1\|950763_952401_+	medium-chain fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	3.4e-32	29.9
WP_003030548.1\|952468_954847_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.0e-169	36.2
WP_003030553.1\|955174_956008_+	posphoenolpyruvate synthetase regulatory kinase/phosphorylase PpsR	NA	NA	NA	NA
WP_003030555.1\|956134_957181_+	3-deoxy-7-phosphoheptulonate synthase AroH	A0A0B5IW14	Pandoravirus	8.8e-82	47.1

DBSCAN-SWA_51

962477 : 977220

Tupanvirus(22.22%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836641.1\|962477_963257_+	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	7.9e-11	26.7
WP_016150131.1\|963253_964696_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	7.7e-52	35.3
WP_001395480.1\|964733_965765_-\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_003836643.1\|965912_966626_-	EAL domain-containing protein	NA	NA	NA	NA
WP_003836644.1\|966942_967407_-	lipoprotein nlpC	A0A1V0DZX6	Clostridioides_phage	3.5e-14	38.2
WP_088902391.1\|967484_968234_-	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	1.2e-08	30.3
WP_003030569.1\|968233_968785_-	glutathione peroxidase	NA	NA	NA	NA
WP_003832584.1\|968845_969826_-	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	6.7e-15	24.8
WP_003030571.1\|969979_970279_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_088902392.1\|970283_972671_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003832580.1\|972686_973670_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.4e-33	38.5
WP_152659856.1\|973869_974001_-	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_003030578.1\|974039_974396_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003030583.1\|974451_974649_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_048997935.1\|974745_975288_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	8.2e-15	32.9
WP_003832572.1\|975291_977220_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.4e-127	36.8

DBSCAN-SWA_52

982483 : 988233

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902394.1\|982483_983245_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	5.3e-20	32.1
WP_086551139.1\|983328_983928_+	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	1.0e-05	33.6
WP_088902395.1\|984063_985455_+	L-cystine transporter	NA	NA	NA	NA
WP_080602219.1\|985518_985773_-	cell division activator CedA	NA	NA	NA	NA
WP_003843454.1\|985974_988233_+	catalase HPII	A0A2K9L572	Tupanvirus	1.7e-138	47.6

DBSCAN-SWA_53

994383 : 995214

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936096.1\|994383_995214_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.0e-73	54.9

DBSCAN-SWA_54

1002759 : 1003980

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840894.1\|1002759_1003980_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	4.2e-27	28.6

DBSCAN-SWA_55

1009514 : 1010147

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902404.1\|1009514_1010147_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.3e-15	31.7

DBSCAN-SWA_56

1015198 : 1017145

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030667.1\|1015198_1017145_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.3e-40	29.7

DBSCAN-SWA_57

1021972 : 1022617

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157676218.1\|1021972_1022617_+	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	6.1e-17	37.2

DBSCAN-SWA_58

1026203 : 1030347

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846646.1\|1026203_1027187_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	4.3e-06	23.4
WP_003846648.1\|1027196_1028144_-	carbohydrate kinase family protein	NA	NA	NA	NA
WP_048219048.1\|1028148_1028985_-	ketose-bisphosphate aldolase	NA	NA	NA	NA
WP_031285326.1\|1029399_1030347_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_59

1033939 : 1035193

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049003657.1\|1033939_1035193_+	glycoside hydrolase family 18 protein	A0A2K9L3D4	Tupanvirus	4.1e-25	30.1

DBSCAN-SWA_60

1043074 : 1046848

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030708.1\|1043074_1044358_+	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	1.9e-09	26.6
WP_044700039.1\|1044423_1045194_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_088902411.1\|1045357_1046848_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.4e-11	28.8

DBSCAN-SWA_61

1051752 : 1052778

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902413.1\|1051752_1052778_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-10	26.3

DBSCAN-SWA_62

1059533 : 1060328

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846680.1\|1059533_1060328_-	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	3.7e-08	29.7

DBSCAN-SWA_63

1070368 : 1085662

uncultured_Caudovirales_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902418.1\|1070368_1070863_-	outer membrane beta-barrel protein	A0A1B0VBR9	Salmonella_phage	3.4e-07	32.4
WP_003030760.1\|1071743_1072169_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	7.3e-51	70.7
WP_016150088.1\|1072181_1073471_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	3.2e-166	70.4
WP_003030762.1\|1073515_1073836_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	3.2e-19	44.8
WP_008320415.1\|1073921_1074620_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.8e-89	68.1
WP_003840850.1\|1075006_1075249_+	DinI family protein	Q6UAW0	Klebsiella_phage	1.5e-29	77.9
WP_003030767.1\|1075338_1075848_+	hypothetical protein	NA	NA	NA	NA
WP_096878644.1\|1075983_1076136_-	isocitrate dehydrogenase	Q77Z09	Phage_21	3.1e-20	94.0
WP_143759644.1\|1079029_1080538_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-44	31.8
WP_052953619.1\|1080846_1081257_+	hypothetical protein	NA	NA	NA	NA
WP_001254932.1\|1081703_1082855_+\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
WP_001000409.1\|1083349_1084885_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	2.0e-260	87.7
WP_000609174.1\|1084934_1085282_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.7e-59	95.7
WP_001201739.1\|1085278_1085662_-	IS66 family insertion sequence hypothetical protein	Q6H9S5	Enterobacteria_phage	3.0e-11	50.0

DBSCAN-SWA_64

1090998 : 1093645

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075335826.1\|1090998_1092159_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.0e-39	36.4
WP_088902426.1\|1092394_1093645_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	4.2e-22	96.3

DBSCAN-SWA_65

1097754 : 1100085

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846707.1\|1097754_1099125_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	8.5e-109	45.3
WP_044711949.1\|1099545_1100085_+	cytochrome b	A0A0U2QLA7	Escherichia_phage	5.8e-45	78.1

DBSCAN-SWA_66

1110928 : 1118639

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030791.1\|1110928_1112065_+	spermidine/putrescine ABC transporter ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	7.2e-29	40.3
WP_003030793.1\|1112048_1112906_+	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	4.3e-10	25.8
WP_003030794.1\|1112902_1113682_+	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_003030797.1\|1113709_1114756_+	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
WP_003030799.1\|1114855_1115677_-	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	3.3e-23	36.1
WP_003030802.1\|1115692_1116604_-	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_088902431.1\|1116693_1117938_-	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_003030805.1\|1117937_1118639_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.9e-36	40.3

DBSCAN-SWA_67

1125923 : 1126181

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030810.1\|1125923_1126181_-	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	2.8e-05	35.7

DBSCAN-SWA_68

1162435 : 1165833

uncultured_Caudovirales_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902446.1\|1162435_1163392_+	Fe(3+) dicitrate ABC transporter permease subunit FecD	A0A2H4IY97	uncultured_Caudovirales_phage	5.3e-17	27.9
WP_088902447.1\|1163392_1164160_+	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-12	27.9
WP_003836713.1\|1164249_1164465_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_075335826.1\|1164672_1165833_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.0e-39	36.4

DBSCAN-SWA_69

1175845 : 1177488

Dinoroseobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902452.1\|1175845_1176850_-	DNA polymerase III subunit delta'	A0A1V0DYC6	Dinoroseobacter_phage	1.4e-07	34.0
WP_088902453.1\|1176846_1177488_-	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.7e-27	38.2

DBSCAN-SWA_70

1180774 : 1181901

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000103754.1\|1180774_1181011_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.5e-10	45.2
WP_003036255.1\|1181166_1181901_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	7.7e-16	34.1

DBSCAN-SWA_71

1196639 : 1197590

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836755.1\|1196639_1197590_-	flagellar assembly peptidoglycan hydrolase FlgJ	S5M633	Brevibacillus_phage	1.6e-10	30.9

DBSCAN-SWA_72

1212825 : 1213071

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036157.1\|1212825_1213071_+	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	1.1e-14	50.0

DBSCAN-SWA_73

1217790 : 1221571

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036136.1\|1217790_1218711_+	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	1.0e-57	41.6
WP_088902464.1\|1220149_1221571_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.3e-19	36.7

DBSCAN-SWA_74

1229787 : 1230330

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149912.1\|1229787_1230330_-	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	4.2e-27	49.3

DBSCAN-SWA_75

1234519 : 1238324

Pelagibacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036082.1\|1234519_1235353_+	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	3.0e-40	39.7
WP_044700707.1\|1235399_1235882_-	DUF1097 domain-containing protein	NA	NA	NA	NA
WP_003036073.1\|1235983_1236538_-	molecular chaperone	NA	NA	NA	NA
WP_003836800.1\|1236561_1237299_-	phosphatase	NA	NA	NA	NA
WP_016149909.1\|1237385_1238324_-	glyoxylate/hydroxypyruvate reductase GhrA	A0A1B1IVB5	uncultured_Mediterranean_phage	3.2e-06	28.5

DBSCAN-SWA_76

1243059 : 1243968

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085951551.1\|1243059_1243968_-	phosphate starvation-inducible protein PhoH	R4II13	Cronobacter_phage	6.9e-91	77.1

DBSCAN-SWA_77

1256009 : 1256183

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036022.1\|1256009_1256183_-	general stress protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_78

1265544 : 1266465

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035957.1\|1265544_1266465_+	curved DNA-binding protein	A0A1V0SIM1	Klosneuvirus	3.6e-10	39.0

DBSCAN-SWA_79

1274137 : 1274953

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061548786.1\|1274137_1274953_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.0e-13	27.3

DBSCAN-SWA_80

1281012 : 1281672

uncultured_Caudovirales_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035917.1\|1281012_1281672_+\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	8.9e-48	55.3

DBSCAN-SWA_81

1285922 : 1287977

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902478.1\|1285922_1287977_-	DNA helicase IV	A7KV33	Bacillus_phage	1.9e-19	27.6

DBSCAN-SWA_82

1300534 : 1302442

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836846.1\|1300534_1302442_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.1e-49	28.4

DBSCAN-SWA_83

1311208 : 1317697

Bacillus_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902485.1\|1311208_1311976_+	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-30	37.6
WP_044712519.1\|1312047_1314660_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	4.1e-19	21.7
WP_003836860.1\|1314926_1316129_+	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
WP_003035832.1\|1316296_1317697_+\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	5.0e-80	35.9

DBSCAN-SWA_84

1321485 : 1322034

Rhodobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035820.1\|1321485_1322034_-	YcbK family protein	A0A0K1LKR7	Rhodobacter_phage	3.5e-05	32.6

DBSCAN-SWA_85

1336771 : 1341312

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035784.1\|1336771_1338520_-	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	2.4e-60	30.7
WP_088902488.1\|1338556_1340821_-	ComEC family protein	NA	NA	NA	NA
WP_003035780.1\|1341027_1341312_-	integration host factor subunit beta	A7KV42	Bacillus_phage	9.2e-10	39.1

DBSCAN-SWA_86

1346366 : 1347455

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847007.1\|1346366_1347455_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	5.9e-81	46.2

DBSCAN-SWA_87

1351579 : 1354788

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035753.1\|1351579_1353862_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.8e-162	42.0
WP_003035751.1\|1354047_1354788_+	pyruvate formate lyase-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.0e-20	26.5

DBSCAN-SWA_88

1359601 : 1365639

Escherichia_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035741.1\|1359601_1360219_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	2.8e-75	59.1
WP_048219186.1\|1360229_1362674_-	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	6.0e-222	50.6
WP_088902490.1\|1362910_1364203_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.8e-93	48.2
WP_003836910.1\|1364295_1365639_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	4.3e-81	40.8

DBSCAN-SWA_89

1371609 : 1376181

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035727.1\|1371609_1372578_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.9e-62	44.3
WP_088902491.1\|1372692_1374459_+	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	1.4e-23	26.2
WP_003847023.1\|1374459_1376181_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	W8CYL7	Bacillus_phage	8.1e-16	23.6

DBSCAN-SWA_90

1381008 : 1472299

Cronobacter_phage(55.1%)

capsid,holin,integrase,portal,head,transposase,terminase,tail

attL 1444011:1444070|attR 1467726:1468814

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044701666.1\|1381008_1382136_-	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	1.6e-28	27.4
WP_003035378.1\|1382177_1382666_-	YbjO family protein	NA	NA	NA	NA
WP_003035376.1\|1382725_1383571_-	putrescine ABC transporter permease PotI	NA	NA	NA	NA
WP_003035374.1\|1383567_1384521_-	putrescine ABC transporter permease PotH	NA	NA	NA	NA
WP_003035373.1\|1384530_1385664_-	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	1.1e-29	34.9
WP_003035370.1\|1385802_1386915_-	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
WP_003035368.1\|1387348_1387825_-	YbjN domain-containing protein	NA	NA	NA	NA
WP_003836932.1\|1387915_1388818_-	30S ribosomal protein S6--L-glutamate ligase	I3ULC9	Synechococcus_phage	2.0e-37	34.0
WP_003836934.1\|1388877_1389600_-	nitroreductase NfsA	NA	NA	NA	NA
WP_003845523.1\|1389583_1389874_-	YbjC family protein	NA	NA	NA	NA
WP_003035358.1\|1390046_1390310_+	glutaredoxin, GrxA family	A0A2I7SAE2	Vibrio_phage	3.8e-26	67.9
WP_003035356.1\|1390344_1390725_-	membrane protein	NA	NA	NA	NA
WP_003035354.1\|1390994_1392680_+	transporter	NA	NA	NA	NA
WP_088902493.1\|1393212_1394424_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	6.6e-190	89.9
WP_005323562.1\|1395322_1396240_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.6e-101	59.5
WP_088902494.1\|1396459_1397374_-	DMT family transporter	NA	NA	NA	NA
WP_088902495.1\|1397476_1398391_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003035341.1\|1398396_1398945_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003836950.1\|1399030_1400239_+	MFS transporter	NA	NA	NA	NA
WP_003035335.1\|1400238_1401054_+	HAD family hydrolase	NA	NA	NA	NA
WP_003035330.1\|1401161_1401443_+	hypothetical protein	NA	NA	NA	NA
WP_003836956.1\|1401471_1402704_-	MFS transporter	NA	NA	NA	NA
WP_058842573.1\|1403002_1403611_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_003836960.1\|1403675_1404434_+	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	3.9e-15	28.8
WP_003035316.1\|1404479_1405682_-	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.9e-97	47.1
WP_088902496.1\|1406010_1406637_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_088902497.1\|1406642_1407740_-	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_003845496.1\|1407842_1408226_-	biofilm formation regulator BssR	NA	NA	NA	NA
WP_003035305.1\|1408455_1409781_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_003836970.1\|1410749_1411670_-	glutathione ABC transporter permease GsiC	NA	NA	NA	NA
WP_088902498.1\|1411716_1413255_-	glutathione ABC transporter substrate-binding protein GsiB	NA	NA	NA	NA
WP_058842491.1\|1413283_1415155_-	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	3.7e-14	27.2
WP_003836974.1\|1415141_1416107_-	beta-aspartyl-peptidase	NA	NA	NA	NA
WP_088902499.1\|1416298_1417087_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_044701113.1\|1417262_1418498_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_049016251.1\|1418497_1419247_+	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_088902500.1\|1419295_1420225_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.9e-67	49.8
WP_049003174.1\|1420404_1421067_-	fructose-6-phosphate aldolase	A0A1D8KKK9	Synechococcus_phage	8.5e-22	31.3
WP_048998117.1\|1421199_1422099_+	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_003845442.1\|1422104_1424537_+	glycyl radical protein	A0A076YHZ7	Citrobacter_phage	2.3e-08	50.9
WP_003836989.1\|1424703_1425519_+	HAD family hydrolase	NA	NA	NA	NA
WP_003035273.1\|1425672_1426935_+	DUF1479 domain-containing protein	NA	NA	NA	NA
WP_003035269.1\|1427078_1428674_-	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	8.5e-60	28.5
WP_003845438.1\|1428906_1429827_+	L,D-transpeptidase	NA	NA	NA	NA
WP_048241350.1\|1429921_1431031_-	anion transporter	NA	NA	NA	NA
WP_088902501.1\|1431027_1431501_-	manganese-binding transcriptional regulator MntR	NA	NA	NA	NA
WP_086551047.1\|1431868_1433344_-	hypothetical protein	NA	NA	NA	NA
WP_136397674.1\|1434034_1435735_-	hypothetical protein	F1BUJ7	Cronobacter_phage	1.2e-224	80.2
WP_086551045.1\|1435737_1436283_-	hypothetical protein	F1BUJ9	Cronobacter_phage	7.4e-64	72.0
WP_086551044.1\|1436254_1436980_-	hypothetical protein	F1BUK1	Cronobacter_phage	8.9e-65	53.9
WP_088902502.1\|1436969_1437506_-\|tail	phage tail protein	F1BUK2	Cronobacter_phage	2.4e-22	37.0
WP_088902503.1\|1437517_1439614_-\|tail	phage tail protein	F1BUK3	Cronobacter_phage	2.7e-146	78.1
WP_088902504.1\|1439623_1440211_-	hypothetical protein	F1BUK5	Cronobacter_phage	5.3e-92	82.6
WP_088902505.1\|1440203_1441388_-	hypothetical protein	F1BUK6	Cronobacter_phage	3.8e-182	80.7
WP_088902506.1\|1441384_1441714_-	DUF2590 family protein	F1BUK8	Cronobacter_phage	7.9e-37	67.9
WP_088902507.1\|1441710_1443771_-\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	6.9e-272	69.5
1444011:1444070	attL	NA	NA	NA	NA
WP_031285326.1\|1444046_1444994_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_143759646.1\|1445084_1445306_-	hypothetical protein	A5X9I7	Aeromonas_virus	1.2e-12	59.4
WP_088902510.1\|1445410_1445791_-	hypothetical protein	F1BUL2	Cronobacter_phage	7.0e-29	64.0
WP_088902511.1\|1445790_1446132_-	M15 family metallopeptidase	F1BUL3	Cronobacter_phage	1.5e-51	93.1
WP_001155240.1\|1446118_1446421_-\|holin	holin	A0A0M5M1H1	Salmonella_phage	4.0e-19	54.3
WP_000044253.1\|1446431_1446887_-	DUF2597 family protein	F1BUL4	Cronobacter_phage	5.9e-59	72.8
WP_088902512.1\|1446883_1448011_-	DUF2586 family protein	F1BUL5	Cronobacter_phage	1.1e-173	81.9
WP_088902513.1\|1448007_1448715_-	hypothetical protein	F1BUL6	Cronobacter_phage	3.1e-99	74.8
WP_021293728.1\|1448711_1449218_-\|tail	phage tail protein	F1BUL7	Cronobacter_phage	6.2e-65	68.7
WP_021293727.1\|1449214_1449703_-\|head	head completion/stabilization protein	F1BUL8	Cronobacter_phage	1.1e-63	82.7
WP_086551035.1\|1449763_1450465_-\|terminase	terminase	F1BUM0	Cronobacter_phage	2.6e-90	69.4
WP_003838043.1\|1450468_1451491_-\|capsid	phage major capsid protein, P2 family	F1BUM2	Cronobacter_phage	1.0e-159	81.8
WP_086551034.1\|1451552_1452356_-\|capsid	phage capsid protein	F1BUM4	Cronobacter_phage	1.3e-80	56.8
WP_088902514.1\|1452517_1454293_+\|terminase	terminase	F1BUM5	Cronobacter_phage	4.2e-294	86.3
WP_086551032.1\|1454289_1455351_+\|portal	phage portal protein	F1BUM7	Cronobacter_phage	7.9e-163	77.8
WP_012602735.1\|1455347_1455671_+	ogr/Delta-like zinc finger family protein	F1BUM8	Cronobacter_phage	4.7e-50	93.3
WP_000364823.1\|1455644_1455851_-	hypothetical protein	NA	NA	NA	NA
WP_136397895.1\|1455970_1457986_-	replication endonuclease	F1BUM9	Cronobacter_phage	2.6e-300	75.1
WP_086551030.1\|1457987_1458200_-	hypothetical protein	NA	NA	NA	NA
WP_000279403.1\|1458196_1459066_-	DNA adenine methylase	F1BUN1	Cronobacter_phage	1.1e-130	81.7
WP_086551029.1\|1459056_1459290_-	DUF2732 family protein	NA	NA	NA	NA
WP_000974860.1\|1459357_1459759_-	hypothetical protein	F1BUN2	Cronobacter_phage	2.2e-49	66.9
WP_001018326.1\|1459758_1460187_-	hypothetical protein	F1BUN5	Cronobacter_phage	1.9e-27	54.0
WP_000460873.1\|1460377_1460881_-	hypothetical protein	F1BUN6	Cronobacter_phage	1.3e-59	71.9
WP_001247709.1\|1460911_1461133_-	hypothetical protein	NA	NA	NA	NA
WP_000102872.1\|1461268_1461850_+	phage repressor protein	F1BUS8	Erwinia_phage	1.4e-33	40.9
WP_000116248.1\|1461851_1462907_+\|integrase	tyrosine-type recombinase/integrase	A0A218M4I3	Erwinia_phage	2.8e-120	63.2
WP_086551026.1\|1462927_1463509_-	hypothetical protein	NA	NA	NA	NA
WP_003836996.1\|1463960_1464089_+	manganase accumulation protein MntS	NA	NA	NA	NA
WP_057063402.1\|1464365_1465952_+	phosphoethanolamine transferase	NA	NA	NA	NA
WP_003035257.1\|1466016_1466532_-	outer membrane protein OmpX	A5LH44	Enterobacteria_phage	1.9e-16	33.7
WP_088902515.1\|1466885_1467779_+	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_031285326.1\|1467761_1468709_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_032936399.1\|1469167_1469671_+	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	5.5e-05	27.7
1467726:1468814	attR	NA	NA	NA	NA
WP_003035251.1\|1470036_1470783_+	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_003035248.1\|1470920_1471580_+	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_003035246.1\|1471576_1472299_+	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	2.8e-34	41.1

DBSCAN-SWA_91

1478671 : 1489812

Synechococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902519.1\|1478671_1479349_+	PKHD-type hydroxylase YbiX	Q5GQB0	Synechococcus_phage	1.5e-18	30.6
WP_003035233.1\|1479424_1479691_+	DksA/TraR family C4-type zinc finger protein	A0A2C9CZU7	Yersinia_phage	3.6e-16	51.1
WP_003035231.1\|1479994_1480255_+	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_088902520.1\|1480352_1481438_-	malate/lactate/ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_003035227.1\|1481600_1482569_-	DNA-binding protein YbiB	NA	NA	NA	NA
WP_003837021.1\|1482598_1484749_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	2.8e-42	27.3
WP_088902521.1\|1484845_1486192_-	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.0e-53	34.0
WP_088902522.1\|1486413_1487091_+	transcriptional regulator CecR	NA	NA	NA	NA
WP_032938552.1\|1487087_1488083_+	secretion protein HlyD	NA	NA	NA	NA
WP_003845404.1\|1488075_1489812_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-17	31.5

DBSCAN-SWA_92

1499635 : 1504180

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902524.1\|1499635_1500544_+	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	4.6e-26	30.7
WP_003837055.1\|1500666_1502688_-	excinuclease ABC subunit B	NA	NA	NA	NA
WP_136345716.1\|1503098_1503446_+	hypothetical protein	NA	NA	NA	NA
WP_003035181.1\|1503457_1504180_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-09	25.5

DBSCAN-SWA_93

1507846 : 1511286

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058842497.1\|1507846_1509136_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	8.2e-21	28.8
WP_003845384.1\|1509193_1509670_+	kinase inhibitor	NA	NA	NA	NA
WP_088902527.1\|1509765_1511286_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.3e-81	40.7

DBSCAN-SWA_94

1516466 : 1517092

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902529.1\|1516466_1516847_-	DNA polymerase V	K7P6F7	Enterobacteria_phage	9.1e-45	67.2
WP_088902530.1\|1516849_1517092_-	DNA polymerase V	I6PD82	Cronobacter_phage	9.3e-19	56.4

DBSCAN-SWA_95

1520253 : 1566153

Cronobacter_phage(22.95%)

holin,integrase,head,terminase,lysis,coat

attL 1516244:1516266|attR 1566222:1566244

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1516244:1516266	attL	NA	NA	NA	NA
WP_088902532.1\|1520253_1523331_-	kinase	A0A286S259	Klebsiella_phage	6.8e-308	52.8
WP_088902533.1\|1523327_1523708_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	9.7e-55	78.6
WP_088902534.1\|1523717_1524200_-	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	7.0e-58	68.6
WP_088902535.1\|1524196_1524667_-	hypothetical protein	A0A286S298	Klebsiella_phage	6.6e-53	56.1
WP_088902536.1\|1524666_1528092_-	tape measure protein	Q5G8W8	Enterobacteria_phage	1.0e-131	39.9
WP_088902537.1\|1528156_1528564_-	hypothetical protein	NA	NA	NA	NA
WP_088902538.1\|1528691_1529381_-	hypothetical protein	F1C5E8	Cronobacter_phage	2.6e-66	53.9
WP_088902539.1\|1529432_1530188_-	Ig domain-containing protein	G0ZNE6	Cronobacter_phage	5.3e-44	44.7
WP_088902540.1\|1530254_1530638_-	hypothetical protein	G0ZNE4	Cronobacter_phage	3.9e-27	44.9
WP_088902541.1\|1530634_1531003_-	hypothetical protein	F1C5E3	Cronobacter_phage	2.2e-40	71.3
WP_088902542.1\|1531002_1531380_-	hypothetical protein	G0ZNE2	Cronobacter_phage	1.1e-34	59.7
WP_088902543.1\|1531379_1531553_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_088902544.1\|1531552_1531933_-	hypothetical protein	F1C5E2	Cronobacter_phage	5.7e-31	55.6
WP_088902545.1\|1531935_1532301_-	hypothetical protein	NA	NA	NA	NA
WP_088902546.1\|1532310_1533396_-\|coat	phage coat protein	F1C5E1	Cronobacter_phage	1.7e-152	75.0
WP_088902547.1\|1533406_1533841_-	hypothetical protein	F1C5E0	Cronobacter_phage	1.2e-48	71.7
WP_088902548.1\|1533844_1535227_-	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	2.1e-131	58.5
WP_088902549.1\|1535439_1536354_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	4.8e-124	72.8
WP_088903362.1\|1536421_1537849_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	3.5e-158	60.5
WP_088902550.1\|1537877_1539440_-\|terminase	terminase	G8C7P3	Escherichia_phage	5.4e-293	89.2
WP_023277178.1\|1539436_1539925_-	DUF2280 domain-containing protein	I6S1P9	Salmonella_phage	8.3e-51	77.5
WP_088902551.1\|1539956_1540595_-	hypothetical protein	I6S676	Salmonella_phage	6.7e-109	86.8
WP_019076559.1\|1540598_1540970_-	hypothetical protein	Q76H27	Enterobacteria_phage	5.4e-42	65.6
WP_088902552.1\|1541016_1541499_-	HNH endonuclease	A0A2P0XMZ8	Shigella_phage	3.0e-16	37.2
WP_088902553.1\|1541677_1542136_-\|lysis	lysis protein	E7C9T0	Salmonella_phage	5.3e-31	50.7
WP_023294179.1\|1542132_1542531_-	M15 family metallopeptidase	E7C9S9	Salmonella_phage	4.1e-64	91.7
WP_088902554.1\|1542517_1542835_-\|holin	holin	F1C5D1	Cronobacter_phage	7.1e-27	59.2
WP_088902555.1\|1543274_1543964_-	antiterminator	I6PDF8	Cronobacter_phage	1.9e-56	51.3
WP_088902556.1\|1543960_1544083_-	hypothetical protein	NA	NA	NA	NA
WP_088902557.1\|1544079_1544259_-	hypothetical protein	NA	NA	NA	NA
WP_088902558.1\|1544255_1544900_-	hypothetical protein	S4TSR3	Salmonella_phage	2.8e-78	71.0
WP_088902559.1\|1544892_1545063_-	NinE family protein	G8C7V4	Escherichia_phage	1.3e-19	87.5
WP_023330218.1\|1545062_1545500_-	recombination protein NinB	G8C7V3	Escherichia_phage	7.4e-59	77.1
WP_088902560.1\|1545735_1546380_-	hypothetical protein	L0AQZ0	Klebsiella_phage	1.7e-43	39.3
WP_088902561.1\|1546384_1547170_-	DUF551 domain-containing protein	K7P7E4	Enterobacteria_phage	8.2e-32	37.4
WP_088902562.1\|1547166_1547589_-	HNH endonuclease	C6ZR29	Salmonella_phage	2.6e-53	70.0
WP_088902563.1\|1547590_1547905_-	hypothetical protein	A0A077KAZ4	Edwardsiella_phage	1.4e-35	77.9
WP_088902564.1\|1548338_1548542_-	hypothetical protein	R9TRD3	Aeromonas_phage	2.2e-21	75.0
WP_088902565.1\|1548538_1549258_-	hypothetical protein	A0A1W6DXQ0	Salmonella_phage	4.0e-17	61.2
WP_088903364.1\|1549297_1549699_-	DUF2591 domain-containing protein	A0A1J0GUX1	Halomonas_phage	2.6e-05	38.5
WP_049040442.1\|1549768_1550029_-	DUF4752 family protein	T1S9K2	Salmonella_phage	2.1e-16	51.9
WP_088902566.1\|1550025_1550328_-	hypothetical protein	E7EKU6	Edwardsiella_phage	1.5e-10	46.2
WP_088902567.1\|1550327_1551761_-	AAA family ATPase	K7P7N4	Enterobacteria_phage	1.1e-231	84.5
WP_088902568.1\|1551750_1552647_-	DNA replication protein	F1C5C3	Cronobacter_phage	3.2e-133	79.2
WP_088902569.1\|1552812_1553112_-	hypothetical protein	A5VW96	Enterobacteria_phage	7.2e-29	68.8
WP_088903365.1\|1553256_1553499_-	transcriptional regulator	A0A2H4J8E6	uncultured_Caudovirales_phage	6.9e-14	56.3
WP_088902570.1\|1553604_1554360_+	helix-turn-helix domain-containing protein	Q7Y5W5	Haemophilus_phage	2.5e-46	54.2
WP_088902571.1\|1554759_1555113_+	antitermination protein	A0A0P0ZBT9	Stx2-converting_phage	1.7e-21	47.2
WP_088903366.1\|1555493_1555760_+	hypothetical protein	A4KWT2	Enterobacteria_phage	2.4e-28	72.9
WP_088902572.1\|1555803_1556100_+	regulator	M9P0E2	Enterobacteria_phage	1.6e-41	85.7
WP_088902573.1\|1556255_1556525_+	hypothetical protein	NA	NA	NA	NA
WP_023277200.1\|1556676_1557183_+	HNH endonuclease	Q5DMP6	Escherichia_phage	2.5e-26	41.1
WP_057059849.1\|1557160_1557394_+	cell division protein FtsZ	M9NZE2	Enterobacteria_phage	5.4e-32	93.9
WP_088902574.1\|1557463_1558432_+	hypothetical protein	M9P0E1	Enterobacteria_phage	1.3e-50	77.4
WP_045345359.1\|1558439_1558721_+	host nuclease inhibitor GamL	M9NZI3	Enterobacteria_phage	8.5e-48	97.8
WP_088902575.1\|1558738_1559485_+	phage recombination protein Bet	A0A0M4RD39	Salmonella_phage	1.8e-65	65.8
WP_058659114.1\|1559481_1560099_+	exonuclease	A0A0S2SY31	Pseudomonas_phage	1.2e-59	57.8
WP_088902576.1\|1560095_1560524_+	regulator	M9NYX4	Enterobacteria_phage	1.5e-72	96.5
WP_088902577.1\|1560520_1560673_+	DUF1317 family protein	A0A1U8QQC1	Enterobacteria_phage	4.2e-09	56.9
WP_088902578.1\|1560669_1562448_+	phage N-6-adenine-methyltransferase	Q6V7R9	Burkholderia_virus	3.8e-109	55.0
WP_023300422.1\|1562444_1562663_+	hypothetical protein	NA	NA	NA	NA
WP_088902579.1\|1562659_1563367_+	hypothetical protein	A0A1W6JP46	Morganella_phage	1.8e-25	33.9
WP_088902580.1\|1563363_1563555_+	DUF1382 family protein	A0A0P0ZC60	Stx2-converting_phage	3.2e-14	66.1
WP_088902581.1\|1563646_1563865_+	TraR/DksA family transcriptional regulator	A0A0N7C211	Escherichia_phage	1.1e-18	64.8
WP_088902582.1\|1563864_1564227_+	hypothetical protein	G8C7S4	Escherichia_phage	8.1e-51	84.1
WP_088902583.1\|1564189_1564429_+	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_088902584.1\|1564438_1564765_+	DUF550 domain-containing protein	K7PGV7	Enterobacterial_phage	1.4e-46	84.5
WP_060682554.1\|1564886_1565105_+	excisionase	Q77WA4	Escherichia_phage	4.1e-26	77.5
WP_088902585.1\|1565082_1566153_+\|integrase	tyrosine-type recombinase/integrase	Q9MCR4	Enterobacteria_phage	3.4e-153	75.8
1566222:1566244	attR	NA	NA	NA	NA

DBSCAN-SWA_96

1575800 : 1582366

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837092.1\|1575800_1576859_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	2.6e-20	33.8
WP_003023032.1\|1576861_1577551_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_003023029.1\|1577550_1578324_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003023026.1\|1578523_1578673_-	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_003023018.1\|1578803_1579592_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_088902587.1\|1579659_1581132_+	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	3.9e-11	28.5
WP_003837100.1\|1581349_1582366_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.3e-77	45.1

DBSCAN-SWA_97

1586660 : 1590176

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837108.1\|1586660_1587713_-	3-deoxy-7-phosphoheptulonate synthase AroG	S4VUY9	Pandoravirus	1.7e-80	47.3
WP_003845358.1\|1588030_1588405_+	hypothetical protein	NA	NA	NA	NA
WP_003022992.1\|1588518_1589460_+	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	3.7e-23	27.5
WP_003022990.1\|1589456_1590176_-	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	5.8e-24	33.6

DBSCAN-SWA_98

1633090 : 1633882

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087879077.1\|1633090_1633882_-	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	2.2e-08	31.1

DBSCAN-SWA_99

1641204 : 1641585

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902593.1\|1641204_1641585_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	8.3e-06	32.0

DBSCAN-SWA_100

1646384 : 1648433

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847356.1\|1646384_1648433_+	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.1e-31	24.7

DBSCAN-SWA_101

1651698 : 1668600

Bacillus_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902596.1\|1651698_1652376_+	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.6e-26	32.0
WP_003022854.1\|1652475_1654116_-	alpha-D-glucose phosphate-specific phosphoglucomutase	NA	NA	NA	NA
WP_003022848.1\|1654140_1654683_-	replication initiation negative regulator SeqA	NA	NA	NA	NA
WP_049014690.1\|1654877_1655651_+	esterase	A0A1J0GVH7	Mycobacterium_phage	3.1e-07	37.2
WP_003022842.1\|1655779_1656067_+	LexA regulated protein	NA	NA	NA	NA
WP_071593189.1\|1656123_1656753_+	flavodoxin FldA	NA	NA	NA	NA
WP_049259739.1\|1656963_1657050_+	ryhB-regulated fur leader peptide	NA	NA	NA	NA
WP_003022836.1\|1657042_1657489_+	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_088902597.1\|1657618_1658545_+	tricarballylate utilization LysR family transcriptional regulator TcuR	NA	NA	NA	NA
WP_088902598.1\|1658642_1660046_+	FAD-dependent tricarballylate dehydrogenase TcuA	A0A2P0ZL82	Lactobacillus_phage	8.7e-08	25.6
WP_088902599.1\|1660032_1661172_+	tricarballylate utilization 4Fe-4S protein TcuB	NA	NA	NA	NA
WP_088902600.1\|1661225_1662521_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.0e-59	34.4
WP_003022817.1\|1662572_1662905_-	hypothetical protein	NA	NA	NA	NA
WP_003835544.1\|1662954_1664361_-	chitoporin	NA	NA	NA	NA
WP_003022809.1\|1664796_1666464_-\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.2
WP_016149786.1\|1666650_1668600_-	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.1e-08	48.6

DBSCAN-SWA_102

1673399 : 1675064

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902601.1\|1673399_1675064_+	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	2.1e-85	39.5

DBSCAN-SWA_103

1679612 : 1680698

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902602.1\|1679612_1680698_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	4.3e-47	46.6

DBSCAN-SWA_104

1686659 : 1691834

Planktothrix_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022754.1\|1686659_1687385_+	glutamate/aspartate ABC transporter ATP binding protein GltL	G9BWD6	Planktothrix_phage	1.1e-30	38.1
WP_048233267.1\|1687501_1688437_+	pyrimidine-specific ribonucleoside hydrolase RihA	NA	NA	NA	NA
WP_003022748.1\|1688533_1689016_-	zinc ribbon-containing protein	NA	NA	NA	NA
WP_048998184.1\|1689251_1691834_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.2e-185	42.6

DBSCAN-SWA_105

1699999 : 1702463

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048216707.1\|1699999_1701109_+	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	6.2e-09	54.8
WP_003022711.1\|1701251_1702463_+	D-alanyl-D-alanine carboxypeptidase DacA	B6DZZ7	Stx2-converting_phage	9.8e-101	47.9

DBSCAN-SWA_106

1706069 : 1706714

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902607.1\|1706069_1706453_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.8e-23	51.5
WP_000034825.1\|1706504_1706714_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	2.7e-22	78.1

DBSCAN-SWA_107

1722101 : 1730231

Escherichia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022107.1\|1722101_1722932_-	alpha/beta hydrolase	W8EHU1	Mycobacterium_phage	3.5e-17	31.2
WP_003022104.1\|1723207_1723618_+	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_003022101.1\|1723801_1724230_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	1.1e-17	38.5
WP_003847417.1\|1724299_1725067_-	hypothetical protein	NA	NA	NA	NA
WP_003022094.1\|1725066_1725624_-	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	6.2e-26	37.7
WP_003835615.1\|1725620_1727891_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	4.9e-45	25.0
WP_057101280.1\|1727887_1728442_-	dehydrogenase	NA	NA	NA	NA
WP_003835619.1\|1728665_1730231_-	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	1.1e-43	34.0

DBSCAN-SWA_108

1733343 : 1735169

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835626.1\|1733343_1734567_+	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	5.9e-61	33.1
WP_088902609.1\|1734551_1735169_+	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	3.0e-53	50.8

DBSCAN-SWA_109

1752542 : 1760684

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835646.1\|1752542_1753550_+	Fe(3+)-siderophore ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.2e-13	26.0
WP_085951538.1\|1753549_1754539_+	iron-enterobactin ABC transporter permease	NA	NA	NA	NA
WP_003022023.1\|1754535_1755333_+	iron-enterobactin ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	6.4e-08	23.0
WP_088902615.1\|1756793_1760684_-	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	4.8e-64	30.0

DBSCAN-SWA_110

1772365 : 1773346

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835685.1\|1772365_1773346_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	8.4e-26	31.5

DBSCAN-SWA_111

1781244 : 1790583

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902622.1\|1781244_1790583_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	2.0e-12	24.8

DBSCAN-SWA_112

1795981 : 1798106

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021940.1\|1795981_1796665_+	copper response regulator transcription factor CusR	W8CYM9	Bacillus_phage	6.0e-31	35.6
WP_088902626.1\|1796654_1798106_+	Cu(+)/Ag(+) sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.9e-10	26.8

DBSCAN-SWA_113

1804484 : 1814387

Morganella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835732.1\|1804484_1804913_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	7.4e-27	49.3
WP_032936924.1\|1805391_1806006_-	molecular chaperone TorD	NA	NA	NA	NA
WP_088902629.1\|1806002_1808543_-	trimethylamine-N-oxide reductase TorA	A0A077SK27	Escherichia_phage	1.6e-73	30.4
WP_088902630.1\|1808532_1809711_-	pentaheme c-type cytochrome TorC	NA	NA	NA	NA
WP_088902631.1\|1809842_1810535_+	two-component system response regulator TorR	W8CYM9	Bacillus_phage	1.1e-19	28.9
WP_088902632.1\|1810507_1811539_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_088902633.1\|1811621_1814387_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	9.0e-33	31.3

DBSCAN-SWA_114

1824931 : 1828139

Enterococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021887.1\|1824931_1825798_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.2e-28	36.5
WP_003021885.1\|1825799_1826012_+	ribosome-associated protein YbcJ	NA	NA	NA	NA
WP_003835753.1\|1826137_1826662_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_081366017.1\|1826753_1828139_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.6e-46	35.4

DBSCAN-SWA_115

1833178 : 1834195

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902640.1\|1833178_1834195_-	virulence-associated ABC transporter ATP-binding protein SfbB	G9BWD6	Planktothrix_phage	1.1e-33	38.6

DBSCAN-SWA_116

1839091 : 1839778

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021853.1\|1839091_1839778_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-31	34.2

DBSCAN-SWA_117

1842928 : 1843606

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021838.1\|1842928_1843606_-	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	4.0e-27	34.7

DBSCAN-SWA_118

1855157 : 1858578

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902645.1\|1855157_1855928_+	heme ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.2e-14	27.9
WP_088902646.1\|1856076_1858578_+	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	5.9e-116	38.2

DBSCAN-SWA_119

1866763 : 1875393

Powai_lake_megavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057101236.1\|1866763_1867723_+	acetyl esterase	A0A167RJ59	Powai_lake_megavirus	3.2e-14	29.1
WP_003021775.1\|1867719_1868682_-	ferrochelatase	NA	NA	NA	NA
WP_003021773.1\|1868845_1869490_-	adenylate kinase	NA	NA	NA	NA
WP_088902650.1\|1869722_1871597_-	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	3.5e-113	36.4
WP_003021767.1\|1871707_1872313_-	recombination protein RecR	NA	NA	NA	NA
WP_003021764.1\|1872312_1872642_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003021761.1\|1872699_1874631_-	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	1.3e-43	41.5
WP_003021759.1\|1874841_1875393_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	7.0e-30	46.6

DBSCAN-SWA_120

1882312 : 1885462

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902654.1\|1882312_1885462_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.5e-55	23.8

DBSCAN-SWA_121

1897660 : 1901204

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902655.1\|1897660_1899439_-	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-41	28.0
WP_016149705.1\|1899431_1901204_-	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.1e-47	29.7

DBSCAN-SWA_122

1905740 : 1906436

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902656.1\|1905740_1906436_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.4e-88	68.0

DBSCAN-SWA_123

1909717 : 1914762

Bacillus_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021629.1\|1909717_1909990_-	DNA-binding protein HU-beta	A7KV42	Bacillus_phage	1.5e-20	58.4
WP_003021627.1\|1910198_1912553_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.6
WP_003831013.1\|1912737_1914012_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.9e-131	56.4
WP_003021624.1\|1914138_1914762_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.9e-64	63.9

DBSCAN-SWA_124

1937401 : 1947009

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021575.1\|1937401_1937872_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.8e-30	47.4
WP_003021573.1\|1937962_1939066_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.4e-52	35.5
WP_003021571.1\|1939069_1939519_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_088902662.1\|1939672_1940212_+	DUF3251 domain-containing protein	NA	NA	NA	NA
WP_003021561.1\|1940510_1941374_+	nucleoside-specific channel-forming protein Tsx	NA	NA	NA	NA
WP_003835974.1\|1941419_1942112_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	4.5e-18	30.1
WP_054528147.1\|1942135_1942501_-	VOC family protein	NA	NA	NA	NA
WP_003021550.1\|1942669_1943641_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.4e-44	37.8
WP_003021547.1\|1943651_1945499_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_003021544.1\|1945526_1945859_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
WP_003021535.1\|1945881_1947009_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-89	46.3

DBSCAN-SWA_125

1961694 : 1971547

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021498.1\|1961694_1962990_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.4e-28	30.3
WP_003021496.1\|1963040_1963730_-	phosphate response regulator transcription factor PhoB	W8CYM9	Bacillus_phage	2.0e-37	38.9
WP_016149691.1\|1963920_1965123_+	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	2.0e-08	25.6
WP_060855543.1\|1965119_1968263_+	exonuclease subunit SbcC	G3MAB6	Bacillus_virus	1.7e-11	26.4
WP_049015777.1\|1968455_1969628_+	MFS transporter AraJ	NA	NA	NA	NA
WP_088902664.1\|1969635_1970544_-	fructokinase	NA	NA	NA	NA
WP_003021479.1\|1970635_1971547_+	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.7e-103	64.3

DBSCAN-SWA_126

1975297 : 1976413

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085954043.1\|1975297_1976413_-	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	5.3e-16	34.6

DBSCAN-SWA_127

1993073 : 1993841

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902673.1\|1993073_1993841_-	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	4.3e-25	38.6

DBSCAN-SWA_128

2001864 : 2002911

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838618.1\|2001864_2002911_+	ferric ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-34	38.2

DBSCAN-SWA_129

2006899 : 2008860

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021379.1\|2006899_2007913_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	3.2e-44	31.1
WP_003838629.1\|2007909_2008860_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	6.2e-34	36.3

DBSCAN-SWA_130

2020758 : 2028716

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143759621.1\|2020758_2021850_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.9e-157	80.9
WP_088902681.1\|2021971_2025055_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	81.8
WP_003838660.1\|2025106_2026360_+	MFS transporter	NA	NA	NA	NA
WP_003838662.1\|2026512_2026785_+	YceK/YidQ family lipoprotein	NA	NA	NA	NA
WP_003847671.1\|2026829_2028716_-	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.1e-53	29.8

DBSCAN-SWA_131

2042494 : 2043400

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061549898.1\|2042494_2043400_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.0e-14	25.3

DBSCAN-SWA_132

2050710 : 2051715

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149641.1\|2050710_2051715_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.8e-23	28.3

DBSCAN-SWA_133

2058950 : 2060816

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902691.1\|2058950_2060816_-	cell envelope integrity protein TolA	A0A1D7XFE4	Escherichia_phage	2.3e-64	31.7

DBSCAN-SWA_134

2083773 : 2087487

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071696411.1\|2083773_2085027_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.1e-99	47.5
WP_003031373.1\|2085038_2086142_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.6e-60	39.6
WP_003843783.1\|2086431_2087487_+	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.5e-116	59.5

DBSCAN-SWA_135

2098283 : 2098688

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003843824.1\|2098283_2098688_-	adenylyltransferase/cytidyltransferase family protein	A0A1V0SGE7	Hokovirus	8.8e-30	48.5

DBSCAN-SWA_136

2112141 : 2115423

Clostridioides_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049001910.1\|2112141_2112903_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.0e-19	38.5
WP_003031388.1\|2113962_2114730_-	class II glutamine amidotransferase	NA	NA	NA	NA
WP_003031390.1\|2114841_2115423_-	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	5.7e-14	30.8

DBSCAN-SWA_137

2127905 : 2128853

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|2127905_2128853_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_138

2132106 : 2136305

Bradyrhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008324473.1\|2132106_2132844_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	4.1e-41	40.7
WP_003838896.1\|2132899_2133367_+	ribonuclease HI	J9Q745	Salmonella_phage	6.5e-53	60.1
WP_003031413.1\|2133363_2134086_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003031418.1\|2134119_2134875_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_003031421.1\|2134946_2136305_+	murein transglycosylase D	A0A0A7NU10	Lactobacillus_phage	8.9e-10	28.6

DBSCAN-SWA_139

2140349 : 2141153

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149586.1\|2140349_2141153_-	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	3.9e-37	35.0

DBSCAN-SWA_140

2147612 : 2148644

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018468.1\|2147612_2148644_+	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_141

2160663 : 2164767

Saccharomonospora_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018516.1\|2160663_2164146_-	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	5.9e-207	37.0
WP_003845817.1\|2164170_2164767_-	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	3.9e-26	39.3

DBSCAN-SWA_142

2173586 : 2174345

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018543.1\|2173586_2174345_-	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	7.2e-25	41.5

DBSCAN-SWA_143

2185770 : 2187204

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018567.1\|2185770_2187204_-\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.1e-25	29.8

DBSCAN-SWA_144

2191205 : 2191550

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018581.1\|2191205_2191550_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	5.9e-27	50.5

DBSCAN-SWA_145

2197444 : 2198242

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902721.1\|2197444_2198242_-	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	6.0e-14	27.4

DBSCAN-SWA_146

2208850 : 2215672

Acanthamoeba_polyphaga_mimivirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_143759633.1\|2208850_2211325_-	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	1.1e-37	29.1
WP_088902724.1\|2211353_2211884_+	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_003837495.1\|2211899_2212604_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_003018625.1\|2212780_2213236_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_003837490.1\|2213306_2214203_+\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_071524282.1\|2214253_2215672_+	polynucleotide adenylyltransferase PcnB	G3MAR3	Bacillus_virus	5.5e-26	35.9

DBSCAN-SWA_147

2237044 : 2244382

Anomala_cuprea_entomopoxvirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837480.1\|2237044_2237971_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.1e-22	34.0
WP_049016119.1\|2238079_2238742_+	carbonate dehydratase	NA	NA	NA	NA
WP_003018658.1\|2238835_2239372_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.9e-17	33.1
WP_088902736.1\|2239623_2241279_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-13	31.3
WP_088902737.1\|2241463_2243083_-	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	4.3e-19	55.3
WP_003018667.1\|2243236_2243584_+	YacC family pilotin-like protein	NA	NA	NA	NA
WP_008786221.1\|2243614_2244382_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	5.7e-30	35.3

DBSCAN-SWA_148

2254736 : 2256161

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902740.1\|2254736_2256161_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.5e-41	26.9

DBSCAN-SWA_149

2267227 : 2267791

Thiobacimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018719.1\|2267227_2267791_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1B0T6G1	Thiobacimonas_phage	2.1e-13	33.1

DBSCAN-SWA_150

2272093 : 2273137

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018732.1\|2272093_2273137_-	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	3.4e-102	55.0

DBSCAN-SWA_151

2299156 : 2300881

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845729.1\|2299156_2300881_-	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	3.0e-34	26.1

DBSCAN-SWA_152

2317346 : 2318045

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937527.1\|2317346_2318045_+	thiamine ABC transporter ATP-binding protein ThiQ	G3M9Y6	Bacillus_virus	8.9e-22	38.2

DBSCAN-SWA_153

2326687 : 2332077

Lymphocystis_disease_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902751.1\|2326687_2329039_+	DNA polymerase II	A0A1B2RW58	Lymphocystis_disease_virus	5.0e-16	24.9
WP_088902752.1\|2329170_2332077_+	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	1.7e-21	37.9

DBSCAN-SWA_154

2339808 : 2341233

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845697.1\|2339808_2340657_+	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A0A0YWI7	Pseudomonas_phage	4.9e-06	45.3
WP_003018873.1\|2340753_2341233_-	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	3.0e-29	47.1

DBSCAN-SWA_155

2349563 : 2355196

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018896.1\|2349563_2351081_+	L-carnitine/gamma-butyrobetaine antiport BCCT transporter	A0A2I7QNT1	Vibrio_phage	2.5e-08	22.1
WP_003018898.1\|2351115_2352258_+	crotonobetainyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003837364.1\|2352363_2353581_+	L-carnitine CoA-transferase	NA	NA	NA	NA
WP_003845685.1\|2353642_2355196_+	crotonobetaine/carnitine-CoA ligase	A0A2K9KZV5	Tupanvirus	7.1e-19	22.3

DBSCAN-SWA_156

2360628 : 2361777

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018918.1\|2360628_2361777_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.2e-49	32.4

DBSCAN-SWA_157

2366224 : 2369041

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149528.1\|2366224_2369041_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	3.0e-76	25.5

DBSCAN-SWA_158

2375513 : 2380028

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018952.1\|2375513_2376680_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.6e-90	51.5
WP_032937497.1\|2376886_2378020_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	5.5e-29	34.6
WP_003018959.1\|2378105_2380028_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.4e-146	50.3

DBSCAN-SWA_159

2384441 : 2385395

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018974.1\|2384441_2385395_-	transaldolase	A0A0E3G6C9	Synechococcus_phage	1.3e-10	34.4

DBSCAN-SWA_160

2401975 : 2407241

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019016.1\|2401975_2403913_-	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	1.6e-12	36.2
WP_003845630.1\|2404244_2405912_+	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	2.4e-41	26.4
WP_003019021.1\|2406011_2407241_-	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.5e-85	44.0

DBSCAN-SWA_161

2413751 : 2415074

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845626.1\|2413751_2415074_-	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	3.4e-78	39.3

DBSCAN-SWA_162

2420617 : 2423422

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019081.1\|2420617_2420779_-	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	2.8e-11	66.0
WP_003845622.1\|2420906_2421524_-	molecular chaperone OsmY	NA	NA	NA	NA
WP_003019086.1\|2421832_2423422_-	peptide chain release factor 3	D0R0F5	Streptococcus_phage	2.7e-29	24.8

DBSCAN-SWA_163

2427243 : 2428320

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044713011.1\|2427243_2428320_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.2e-20	39.8

DBSCAN-SWA_164

2434662 : 2435942

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019130.1\|2434662_2435202_+	primosomal protein DnaT	T1SA92	Salmonella_phage	4.9e-28	61.7
WP_003019133.1\|2435204_2435942_+	DNA replication protein DnaC	V5UQI5	Shigella_phage	2.9e-63	51.2

DBSCAN-SWA_165

2439070 : 2441552

Micromonas_pusilla_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902763.1\|2439070_2440516_-	tagaturonate reductase	G8DCZ3	Micromonas_pusilla_virus	1.3e-19	26.2
WP_003837229.1\|2440529_2441552_-	zinc-binding alcohol dehydrogenase family protein	A0A2K9L7I1	Tupanvirus	3.9e-10	26.0

DBSCAN-SWA_166

2444831 : 2446493

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019155.1\|2444831_2446493_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-08	72.3

DBSCAN-SWA_167

2452419 : 2456393

Rhodobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902767.1\|2452419_2454849_+	DEAD/DEAH box helicase	A0A0K1LLU7	Rhodobacter_phage	2.6e-07	23.4
WP_088902768.1\|2454923_2456393_+	type I restriction-modification system subunit M	J7I0U9	Acinetobacter_phage	1.1e-34	27.6

DBSCAN-SWA_168

2474229 : 2478561

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044713037.1\|2474229_2475207_-	porin	Q1MVN1	Enterobacteria_phage	2.8e-82	50.1
WP_044713039.1\|2475327_2475531_-	hypothetical protein	NA	NA	NA	NA
WP_003033268.1\|2476179_2476953_-	Uxu operon transcriptional regulator	NA	NA	NA	NA
WP_032948455.1\|2477085_2478561_-	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	4.5e-47	31.6

DBSCAN-SWA_169

2493404 : 2505331

Stenotrophomonas_phage(20.0%)

tRNA,integrase

attL 2486776:2486793|attR 2512899:2512916

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2486776:2486793	attL	NA	NA	NA	NA
WP_088902781.1\|2493404_2494661_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	9.6e-83	42.5
WP_044699125.1\|2495164_2496184_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	1.9e-44	32.3
WP_003025876.1\|2496331_2497834_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	8.8e-83	44.3
WP_003025875.1\|2497935_2499018_-	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_003839630.1\|2499017_2500118_-	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_003025870.1\|2500384_2501896_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	7.1e-48	38.4
WP_087051781.1\|2501993_2502476_+	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_088902782.1\|2502475_2505331_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.8e-140	36.7
2512899:2512916	attR	NA	NA	NA	NA

DBSCAN-SWA_170

2516253 : 2517189

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025818.1\|2516253_2517189_+	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.4e-51	39.2

DBSCAN-SWA_171

2521586 : 2525632

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902790.1\|2521586_2524295_-	magnesium-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	4.5e-45	27.5
WP_049002379.1\|2524684_2525632_+	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	1.2e-13	22.1

DBSCAN-SWA_172

2529317 : 2532547

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844922.1\|2529317_2531456_+	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	9.1e-267	64.6
WP_088902792.1\|2531562_2532027_+	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	5.5e-52	57.1
WP_088902793.1\|2532030_2532315_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	3.3e-31	70.2
WP_003839576.1\|2532304_2532547_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	4.3e-16	52.5

DBSCAN-SWA_173

2544456 : 2552209

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025742.1\|2544456_2545455_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.1e-68	42.1
WP_088902795.1\|2545569_2546682_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-14	34.0
WP_003025736.1\|2546785_2547787_-	sugar ABC transporter permease YjfF	NA	NA	NA	NA
WP_008323019.1\|2547773_2548796_-	ABC transporter permease	NA	NA	NA	NA
WP_016149467.1\|2548809_2550312_-	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	3.6e-12	30.4
WP_003025728.1\|2550415_2551372_-	galactofuranose ABC transporter substrate-binding protein YtfQ	NA	NA	NA	NA
WP_003025726.1\|2551681_2552209_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.3e-56	63.3

DBSCAN-SWA_174

2568589 : 2569537

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|2568589_2569537_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_175

2580656 : 2582210

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902804.1\|2580656_2582210_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-08	31.0

DBSCAN-SWA_176

2601598 : 2606158

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025612.1\|2601598_2604061_-	ribonuclease R	Q0GXV6	Lactococcus_phage	9.4e-66	32.5
WP_003025609.1\|2604217_2604643_-	nitric oxide-sensing transcriptional repressor NsrR	NA	NA	NA	NA
WP_003025606.1\|2604859_2606158_-	adenylosuccinate synthase	W5S5V7	Pithovirus	2.9e-66	35.6

DBSCAN-SWA_177

2611680 : 2614881

Wolbachia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902807.1\|2611680_2613546_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	6.9e-61	42.4
WP_088902808.1\|2613555_2614881_-	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	1.1e-17	30.1

DBSCAN-SWA_178

2618890 : 2619436

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839477.1\|2618890_2619436_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-28	41.0

DBSCAN-SWA_179

2627997 : 2628975

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003830517.1\|2627997_2628975_-	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	8.1e-29	29.1

DBSCAN-SWA_180

2634876 : 2636464

Morganella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025522.1\|2634876_2635410_+	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.6e-47	54.8
WP_005323562.1\|2635546_2636464_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.6e-101	59.5

DBSCAN-SWA_181

2641468 : 2643452

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025464.1\|2641468_2643115_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.9e-188	68.1
WP_000027827.1\|2643158_2643452_-	co-chaperone GroES	K4F9I2	Cronobacter_phage	1.2e-12	43.3

DBSCAN-SWA_182

2651909 : 2653175

Enterobacteria_phage(100.0%)

integrase

attL 2649800:2649814|attR 2664066:2664080

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2649800:2649814	attL	NA	NA	NA	NA
WP_088902814.1\|2651909_2653175_+\|integrase	integrase arm-type DNA-binding domain-containing protein	Q7M297	Enterobacteria_phage	2.9e-79	39.1
WP_088902814.1\|2651909_2653175_+\|integrase	integrase arm-type DNA-binding domain-containing protein	Q7M297	Enterobacteria_phage	2.9e-79	39.1
2664066:2664080	attR	NA	NA	NA	NA

DBSCAN-SWA_183

2662656 : 2663604

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|2662656_2663604_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_184

2672650 : 2674211

Yersinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902818.1\|2672650_2673469_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	1.0e-45	38.7
WP_088902820.1\|2673728_2674211_+	antirestriction protein	A0A1S5R3R9	Pseudomonas_phage	3.7e-11	32.8

DBSCAN-SWA_185

2678215 : 2679877

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902822.1\|2678215_2679877_+	fatty acid--CoA ligase	Q75ZG1	Hepacivirus	4.3e-30	25.3

DBSCAN-SWA_186

2706532 : 2709358

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844779.1\|2706532_2707615_+	two-component system sensor histidine kinase PmrB	W8CYF6	Bacillus_phage	2.9e-11	26.0
WP_008321468.1\|2707608_2707698_-	LpxT activity modulator PmrR	NA	NA	NA	NA
WP_088902828.1\|2707855_2709358_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	1.8e-56	31.5

DBSCAN-SWA_187

2715930 : 2716719

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841124.1\|2715930_2716719_+	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.5e-12	29.0

DBSCAN-SWA_188

2722456 : 2723985

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844769.1\|2722456_2723215_+	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	1.8e-15	28.2
WP_032938148.1\|2723304_2723985_+	phosphonate C-P lyase system protein PhnL	F2Y2R6	Organic_Lake_phycodnavirus	4.9e-09	29.7

DBSCAN-SWA_189

2729842 : 2731366

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844755.1\|2729842_2731366_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-16	27.9

DBSCAN-SWA_190

2737175 : 2739161

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044714894.1\|2737175_2739161_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	7.9e-148	44.3

DBSCAN-SWA_191

2757382 : 2759341

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902838.1\|2757382_2759341_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.6e-92	41.5

DBSCAN-SWA_192

2765522 : 2766872

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044715246.1\|2765522_2766872_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.7e-159	71.4

DBSCAN-SWA_193

2770954 : 2779947

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003826621.1\|2770954_2771479_-	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	1.1e-53	94.5
WP_088902839.1\|2771730_2774553_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.6
WP_003031719.1\|2774668_2775025_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_044702294.1\|2775152_2775866_-	acid phosphatase AphA	NA	NA	NA	NA
WP_087879458.1\|2776113_2777307_-	aromatic amino acid transaminase	NA	NA	NA	NA
WP_088902840.1\|2777435_2778515_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	3.6e-30	28.5
WP_003826610.1\|2778531_2779947_-	replicative DNA helicase	O80281	Escherichia_phage	1.8e-199	77.9

DBSCAN-SWA_194

2785746 : 2786355

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031703.1\|2785746_2786355_-	repressor LexA	Q9G0C2	Lactococcus_phage	1.0e-13	38.0

DBSCAN-SWA_195

2797597 : 2798707

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031682.1\|2797597_2798707_-	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_196

2813914 : 2814700

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902846.1\|2813914_2814700_-	nucleotidyltransferase domain-containing protein	A0A2D1GQQ2	Pseudomonas_phage	5.1e-50	45.9

DBSCAN-SWA_197

2828173 : 2836624

uncultured_Caudovirales_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085951602.1\|2828173_2828347_+	hypothetical protein	A0A2H4JB52	uncultured_Caudovirales_phage	6.8e-08	50.0
WP_075335826.1\|2828442_2829603_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.0e-39	36.4
WP_088902851.1\|2829973_2830252_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	2.5e-12	50.0
WP_003841421.1\|2830360_2831050_+	dipeptidase PepE	NA	NA	NA	NA
WP_003031618.1\|2831115_2832747_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_088902852.1\|2832940_2836624_-	methionine synthase	A0A140XBC7	Dickeya_phage	3.7e-26	90.2

DBSCAN-SWA_198

2849863 : 2851453

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048234177.1\|2849863_2851453_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.1e-67	47.7

DBSCAN-SWA_199

2856944 : 2858708

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001044509.1\|2856944_2857217_-	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	5.5e-20	57.8
WP_088902854.1\|2857403_2857994_-	YjaG family protein	NA	NA	NA	NA
WP_088902855.1\|2858027_2858708_-	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	3.0e-22	31.0

DBSCAN-SWA_200

2863972 : 2884511

Catovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902858.1\|2863972_2864731_+	HesA/MoeB/ThiF family protein	A0A1V0SAV8	Catovirus	1.2e-11	27.3
WP_003033088.1\|2864711_2864912_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_003842025.1\|2864913_2865684_+	thiazole synthase	NA	NA	NA	NA
WP_088902859.1\|2865680_2866814_+	2-iminoacetate synthase ThiH	NA	NA	NA	NA
WP_003033098.1\|2866933_2867146_-	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	2.2e-24	78.6
WP_003033102.1\|2868237_2868543_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003033104.1\|2868547_2868865_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003033107.1\|2868976_2873200_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	1.0e-67	27.4
WP_003033111.1\|2873276_2877305_-	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	1.6e-22	29.4
WP_003033114.1\|2877625_2877991_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_001207203.1\|2878057_2878555_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_003033119.1\|2878973_2879681_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_003033122.1\|2879684_2880113_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_003033125.1\|2880267_2880813_-	transcription termination/antitermination protein NusG	A0A291AUS6	Sinorhizobium_phage	1.1e-14	29.6
WP_003033128.1\|2880814_2881198_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003031109.1\|2881428_2882613_-	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_003031107.1\|2883560_2884511_+	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	8.7e-28	32.0

DBSCAN-SWA_201

2893125 : 2986157

Salmonella_phage(74.42%)

terminase,capsid,plate,holin,portal,protease,head,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028868.1\|2893125_2894982_-	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	1.0e-08	29.3
WP_049002303.1\|2895349_2896450_+\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA
WP_003028863.1\|2896532_2896892_-	YijD family membrane protein	NA	NA	NA	NA
WP_003028862.1\|2896907_2897543_-	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_003028860.1\|2897734_2899135_+	Si-specific NAD(P)(+) transhydrogenase	NA	NA	NA	NA
WP_003028858.1\|2899117_2900035_-	DNA-binding transcriptional regulator OxyR	NA	NA	NA	NA
WP_003028856.1\|2900298_2901672_-	argininosuccinate lyase	NA	NA	NA	NA
WP_003028854.1\|2901780_2902554_-	acetylglutamate kinase	NA	NA	NA	NA
WP_088902860.1\|2902563_2903568_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_003028848.1\|2903723_2904875_+	acetylornithine deacetylase	NA	NA	NA	NA
WP_003840542.1\|2905144_2907796_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_003840540.1\|2908008_2909742_+	phosphoethanolamine transferase CptA	NA	NA	NA	NA
WP_003847839.1\|2909893_2910742_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088902861.1\|2910989_2911652_+	fructose-6-phosphate aldolase	A0A0E3F0E2	Synechococcus_phage	9.3e-29	32.2
WP_032950726.1\|2911664_2912768_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_088902862.1\|2912853_2915034_-	catalase/peroxidase HPI	NA	NA	NA	NA
WP_003028830.1\|2915202_2916090_-	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_088902863.1\|2916247_2917156_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_057102216.1\|2917245_2917623_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_032950720.1\|2917661_2919218_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_088902864.1\|2919351_2920527_+	cytoplasmic protein	NA	NA	NA	NA
WP_071697854.1\|2920562_2922995_-	bifunctional aspartate kinase/homoserine dehydrogenase II	NA	NA	NA	NA
WP_044714689.1\|2922997_2924158_-	cystathionine gamma-synthase	NA	NA	NA	NA
WP_003028816.1\|2924422_2924740_+	met regulon transcriptional regulator MetJ	NA	NA	NA	NA
WP_088902865.1\|2924792_2926217_-	MFS transporter	NA	NA	NA	NA
WP_088902866.1\|2926295_2926976_-	hypothetical protein	NA	NA	NA	NA
WP_003028810.1\|2927314_2927527_-	50S ribosomal protein L31	NA	NA	NA	NA
WP_088902867.1\|2927731_2929930_+	primosomal protein N'	NA	NA	NA	NA
WP_003028807.1\|2930086_2931112_+	DNA-binding transcriptional regulator CytR	NA	NA	NA	NA
WP_088902868.1\|2931205_2932180_+	cell division protein FtsN	NA	NA	NA	NA
WP_003028805.1\|2932271_2932802_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_003028803.1\|2932811_2934143_+	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	2.6e-46	29.2
WP_003028801.1\|2934210_2935140_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
WP_003028798.1\|2935232_2935718_+	ribonuclease E activity regulator RraA	NA	NA	NA	NA
WP_044701846.1\|2935877_2936621_+	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
WP_088732415.1\|2936823_2937069_-	septal ring assembly protein ZapB	NA	NA	NA	NA
WP_003028793.1\|2937497_2938343_+	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.8e-16	29.5
WP_003028792.1\|2938364_2939873_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003847859.1\|2940008_2941019_+	class II fructose-bisphosphatase	NA	NA	NA	NA
WP_003840504.1\|2941114_2941861_+	ferredoxin--NADP(+) reductase	NA	NA	NA	NA
WP_003840502.1\|2941924_2942353_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_003028785.1\|2942453_2943050_+	YiiQ family protein	NA	NA	NA	NA
WP_003028783.1\|2943161_2943929_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_016151273.1\|2943968_2945441_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_003840496.1\|2945554_2946859_-	hypothetical protein	NA	NA	NA	NA
WP_016151272.1\|2946932_2947682_-	CDP-diacylglycerol diphosphatase	NA	NA	NA	NA
WP_003840489.1\|2947786_2948776_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003028778.1\|2948979_2949942_-	6-phosphofructokinase	NA	NA	NA	NA
WP_003028775.1\|2950125_2951028_-	CDF family cation-efflux transporter FieF	NA	NA	NA	NA
WP_088902869.1\|2951314_2952028_+	hypothetical protein	Q37850	Escherichia_phage	4.0e-62	48.3
WP_001251454.1\|2952060_2952303_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_088902870.1\|2952351_2953470_-	phage late control D family protein	A0A0M4REC6	Salmonella_phage	5.2e-189	98.1
WP_088902871.1\|2953627_2954821_+\|tail	phage tail protein	A0A0M4S6M1	Salmonella_phage	3.7e-217	95.5
WP_001207579.1\|2954833_2955349_+\|tail	phage major tail tube protein	A0A0M5M1I5	Salmonella_phage	3.9e-91	95.9
WP_000047593.1\|2955363_2955699_+	hypothetical protein	A0A0M4RCV2	Salmonella_phage	3.0e-52	99.1
WP_000763324.1\|2955707_2955824_+\|tail	GpE family phage tail protein	A0A0M3ULA8	Salmonella_phage	6.6e-15	100.0
WP_088902872.1\|2955824_2958758_+\|tail	phage tail tape measure protein	A0A0M4R2V3	Salmonella_phage	9.8e-280	76.3
WP_000979934.1\|2958767_2959217_+\|tail	phage tail protein	A0A1J0I2L5	Salmonella_phage	3.9e-79	98.7
WP_130714801.1\|2959596_2959878_-	hypothetical protein	NA	NA	NA	NA
WP_088902873.1\|2961522_2962137_-\|tail	phage tail protein I	A0A1J0I2I4	Salmonella_phage	2.2e-109	97.9
WP_088902874.1\|2962129_2963041_-\|plate	baseplate assembly protein	A0A0M4REB7	Salmonella_phage	1.2e-159	97.4
WP_000108898.1\|2963037_2963400_-\|plate	baseplate assembly protein	A0A0M4S6L5	Salmonella_phage	5.0e-61	100.0
WP_088902875.1\|2963396_2964017_-\|plate	phage baseplate assembly protein V	A0A0M3ULA5	Salmonella_phage	7.3e-92	84.5
WP_088902876.1\|2964174_2964819_-	phage virion morphogenesis protein	A0A0M4RCU1	Salmonella_phage	1.2e-113	95.8
WP_088902877.1\|2964779_2965274_-\|tail	phage tail protein	A0A0M4R2U5	Salmonella_phage	5.6e-79	97.4
WP_088902878.1\|2965273_2965807_-	DUF2514 family protein	A0A0M4S5V1	Salmonella_phage	1.7e-44	93.7
WP_000002675.1\|2965921_2966314_-	M15 family metallopeptidase	S4TRL9	Salmonella_phage	2.7e-60	84.4
WP_063159706.1\|2966303_2966624_-\|holin	phage holin family protein	A4PE35	Ralstonia_virus	1.2e-08	43.2
WP_000232677.1\|2966607_2966997_-	hypothetical protein	A0A192Y8P2	Salmonella_phage	9.7e-10	36.4
WP_001102549.1\|2967037_2967238_-\|tail	tail protein	A0A0M4RTN6	Salmonella_phage	1.8e-31	100.0
WP_016246752.1\|2967237_2967726_-\|head	head completion/stabilization protein	A0A0M4QWR7	Salmonella_phage	5.2e-85	97.5
WP_088902879.1\|2967828_2968677_-\|terminase	terminase	A0A0M4R523	Salmonella_phage	2.8e-134	98.9
WP_001246221.1\|2968719_2969766_-\|capsid	phage major capsid protein, P2 family	A0A0M3ULA3	Salmonella_phage	9.1e-196	98.8
WP_088903378.1\|2969806_2970652_-\|capsid	GPO family capsid scaffolding protein	A0A1J0I2E9	Salmonella_phage	1.7e-155	98.9
WP_088902880.1\|2970805_2972518_+	oxidoreductase	A0A0M4S6K7	Salmonella_phage	0.0e+00	97.5
WP_088902881.1\|2972518_2973568_+\|portal	phage portal protein	A0A0M5M1H6	Salmonella_phage	1.2e-206	99.7
WP_088902882.1\|2973946_2974675_-	DNA adenine methylase	A0A0M4S5U3	Salmonella_phage	3.5e-93	71.0
WP_088902883.1\|2974874_2977265_-	replication endonuclease	A0A0M4RTM8	Salmonella_phage	0.0e+00	88.9
WP_088902884.1\|2977261_2978371_-	DNA cytosine methyltransferase	A0A0M3ULA1	Salmonella_phage	2.1e-174	80.2
WP_023309722.1\|2978367_2978688_-	DUF4406 domain-containing protein	A0A1I9KFD3	Aeromonas_phage	1.9e-27	67.8
WP_088902885.1\|2978687_2979659_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A0M4QWR0	Salmonella_phage	8.6e-140	82.3
WP_000166617.1\|2979660_2979873_-	hypothetical protein	A0A0M4R514	Salmonella_phage	6.4e-32	95.7
WP_000946669.1\|2979915_2980098_-	hypothetical protein	NA	NA	NA	NA
WP_000482341.1\|2980097_2980532_-	tellurite resistance TerB family protein	Q1MVI3	Enterobacteria_phage	5.1e-68	91.0
WP_063928745.1\|2980625_2980856_-	hypothetical protein	A0A0M4S6M9	Salmonella_phage	2.7e-28	74.7
WP_032654192.1\|2980845_2981049_-	DUF4761 family protein	A0A0M5M1I3	Salmonella_phage	1.8e-31	98.5
WP_032654195.1\|2981050_2981293_-	hypothetical protein	NA	NA	NA	NA
WP_016246742.1\|2981300_2981504_-	hypothetical protein	A0A0M3ULI0	Salmonella_phage	1.5e-30	98.5
WP_063217255.1\|2981514_2981796_-	regulator	A0A0M4RCW1	Salmonella_phage	3.7e-35	72.0
WP_088902886.1\|2981930_2982224_+	helix-turn-helix transcriptional regulator	Q1JS21	Enterobacteria_phage	2.2e-22	54.6
WP_003028767.1\|2983437_2983938_-	cell-envelope stress modulator CpxP	NA	NA	NA	NA
WP_003028763.1\|2984088_2984787_+	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	1.5e-05	29.5
WP_088902887.1\|2984783_2986157_+	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.1e-15	25.4

DBSCAN-SWA_202

2989202 : 2989823

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840480.1\|2989202_2989823_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	1.0e-61	57.4

DBSCAN-SWA_203

3001543 : 3004594

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085951592.1\|3001543_3004594_+	formate dehydrogenase-N subunit alpha	A0A077SK27	Escherichia_phage	6.5e-08	23.7

DBSCAN-SWA_204

3007925 : 3008834

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902891.1\|3007925_3008834_+	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	2.4e-27	32.9

DBSCAN-SWA_205

3018337 : 3020807

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028636.1\|3018337_3019387_+	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	2.6e-09	26.6
WP_088903379.1\|3019397_3020807_+	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	9.0e-05	28.7

DBSCAN-SWA_206

3024722 : 3027509

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028623.1\|3024722_3027509_-	DNA polymerase I	A8E2B3	Enterococcus_phage	4.9e-47	30.3

DBSCAN-SWA_207

3039698 : 3040313

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841252.1\|3039698_3040313_-	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	2.1e-19	45.7

DBSCAN-SWA_208

3051262 : 3054582

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003017884.1\|3051262_3052054_-	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	6.8e-26	31.5
WP_003841235.1\|3052056_3052605_-	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_088902897.1\|3052608_3052863_-	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_088902898.1\|3052941_3054582_-	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	1.3e-42	29.5

DBSCAN-SWA_209

3068754 : 3070584

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061549309.1\|3068754_3070584_-	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	3.3e-84	38.5

DBSCAN-SWA_210

3074502 : 3078348

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003017922.1\|3074502_3076665_-	DNA helicase II	A7KV33	Bacillus_phage	7.8e-117	37.6
WP_003017925.1\|3076729_3077446_-	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
WP_003841210.1\|3077445_3078348_-	tyrosine recombinase XerC	A0A142F1N9	Bacillus_phage	1.9e-24	29.5

DBSCAN-SWA_211

3094768 : 3100930

Enterobacteria_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044714765.1\|3094768_3095899_-	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	1.1e-18	41.7
WP_088902906.1\|3095903_3096581_-	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
WP_003017976.1\|3096558_3097440_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	8.7e-107	66.7
WP_057064541.1\|3097473_3098541_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.3e-100	53.1
WP_088902907.1\|3098540_3099803_-	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HFY9	Paramecium_bursaria_Chlorella_virus	5.4e-25	27.7
WP_003017984.1\|3099799_3100930_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.9e-26	26.8

DBSCAN-SWA_212

3104983 : 3110412

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001280776.1\|3104983_3105313_-	thioredoxin TrxA	A0A1V0SD63	Indivirus	4.2e-14	38.5
WP_003017994.1\|3105456_3106725_+	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	8.3e-42	31.2
WP_003844615.1\|3106861_3108343_+	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
WP_003829018.1\|3108390_3110412_-	DNA helicase Rep	A7KV33	Bacillus_phage	2.2e-113	37.8

DBSCAN-SWA_213

3119537 : 3121184

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841174.1\|3119537_3121184_-	acetolactate synthase 2 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.3e-65	31.8

DBSCAN-SWA_214

3138664 : 3140533

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023768.1\|3138664_3140533_-	low affinity potassium transporter Kup	M1I6H8	Paramecium_bursaria_Chlorella_virus	3.2e-66	30.5

DBSCAN-SWA_215

3143807 : 3144800

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844416.1\|3143807_3144800_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	8.4e-50	37.3

DBSCAN-SWA_216

3157080 : 3160505

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700491.1\|3157080_3158451_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	4.3e-36	38.0
WP_003023813.1\|3158675_3160505_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.1e-122	41.4

DBSCAN-SWA_217

3166162 : 3173012

Cyanophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023814.1\|3166162_3167203_+	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.0e-46	35.8
WP_003023817.1\|3167347_3168307_+	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_003023819.1\|3168306_3169197_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003023821.1\|3169243_3170017_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
WP_003023824.1\|3170031_3170757_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_016151219.1\|3170841_3171507_-	6-phosphogluconate phosphatase	NA	NA	NA	NA
WP_003840586.1\|3171674_3173012_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	9.6e-65	38.0

DBSCAN-SWA_218

3179987 : 3187357

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023846.1\|3179987_3180245_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7
WP_088902917.1\|3180208_3180568_-	ribonuclease P protein component	NA	NA	NA	NA
WP_003023858.1\|3180585_3180726_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_003023861.1\|3181332_3182736_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_088902918.1\|3182740_3183841_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	3.1e-53	34.7
WP_003023865.1\|3183840_3184914_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003844435.1\|3184942_3187357_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.4e-114	34.1

DBSCAN-SWA_219

3191463 : 3192398

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023882.1\|3191463_3191877_+	heat shock chaperone IbpA	A0A1D8KSJ6	Synechococcus_phage	4.6e-18	35.2
WP_003840609.1\|3191969_3192398_+	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	2.7e-13	36.4

DBSCAN-SWA_220

3200519 : 3205359

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023905.1\|3200519_3201704_-	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	5.0e-17	25.1
WP_003840641.1\|3201897_3202731_-	EamA family transporter	NA	NA	NA	NA
WP_003840643.1\|3202854_3202944_-	type I toxin-antitoxin system toxin TisB	NA	NA	NA	NA
WP_071696250.1\|3203464_3203563_+	ilvB operon leader peptide IvbL	NA	NA	NA	NA
WP_032937132.1\|3203670_3205359_+	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	2.9e-58	30.4

DBSCAN-SWA_221

3218006 : 3218954

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|3218006_3218954_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_222

3228978 : 3229917

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902925.1\|3228978_3229917_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	2.6e-69	53.1

DBSCAN-SWA_223

3241383 : 3254405

uncultured_Caudovirales_phage(83.33%)

integrase

attL 3229002:3229018|attR 3258046:3258062

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3229002:3229018	attL	NA	NA	NA	NA
WP_088902928.1\|3241383_3242097_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	7.3e-96	72.6
WP_088902929.1\|3242105_3242651_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_088902930.1\|3242726_3243089_+	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_088902931.1\|3243109_3244867_+	arsenical pump-driving ATPase	NA	NA	NA	NA
WP_088902932.1\|3244897_3245323_-	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	2.1e-50	70.0
WP_088902933.1\|3245335_3246625_-	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	3.0e-172	73.1
WP_088902934.1\|3246672_3248424_-	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_088902935.1\|3248441_3248804_-	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_039186022.1\|3248849_3249203_-	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	3.1e-23	49.1
WP_088902936.1\|3249362_3249803_-	protein tyrosine phosphatase	NA	NA	NA	NA
WP_088903384.1\|3249850_3250330_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.2e-35	50.0
WP_088902937.1\|3250334_3250706_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088902938.1\|3251059_3252634_-	hypothetical protein	NA	NA	NA	NA
WP_088902939.1\|3253190_3254405_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	1.8e-155	66.6
3258046:3258062	attR	NA	NA	NA	NA

DBSCAN-SWA_224

3266900 : 3268292

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024026.1\|3266900_3268292_-	xanthine/proton symporter XanP	H9YQ34	environmental_Halophage	2.5e-68	95.9

DBSCAN-SWA_225

3272552 : 3277580

Bordetella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024038.1\|3272552_3274667_-	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5
WP_000135058.1\|3274685_3274961_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_003024042.1\|3275015_3275639_-	guanylate kinase	K4JYM5	Abalone_herpesvirus	2.2e-19	35.6
WP_088902944.1\|3275900_3277580_+	NAD-dependent DNA ligase LigB	G3M9X7	Bacillus_virus	2.3e-23	23.4

DBSCAN-SWA_226

3281661 : 3286224

Xanthomonas_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024065.1\|3281661_3282117_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	1.6e-48	60.1
WP_088903385.1\|3282097_3283318_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	2.7e-42	34.6
WP_003837605.1\|3283489_3284155_+	JAB domain-containing protein	NA	NA	NA	NA
WP_003024071.1\|3284373_3284610_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_003024094.1\|3284630_3284798_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003844529.1\|3284896_3285706_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	3.1e-26	31.6
WP_003024099.1\|3285744_3286224_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.3e-27	43.2

DBSCAN-SWA_227

3290948 : 3292930

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044714175.1\|3290948_3291959_+	LPS 1,2-glucosyltransferase	A0ZYL4	Archaeal_BJ1_virus	7.1e-12	27.1
WP_088902948.1\|3291985_3292930_-	glycosyl transferase family 8	A0ZYL4	Archaeal_BJ1_virus	4.9e-15	26.0

DBSCAN-SWA_228

3298324 : 3307696

Prochlorococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902952.1\|3298324_3299257_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.0e-36	37.1
WP_049002652.1\|3299472_3300669_+	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	2.4e-35	29.4
WP_003024132.1\|3300678_3301704_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8
WP_088902953.1\|3301896_3302934_+	glycosyltransferase	NA	NA	NA	NA
WP_088902954.1\|3302934_3303870_-	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_088902955.1\|3303873_3305157_-	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	1.8e-07	34.3
WP_088903386.1\|3305166_3306711_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_003024148.1\|3306960_3307392_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_003024152.1\|3307444_3307696_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	2.2e-15	53.4

DBSCAN-SWA_229

3329990 : 3336587

uncultured_Caudovirales_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902960.1\|3329990_3332447_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	5.4e-21	41.7
WP_088902961.1\|3332647_3333256_+	glutathione S-transferase	NA	NA	NA	NA
WP_088902962.1\|3333354_3334746_+\|tRNA	L-seryl-tRNA(Sec) selenium transferase	NA	NA	NA	NA
WP_088902963.1\|3334742_3336587_+	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	5.3e-13	25.5

DBSCAN-SWA_230

3359856 : 3360852

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837703.1\|3359856_3360852_-	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	5.9e-11	24.8

DBSCAN-SWA_231

3365259 : 3368166

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000014594.1\|3365259_3365472_-	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	2.7e-22	72.9
WP_049002068.1\|3365751_3366042_-	HTH-type transcriptional regulator	NA	NA	NA	NA
WP_088902968.1\|3366422_3367133_+	DUF3053 domain-containing protein	NA	NA	NA	NA
WP_016151146.1\|3367191_3368166_-	glyoxylate/hydroxypyruvate reductase GhrB	M1HST2	Paramecium_bursaria_Chlorella_virus	6.4e-18	27.0

DBSCAN-SWA_232

3373575 : 3375909

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902971.1\|3373575_3375909_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	2.3e-74	30.9

DBSCAN-SWA_233

3386046 : 3388031

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024317.1\|3386046_3387030_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-14	31.2
WP_003024319.1\|3387026_3388031_+	dipeptide ABC transporter ATP binding subunit DppF	G3M9Y6	Bacillus_virus	2.5e-17	29.9

DBSCAN-SWA_234

3419511 : 3421554

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902979.1\|3419511_3421554_+	oligopeptidase A	A0A1V0SD92	Indivirus	1.7e-44	23.1

DBSCAN-SWA_235

3440322 : 3441469

Shigella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088902985.1\|3440322_3441469_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.0e-148	93.0

DBSCAN-SWA_236

3457820 : 3462045

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846160.1\|3457820_3460568_+	ribosome-associated ATPase/putative transporter RbbA	W6JKT0	Anomala_cuprea_entomopoxvirus	8.7e-20	32.6
WP_003837801.1\|3460567_3461692_+	ABC transporter permease	NA	NA	NA	NA
WP_003837806.1\|3461769_3462045_+	type II toxin-antitoxin system HicA family toxin	R4JMD3	Burkholderia_phage	3.2e-15	47.6

DBSCAN-SWA_237

3466638 : 3470711

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837818.1\|3466638_3467304_-	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	3.3e-58	54.9
WP_003023404.1\|3467472_3467718_+	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	4.7e-10	83.3
WP_046671265.1\|3467811_3470010_-	Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA	E4ZFI9	Streptococcus_phage	1.0e-116	37.6
WP_088902987.1\|3470084_3470711_-	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	8.0e-30	61.1

DBSCAN-SWA_238

3476050 : 3478880

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023420.1\|3476050_3476719_+	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	27.6
WP_003837835.1\|3476711_3477770_+	cell division protein FtsX	NA	NA	NA	NA
WP_003023425.1\|3478025_3478880_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	7.0e-45	41.9

DBSCAN-SWA_239

3484624 : 3486123

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023438.1\|3484624_3485392_+	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	W6JKT0	Anomala_cuprea_entomopoxvirus	3.7e-13	25.1
WP_003827581.1\|3485409_3486123_+	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	3.7e-15	30.1

DBSCAN-SWA_240

3489902 : 3491713

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023452.1\|3489902_3490973_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.6e-20	32.0
WP_049003511.1\|3490969_3491713_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	3.7e-10	25.3

DBSCAN-SWA_241

3516546 : 3518994

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023492.1\|3516546_3518994_+	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	3.6e-33	82.1

DBSCAN-SWA_242

3526242 : 3528636

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044713881.1\|3526242_3528636_+	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	2.8e-14	40.2

DBSCAN-SWA_243

3542051 : 3546794

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|3542051_3542999_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_016197640.1\|3543067_3543748_+	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	6.4e-25	33.0
WP_003837891.1\|3543744_3545097_+	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	4.3e-12	23.6
WP_044713874.1\|3545171_3546794_-	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	4.8e-143	52.5

DBSCAN-SWA_244

3563756 : 3564593

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023558.1\|3563756_3564593_+	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	8.4e-67	49.1

DBSCAN-SWA_245

3583586 : 3587636

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847954.1\|3583586_3584150_+	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	6.0e-61	56.5
WP_003023603.1\|3584235_3585453_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	5.7e-32	28.2
WP_003023605.1\|3585548_3587636_-	membrane protein	H9YQA8	environmental_Halophage	5.5e-67	89.1

DBSCAN-SWA_246

3591371 : 3596659

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903005.1\|3591371_3592091_-	NUDIX hydrolase	G3MA14	Bacillus_virus	4.3e-19	27.5
WP_032937275.1\|3592282_3593143_+	ribose-phosphate pyrophosphokinase	G0X553	Salmonella_phage	5.6e-50	40.6
WP_058842738.1\|3593157_3594648_+	nicotinate phosphoribosyltransferase	A0A218KC49	Bacillus_phage	3.7e-142	52.4
WP_046671299.1\|3594757_3596659_-	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.5e-74	33.9

DBSCAN-SWA_247

3602415 : 3607987

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023646.1\|3602415_3602802_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	6.7e-19	40.6
WP_049001488.1\|3602801_3603161_+	sulfurtransferase complex subunit TusC	NA	NA	NA	NA
WP_003023651.1\|3603168_3603456_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.4e-05	39.2
WP_003023654.1\|3603581_3603956_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_003023657.1\|3604051_3604522_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_003023659.1\|3604618_3606733_+	elongation factor G	E4ZFJ7	Streptococcus_phage	6.2e-58	27.1
WP_003031109.1\|3606802_3607987_+	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1

DBSCAN-SWA_248

3627886 : 3629358

Prochlorococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845229.1\|3627886_3628834_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-08	39.8
WP_003031159.1\|3628848_3629358_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.6e-18	40.3

DBSCAN-SWA_249

3639795 : 3643951

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025300.1\|3639795_3640554_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-20	31.7
WP_088903007.1\|3640561_3641665_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_032938248.1\|3641674_3642856_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003025295.1\|3642925_3643951_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	9.0e-71	39.5

DBSCAN-SWA_250

3650557 : 3651442

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839873.1\|3650557_3651442_-	adenine-specific DNA-methyltransferase	M4QNN5	Ostreococcus_lucimarinus_virus	2.1e-28	32.8

DBSCAN-SWA_251

3664099 : 3665143

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000913396.1\|3664099_3665143_+	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_252

3682871 : 3684239

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025151.1\|3682871_3684239_-\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	2.5e-20	25.3

DBSCAN-SWA_253

3688141 : 3688645

Pseudomonas_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025130.1\|3688141_3688645_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.3e-26	54.8

DBSCAN-SWA_254

3692473 : 3693964

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025119.1\|3692473_3693964_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-08	23.9

DBSCAN-SWA_255

3704918 : 3719055

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839924.1\|3704918_3705848_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	6.7e-17	32.8
WP_003025089.1\|3706053_3708390_+	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	4.9e-40	30.8
WP_003839926.1\|3708619_3709273_+	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_003839927.1\|3709269_3709989_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_003025086.1\|3710119_3710392_-	PTS phosphocarrier protein NPr	NA	NA	NA	NA
WP_003025085.1\|3710388_3711243_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
WP_044714527.1\|3711288_3711780_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003025078.1\|3711863_3712151_-	ribosome hibernation promoting factor	A0A0M7QCF2	Escherichia_phage	4.2e-10	43.2
WP_003025074.1\|3712173_3713607_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003025073.1\|3713653_3714379_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-22	28.4
WP_003025070.1\|3714385_3714934_-	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_003025068.1\|3714902_3715478_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_088903014.1\|3715474_3716041_-	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	4.2e-54	76.3
WP_003025063.1\|3716061_3717048_-	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.9e-38	31.5
WP_003839941.1\|3717061_3718039_-	calcium/sodium antiporter	NA	NA	NA	NA
WP_088903015.1\|3718254_3719055_+	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	7.3e-20	30.6

DBSCAN-SWA_256

3723159 : 3724638

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839952.1\|3723159_3723444_-	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	6.0e-17	65.7
WP_003025033.1\|3723666_3724638_-	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	1.6e-08	26.2

DBSCAN-SWA_257

3731318 : 3734200

Micromonas_pusilla_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025013.1\|3731318_3733253_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	4.1e-117	43.6
WP_003025010.1\|3733351_3734200_+	dihydropteroate synthase	S4VNV0	Pandoravirus	1.3e-19	31.2

DBSCAN-SWA_258

3740025 : 3746670

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024998.1\|3740025_3741369_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	4.8e-64	93.7
WP_003024996.1\|3741986_3742439_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003024992.1\|3742467_3743955_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003844847.1\|3743979_3746670_+	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	2.5e-24	26.4

DBSCAN-SWA_259

3752260 : 3754189

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839970.1\|3752260_3754189_+	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	30.8

DBSCAN-SWA_260

3759953 : 3766042

Invertebrate_iridovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044714514.1\|3759953_3760253_-	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	4.2e-13	53.2
WP_044714511.1\|3760305_3760734_+	YhbP family protein	NA	NA	NA	NA
WP_003024957.1\|3760771_3761407_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003024954.1\|3761500_3762076_-	divisome-associated lipoprotein YraP	NA	NA	NA	NA
WP_003024948.1\|3762085_3762676_-	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	3.2e-12	31.8
WP_003024946.1\|3762710_3763106_-	YraN family protein	NA	NA	NA	NA
WP_088903020.1\|3763063_3765115_-	penicillin-binding protein activator	NA	NA	NA	NA
WP_003024942.1\|3765178_3766042_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.6e-50	43.6

DBSCAN-SWA_261

3791666 : 3792812

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049001679.1\|3791666_3792812_+	glycerate 2-kinase	W6LM47	Streptococcus_phage	2.7e-47	39.9

DBSCAN-SWA_262

3798838 : 3801133

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024871.1\|3798838_3801133_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	5.3e-156	40.4

DBSCAN-SWA_263

3822144 : 3823113

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003828551.1\|3822144_3823113_-	TerC family protein	A0A291LBC5	Escherichia_phage	3.5e-32	31.8

DBSCAN-SWA_264

3834124 : 3846170

Herpes_simplex_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903035.1\|3834124_3837217_-	beta-galactosidase subunit alpha	L0N6M2	Herpes_simplex_virus	2.6e-158	34.1
WP_003024771.1\|3837424_3838408_-	transcriptional regulator EbgR	NA	NA	NA	NA
WP_003024768.1\|3838616_3838949_+\|tRNA	tRNA-binding protein	NA	NA	NA	NA
WP_048998748.1\|3839022_3840465_-	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.7e-33	28.7
WP_003024763.1\|3840832_3842353_+	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	2.9e-33	49.3
WP_044713675.1\|3842406_3843081_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_088903036.1\|3843320_3844103_+	siderophore-interacting protein	NA	NA	NA	NA
WP_032941143.1\|3844099_3844948_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003846231.1\|3845015_3846170_+	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.6e-84	45.8

DBSCAN-SWA_265

3859897 : 3861214

Klebsiella_phage(100.0%)

integrase

attL 3858020:3858033|attR 3867747:3867760

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3858020:3858033	attL	NA	NA	NA	NA
WP_023326125.1\|3859897_3861214_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	2.7e-35	30.2
WP_023326125.1\|3859897_3861214_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	2.7e-35	30.2
3867747:3867760	attR	NA	NA	NA	NA

DBSCAN-SWA_266

3884921 : 3885902

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032441801.1\|3884921_3885902_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	2.8e-186	99.4

DBSCAN-SWA_267

3890245 : 3890677

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903392.1\|3890245_3890677_+	antirestriction protein	A0A2D0W9W4	Bordetella_phage	7.0e-17	35.7

DBSCAN-SWA_268

3894700 : 3903459

Acinetobacter_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903056.1\|3894700_3896698_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.9e-08	27.2
WP_048218613.1\|3896708_3897758_-	YncE family protein	NA	NA	NA	NA
WP_157676228.1\|3897706_3897907_+	DUF3156 family protein	NA	NA	NA	NA
WP_003024699.1\|3897919_3899767_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
WP_003024697.1\|3900010_3901756_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	8.4e-77	38.8
WP_001144069.1\|3901993_3902209_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_003024694.1\|3902445_3903459_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.4e-110	59.8

DBSCAN-SWA_269

3914813 : 3916055

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903057.1\|3914813_3916055_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	2.4e-94	49.3

DBSCAN-SWA_270

3921305 : 3922739

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838125.1\|3921305_3922739_+	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	2.2e-38	28.8

DBSCAN-SWA_271

3926336 : 3926990

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838130.1\|3926336_3926990_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.1e-45	44.3

DBSCAN-SWA_272

3938753 : 3946837

Ralstonia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024594.1\|3938753_3939914_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	5.0e-86	42.9
WP_003024591.1\|3939919_3940597_-	DUF1190 family protein	A0A173GEW8	Erwinia_phage	2.6e-34	45.0
WP_085951568.1\|3940754_3942233_-	outer membrane channel protein TolC	NA	NA	NA	NA
WP_003024585.1\|3942431_3943064_+	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	1.2e-20	34.7
WP_003024582.1\|3943060_3943483_+	DUF1249 family protein	NA	NA	NA	NA
WP_003838143.1\|3943507_3944335_+	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
WP_088903060.1\|3944334_3944916_+	esterase YqiA	NA	NA	NA	NA
WP_003024571.1\|3944944_3946837_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.0e-92	34.8

DBSCAN-SWA_273

3957154 : 3959930

Stx_converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024544.1\|3957154_3957553_+	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	9.9e-18	43.9
WP_047715920.1\|3957671_3959930_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	7.5e-86	35.5

DBSCAN-SWA_274

3964038 : 3969284

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024532.1\|3964038_3966210_+	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	1.3e-103	70.4
WP_003024529.1\|3966313_3966769_-	HIT family protein	Q5YEY9	Rock_bream_iridovirus	2.1e-19	34.7
WP_088903064.1\|3966813_3968268_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_003024520.1\|3968456_3969284_-	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.1e-63	46.0

DBSCAN-SWA_275

3979150 : 3980791

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048217165.1\|3979150_3980791_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.5e-11	54.7

DBSCAN-SWA_276

3999903 : 4001928

Ochrobactrum_phage(50.0%)

integrase

attL 3983974:3983987|attR 4002915:4002928

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3983974:3983987	attL	NA	NA	NA	NA
WP_088903069.1\|3999903_4000461_-	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	2.3e-20	53.5
WP_088903070.1\|4000668_4001928_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1B0VMI6	Pseudomonas_phage	1.3e-82	44.6
4002915:4002928	attR	NA	NA	NA	NA

DBSCAN-SWA_277

4007103 : 4008189

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049001609.1\|4007103_4008189_-	membrane-bound lytic murein transglycosylase MltC	A0A0H3V0Q1	Geobacillus_virus	4.5e-12	39.0

DBSCAN-SWA_278

4023954 : 4026903

Aichi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027074.1\|4023954_4025349_-	sugar porter family MFS transporter	O13311	Aichi_virus	1.4e-26	25.5
WP_003027071.1\|4025748_4026903_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.3e-128	63.2

DBSCAN-SWA_279

4039674 : 4040358

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903077.1\|4039674_4040358_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.5e-10	23.6

DBSCAN-SWA_280

4057868 : 4059101

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003026984.1\|4057868_4059101_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.1e-102	47.6

DBSCAN-SWA_281

4067357 : 4072563

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044713822.1\|4067357_4070231_+	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	3.4e-261	51.0
WP_071687456.1\|4070292_4071036_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_088903082.1\|4071129_4072563_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	2.8e-30	26.1

DBSCAN-SWA_282

4077262 : 4090932

Bacillus_phage(33.33%)

transposase,tRNA,integrase

attL 4073487:4073501|attR 4091685:4091699

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4073487:4073501	attL	NA	NA	NA	NA
WP_088903084.1\|4077262_4078159_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	4.3e-29	27.6
WP_003825520.1\|4078182_4078896_+	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
WP_048232743.1\|4078901_4080635_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.5e-62	28.7
WP_096878465.1\|4080726_4081824_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	1.8e-05	39.0
WP_003026911.1\|4081834_4083352_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.3e-86	36.9
WP_088903085.1\|4083429_4083984_-	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_003026902.1\|4084150_4084909_+	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	3.2e-09	37.3
WP_048998164.1\|4085226_4086417_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	3.6e-140	61.2
WP_085950818.1\|4086443_4087564_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_000790483.1\|4088101_4088533_-	silver-binding protein SilE	NA	NA	NA	NA
WP_032433718.1\|4088783_4090259_-	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	1.8e-27	29.7
WP_038633715.1\|4090251_4090932_-	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	7.8e-31	35.7
4091685:4091699	attR	NA	NA	NA	NA

DBSCAN-SWA_283

4100828 : 4101566

Listeria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000287501.1\|4100828_4101566_-	peptidase	A8ATH6	Listeria_phage	1.0e-12	41.0

DBSCAN-SWA_284

4106660 : 4108738

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001188930.1\|4106660_4107341_+	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	8.7e-30	34.4
WP_009654301.1\|4107337_4108738_+	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	6.4e-19	26.9

DBSCAN-SWA_285

4124020 : 4126516

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033923.1\|4124020_4124782_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-19	32.1
WP_003033926.1\|4125097_4126516_+	sugar porter family MFS transporter	O13311	Aichi_virus	5.1e-24	26.7

DBSCAN-SWA_286

4130154 : 4131165

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937458.1\|4130154_4131165_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.1e-32	30.4

DBSCAN-SWA_287

4140452 : 4144564

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033984.1\|4140452_4142699_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	5.1e-10	24.6
WP_003033987.1\|4142887_4143763_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_006686967.1\|4143769_4144564_+	thymidylate synthase	R4IFY1	Cronobacter_phage	2.4e-116	62.0

DBSCAN-SWA_288

4150044 : 4165585

Klosneuvirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903095.1\|4150044_4152933_+	pitrilysin	A0A1V0SJA4	Klosneuvirus	4.0e-68	24.9
WP_088903096.1\|4152925_4156471_+	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	5.2e-09	20.1
WP_088903097.1\|4156467_4158297_+	exodeoxyribonuclease V subunit alpha	A0A1P8DII4	Virus_Rctr197k	1.9e-18	34.4
WP_003034012.1\|4158421_4159753_-	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_003840937.1\|4159987_4161241_+	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	2.7e-13	28.4
WP_003034021.1\|4161842_4162940_+	murein transglycosylase A	NA	NA	NA	NA
WP_003846496.1\|4163049_4163856_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.2e-16	32.8
WP_003846500.1\|4163933_4164380_-	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
WP_003840388.1\|4164379_4165585_-	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	6.2e-71	36.0

DBSCAN-SWA_289

4173819 : 4175319

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034052.1\|4173819_4175319_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-20	31.6

DBSCAN-SWA_290

4182069 : 4182825

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846524.1\|4182069_4182825_-	flap endonuclease Xni	F8WQ40	Bacillus_phage	3.9e-07	28.7

DBSCAN-SWA_291

4187739 : 4188588

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034084.1\|4187739_4188588_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.8e-40	37.3

DBSCAN-SWA_292

4193111 : 4201193

Oenococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903102.1\|4193111_4194452_+	glucarate dehydratase	Q6A202	Oenococcus_phage	3.5e-06	24.3
WP_088903103.1\|4194472_4195813_+	glucarate dehydratase	NA	NA	NA	NA
WP_088903104.1\|4195894_4197037_+	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-49	41.4
WP_003840349.1\|4197080_4199837_-	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.0e-52	29.5
WP_032938359.1\|4199894_4201193_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.4e-36	27.9

DBSCAN-SWA_293

4204667 : 4207691

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034127.1\|4204667_4206305_+	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.7e-153	50.6
WP_003034129.1\|4206392_4207691_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.4e-129	57.9

DBSCAN-SWA_294

4214086 : 4214758

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034139.1\|4214086_4214758_+	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	3.9e-14	24.6

DBSCAN-SWA_295

4222107 : 4224140

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903107.1\|4222107_4223535_+	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	1.8e-32	25.8
WP_088903108.1\|4223534_4224140_+	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	1.6e-27	38.4

DBSCAN-SWA_296

4227313 : 4231017

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003825728.1\|4227313_4228075_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.5e-57	46.7
WP_003034172.1\|4228068_4228695_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.4e-36	50.6
WP_003840324.1\|4228834_4229962_+	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	5.0e-06	34.6
WP_088903109.1\|4230024_4231017_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	4.6e-32	37.6

DBSCAN-SWA_297

4234495 : 4237063

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903110.1\|4234495_4237063_-	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	1.1e-32	21.0

DBSCAN-SWA_298

4242195 : 4245930

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903111.1\|4242195_4243011_-	iron/manganese ABC transporter ATP-binding protein SitB	W8CYL7	Bacillus_phage	1.0e-08	27.9
WP_049003390.1\|4243007_4243925_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003840292.1\|4244105_4244879_-	hypothetical protein	NA	NA	NA	NA
WP_016150891.1\|4244889_4245930_-	porin	Q1MVN1	Enterobacteria_phage	3.9e-05	22.1

DBSCAN-SWA_299

4278831 : 4279797

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037353.1\|4278831_4279797_-	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	1.8e-36	33.9

DBSCAN-SWA_300

4285357 : 4290778

Pseudomonas_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037333.1\|4285357_4285855_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.6e-31	51.0
WP_003037330.1\|4285947_4287012_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	4.0e-114	63.8
WP_003037326.1\|4287098_4287599_+	recombination regulator RecX	NA	NA	NA	NA
WP_003037323.1\|4287727_4290355_+\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	8.4e-81	38.8
WP_000906486.1\|4290592_4290778_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7

DBSCAN-SWA_301

4305277 : 4310574

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037282.1\|4305277_4306480_-	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.9e-27	38.1
WP_088903125.1\|4306834_4307794_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	8.5e-132	71.2
WP_088903126.1\|4307804_4309949_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	4.5e-197	48.6
WP_003037273.1\|4309921_4310332_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.6e-17	41.0
WP_003037270.1\|4310328_4310574_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.8e-12	42.5

DBSCAN-SWA_302

4316333 : 4320354

Clostridioides_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037241.1\|4316333_4316783_+	peptidoglycan-binding protein LysM	A0A1V0DZX0	Clostridioides_phage	3.7e-05	38.2
WP_057102424.1\|4316795_4317482_-	DNA-binding transcriptional regulator CsiR	NA	NA	NA	NA
WP_003839698.1\|4317527_4318928_-	GABA permease	NA	NA	NA	NA
WP_088903131.1\|4319070_4320354_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	6.2e-29	28.9

DBSCAN-SWA_303

4327862 : 4329233

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903395.1\|4327862_4329233_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.7e-16	31.9

DBSCAN-SWA_304

4342299 : 4493948

123

Cronobacter_phage(46.81%)

terminase,capsid,integrase,holin,portal,head,transposase,tRNA,tail

attL 4407040:4407058|attR 4486605:4486623

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000427623.1\|4342299_4343304_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_003037180.1\|4344538_4345096_+	polysaccharide export protein	NA	NA	NA	NA
WP_088903137.1\|4345098_4347228_+	capsular biosynthesis protein	NA	NA	NA	NA
WP_088903138.1\|4347224_4348436_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_003037174.1\|4348432_4349803_+	hypothetical protein	NA	NA	NA	NA
WP_088903139.1\|4349807_4350797_+	glycosyltransferase	NA	NA	NA	NA
WP_088903140.1\|4350811_4352023_+	glycosyltransferase family 4 protein	A0A2P0VNG4	Tetraselmis_virus	1.3e-12	31.6
WP_032938077.1\|4352024_4353137_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_032938074.1\|4353139_4353547_+	hypothetical protein	NA	NA	NA	NA
WP_049002284.1\|4355014_4356031_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	5.5e-81	46.8
WP_044713272.1\|4356098_4357037_-	hypothetical protein	NA	NA	NA	NA
WP_003037157.1\|4357260_4357896_-	carbonic anhydrase	NA	NA	NA	NA
WP_088903141.1\|4358154_4358664_+	hypothetical protein	NA	NA	NA	NA
WP_008321488.1\|4358742_4360491_-	signal transduction protein	NA	NA	NA	NA
WP_088903142.1\|4363280_4364597_+	ATP-binding protein	NA	NA	NA	NA
WP_088903143.1\|4364593_4366789_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_088903144.1\|4369434_4370961_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_088903145.1\|4371212_4371893_+	inovirus Gp2 family protein	NA	NA	NA	NA
WP_088903146.1\|4371979_4373221_-\|integrase	integrase	A0A1B5FPC6	Escherichia_phage	2.2e-103	48.3
WP_085951585.1\|4373860_4375024_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_088903147.1\|4375031_4377218_-	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	7.1e-17	29.8
WP_003839817.1\|4377214_4378624_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_088903148.1\|4378724_4389929_-	BapA prefix-like domain-containing protein	NA	NA	NA	NA
WP_003031211.1\|4390512_4390995_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.2e-28	46.8
WP_071524313.1\|4391137_4391593_+	type II toxin-antitoxin system toxin RatA	NA	NA	NA	NA
WP_003839823.1\|4391576_4391873_+	RnfH family protein	NA	NA	NA	NA
WP_003826401.1\|4391923_4392268_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_032937967.1\|4392417_4394079_-	DNA repair protein RecN	NA	NA	NA	NA
WP_003031220.1\|4394164_4395043_-	NAD(+) kinase	NA	NA	NA	NA
WP_003031221.1\|4395165_4395759_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_008324538.1\|4395808_4397098_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_003031224.1\|4397116_4397908_-	inner membrane protein YpjD	NA	NA	NA	NA
WP_088903149.1\|4398073_4399435_+	signal recognition particle protein	NA	NA	NA	NA
WP_003031228.1\|4399688_4399937_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_003031230.1\|4399955_4400504_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_003031232.1\|4400548_4401316_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_002914145.1\|4401355_4401703_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_003839836.1\|4401834_4402317_-	OmpA family protein	NA	NA	NA	NA
WP_003839838.1\|4402329_4403556_-	diguanylate cyclase DgcN	A0A2K8I9Y5	Pseudomonas_phage	1.1e-06	37.6
WP_048217251.1\|4403548_4404067_-	YfiR family protein	NA	NA	NA	NA
WP_088903150.1\|4404225_4404600_-	DUF2799 domain-containing protein	NA	NA	NA	NA
WP_003031241.1\|4404814_4405885_+	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	4.5e-89	50.9
WP_048217253.1\|4405895_4407017_+	bifunctional chorismate mutase/prephenate dehydrogenase	NA	NA	NA	NA
4407040:4407058	attL	NA	NA	NA	NA
WP_088903151.1\|4407113_4408274_-	bifunctional chorismate mutase/prephenate dehydratase	NA	NA	NA	NA
WP_100250063.1\|4408373_4408421_-	hypothetical protein	NA	NA	NA	NA
WP_077918515.1\|4408584_4409604_-\|integrase	tyrosine-type recombinase/integrase	A0A0F7LBR0	Escherichia_phage	5.0e-106	56.3
WP_077918516.1\|4409643_4409952_-	helix-turn-helix transcriptional regulator	Q1JS21	Enterobacteria_phage	1.0e-22	53.2
WP_045719137.1\|4410052_4410340_+	regulatory protein	NA	NA	NA	NA
WP_045719138.1\|4410373_4410694_+	hypothetical protein	NA	NA	NA	NA
WP_045719139.1\|4410709_4411270_+	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	2.0e-24	35.4
WP_045719140.1\|4411530_4414188_+	toprim domain-containing protein	A0A077K8T2	Ralstonia_phage	2.3e-243	47.1
WP_045719141.1\|4414403_4414733_-	ogr/Delta-like zinc finger family protein	F1BUM8	Cronobacter_phage	1.1e-27	58.2
WP_045719142.1\|4414732_4415752_-\|portal	phage portal protein	F1BUM7	Cronobacter_phage	1.0e-135	69.1
WP_088903153.1\|4415748_4417533_-\|terminase	terminase	F1BUM5	Cronobacter_phage	3.2e-249	70.4
WP_045719143.1\|4417712_4418552_+\|capsid	phage capsid scaffolding protein	F1BUM4	Cronobacter_phage	4.8e-46	52.0
WP_088903154.1\|4418586_4419606_+\|capsid	phage major capsid protein, P2 family	F1BUM2	Cronobacter_phage	1.2e-136	73.5
WP_044713213.1\|4419616_4420315_+\|terminase	terminase	F1BUM0	Cronobacter_phage	2.3e-62	52.6
WP_000505908.1\|4420333_4420525_+	hypothetical protein	NA	NA	NA	NA
WP_000491223.1\|4420618_4421071_+\|head	head completion/stabilization protein	F1BUL8	Cronobacter_phage	1.2e-48	64.7
WP_045719146.1\|4421067_4421550_+\|tail	phage tail protein	F1BUL7	Cronobacter_phage	2.3e-37	48.7
WP_044713206.1\|4421546_4422251_+	hypothetical protein	F1BUL6	Cronobacter_phage	4.0e-70	59.5
WP_045719147.1\|4422247_4423375_+	DUF2586 domain-containing protein	F1BUL5	Cronobacter_phage	5.6e-175	83.5
WP_023185863.1\|4423371_4423827_+	DUF2597 family protein	F1BUL4	Cronobacter_phage	1.3e-58	72.2
WP_088903155.1\|4423839_4424136_+\|holin	holin	NA	NA	NA	NA
WP_044713197.1\|4424132_4424474_+	M15 family metallopeptidase	F1BUL3	Cronobacter_phage	2.1e-45	86.1
WP_044713196.1\|4424473_4424806_+	hypothetical protein	F1BUL2	Cronobacter_phage	3.9e-36	68.2
WP_143759641.1\|4424952_4425210_+	hypothetical protein	A5X9I7	Aeromonas_virus	6.2e-21	62.2
WP_088903158.1\|4425397_4427437_+\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	2.1e-252	68.2
WP_044713189.1\|4427433_4427763_+	DUF2590 family protein	F1BUK8	Cronobacter_phage	6.0e-37	71.4
WP_088903159.1\|4427759_4428944_+	hypothetical protein	F1BUK6	Cronobacter_phage	1.4e-181	80.4
WP_071698597.1\|4428936_4429524_+	hypothetical protein	F1BUK5	Cronobacter_phage	6.9e-92	82.6
WP_031285326.1\|4431356_4432304_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_088903161.1\|4432727_4433261_+\|tail	phage tail protein	F1BUK2	Cronobacter_phage	1.5e-21	36.4
WP_088903162.1\|4433250_4433976_+	hypothetical protein	F1BUK1	Cronobacter_phage	1.2e-66	55.2
WP_044713177.1\|4433947_4434493_+	hypothetical protein	F1BUJ9	Cronobacter_phage	3.5e-66	73.6
WP_143759654.1\|4434495_4436196_+	hypothetical protein	F1BUJ7	Cronobacter_phage	2.0e-224	80.4
WP_157676229.1\|4436379_4436517_-	hypothetical protein	NA	NA	NA	NA
WP_088903164.1\|4437227_4437530_-	hypothetical protein	NA	NA	NA	NA
WP_003031244.1\|4437770_4438109_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_003031245.1\|4438378_4439116_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_003031246.1\|4439247_4440228_+	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_088903165.1\|4440224_4440956_+	polyphenol oxidase	NA	NA	NA	NA
WP_003031249.1\|4441085_4443659_+	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	1.5e-127	35.2
WP_003037551.1\|4449488_4450787_+	MFS transporter	Q6JIH2	Burkholderia_virus	5.3e-44	31.1
WP_046670183.1\|4450783_4451107_-	YfiM family lipoprotein	NA	NA	NA	NA
WP_008319601.1\|4451151_4452507_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_088903166.1\|4452621_4455282_-	protein lysine acetyltransferase	NA	NA	NA	NA
WP_003835347.1\|4455318_4456017_-	DTW domain-containing protein	NA	NA	NA	NA
WP_003037559.1\|4456086_4456506_-	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	8.3e-15	36.5
WP_003037560.1\|4456713_4457793_+\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_017900911.1\|4457902_4459231_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_003037561.1\|4459265_4459955_-	uracil-DNA glycosylase	A0A076JX67	Equid_alphaherpesvirus	7.9e-55	49.3
WP_003037563.1\|4460272_4460656_+	autonomous glycyl radical cofactor GrcA	A0A1W5N098	Cronobacter_phage	3.6e-33	70.9
WP_088903167.1\|4460735_4461323_-	cysteine/O-acetylserine transporter	NA	NA	NA	NA
WP_088903168.1\|4461425_4462322_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003037569.1\|4462339_4463668_-	ATP-dependent RNA helicase SrmB	E3T5E1	Cafeteria_roenbergensis_virus	2.5e-41	29.1
WP_003847060.1\|4463798_4464536_+\|tRNA	tRNA(1)(Val) (adenine(37)-N(6))-methyltransferase TrmN	NA	NA	NA	NA
WP_088903169.1\|4464520_4466143_-	L-aspartate oxidase	NA	NA	NA	NA
WP_049259737.1\|4466406_4466571_+	rpoE leader peptide RseD	NA	NA	NA	NA
WP_003037573.1\|4466567_4467143_+	RNA polymerase sigma factor RpoE	NA	NA	NA	NA
WP_003037574.1\|4467174_4467825_+	anti-sigma-E factor RseA	NA	NA	NA	NA
WP_003847063.1\|4467824_4468781_+	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
WP_003037576.1\|4468777_4469242_+	SoxR-reducing system protein RseC	NA	NA	NA	NA
WP_088903170.1\|4469512_4471312_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	6.5e-24	25.1
WP_003037578.1\|4471327_4472302_+	signal peptidase I	NA	NA	NA	NA
WP_003037579.1\|4472571_4473252_+	ribonuclease III	A0A2K9L5P0	Tupanvirus	1.6e-20	31.8
WP_003037581.1\|4473248_4474154_+	GTPase Era	NA	NA	NA	NA
WP_003037583.1\|4474181_4474910_+	DNA repair protein RecO	NA	NA	NA	NA
WP_003838383.1\|4474921_4475653_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_003037588.1\|4475652_4476033_+	holo-ACP synthase	NA	NA	NA	NA
WP_003037590.1\|4476062_4476323_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.7e-18	54.7
WP_003037593.1\|4476378_4477227_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_088903396.1\|4477344_4478238_+	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
WP_003037603.1\|4479614_4480250_+	phosphatidylglycerophosphatase C	NA	NA	NA	NA
WP_088903171.1\|4480267_4480804_+\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_003838390.1\|4480816_4482367_-	membrane-bound lytic murein transglycosylase MltF	NA	NA	NA	NA
WP_088903172.1\|4482623_4486511_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	3.8e-130	59.0
WP_136345775.1\|4487146_4488577_+	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	1.6e-12	25.6
4486605:4486623	attR	NA	NA	NA	NA
WP_003037617.1\|4488599_4489343_+	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_003838398.1\|4489339_4490677_+	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	1.4e-10	34.1
WP_002914032.1\|4490737_4491076_+	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_003037624.1\|4491177_4492368_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_003037627.1\|4492694_4493948_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.9e-100	53.4

DBSCAN-SWA_305

4513240 : 4514749

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060855377.1\|4513240_4514749_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-15	26.4

DBSCAN-SWA_306

4520369 : 4526724

Faustovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903178.1\|4520369_4521584_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6
WP_002913991.1\|4521609_4521996_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.7e-52	77.3
WP_003037681.1\|4522016_4522340_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.2e-22	47.7
WP_088903179.1\|4522448_4522964_+	co-chaperone HscB	NA	NA	NA	NA
WP_003838439.1\|4522979_4524830_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.4e-103	41.9
WP_003037690.1\|4524831_4525167_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003037694.1\|4525178_4525379_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_088903180.1\|4525440_4526724_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	9.9e-35	35.4

DBSCAN-SWA_307

4536101 : 4536533

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037710.1\|4536101_4536533_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	5.3e-17	37.1

DBSCAN-SWA_308

4545509 : 4547051

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037736.1\|4545509_4547051_+	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.4e-160	57.6

DBSCAN-SWA_309

4558705 : 4564890

Bodo_saltans_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903186.1\|4558705_4560079_-	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	4.4e-41	35.0
WP_003037756.1\|4560239_4561706_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	5.7e-87	38.5
WP_003037760.1\|4561769_4563347_+	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_003838477.1\|4563443_4564322_-	small-conductance mechanosensitive channel MscS	NA	NA	NA	NA
WP_049002457.1\|4564686_4564890_-	DUF2633 family protein	G9L6F2	Escherichia_phage	5.6e-17	71.4

DBSCAN-SWA_310

4571317 : 4576915

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838482.1\|4571317_4571959_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	4.5e-28	40.6
WP_003838485.1\|4571955_4572993_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	6.3e-72	42.4
WP_088903187.1\|4573288_4574719_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_003037929.1\|4574902_4575529_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003037932.1\|4575625_4576915_+	uracil permease	Q9KX94	Enterobacteria_phage	1.7e-63	36.7

DBSCAN-SWA_311

4586829 : 4587543

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037964.1\|4586829_4587543_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	2.0e-37	35.7

DBSCAN-SWA_312

4609341 : 4611804

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903195.1\|4609341_4611804_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.8e-21	39.5

DBSCAN-SWA_313

4628090 : 4637575

Paenibacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003038046.1\|4628090_4628960_-	N-acetylmuramoyl-L-alanine amidase AmiA	A0A0N9SGH1	Paenibacillus_phage	1.5e-18	33.3
WP_003038048.1\|4629172_4629598_+	GNAT family acetyltransferase	NA	NA	NA	NA
WP_003847269.1\|4629584_4630034_+	DUF2919 domain-containing protein	NA	NA	NA	NA
WP_016150735.1\|4630093_4630669_+	RpoE-regulated lipoprotein	NA	NA	NA	NA
WP_003838547.1\|4630762_4631662_+	porphyrinogen peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
WP_003038057.1\|4631834_4632626_+	SDR family oxidoreductase UcpA	Q06VL0	Trichoplusia_ni_ascovirus	6.8e-18	31.8
WP_003038059.1\|4632783_4633800_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003038061.1\|4633800_4634634_+	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
WP_003038064.1\|4634633_4635509_+	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
WP_003038066.1\|4635498_4636596_+	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G3M9Y6	Bacillus_virus	9.4e-26	33.7
WP_003838552.1\|4636663_4637575_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.8e-60	43.8

DBSCAN-SWA_314

4641558 : 4651425

Hokovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003038080.1\|4641558_4643286_-	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	7.4e-17	31.1
WP_003038086.1\|4643331_4643589_-	phosphocarrier protein Hpr	NA	NA	NA	NA
WP_003038091.1\|4643972_4644944_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	3.3e-75	51.0
WP_003838567.1\|4645107_4645869_-	sulfate transporter CysZ	NA	NA	NA	NA
WP_088903201.1\|4646099_4647107_+	cell division protein ZipA	NA	NA	NA	NA
WP_071685008.1\|4647178_4649194_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	2.9e-150	43.5
WP_003038102.1\|4649195_4649414_+	DUF3820 family protein	NA	NA	NA	NA
WP_003038103.1\|4649410_4650409_-	bile acid:sodium symporter	NA	NA	NA	NA
WP_046670126.1\|4650498_4651425_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.6e-08	25.9

DBSCAN-SWA_315

4662656 : 4664762

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903205.1\|4662656_4664762_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.2e-26	24.8

DBSCAN-SWA_316

4687289 : 4688024

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044714101.1\|4687289_4688024_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	9.4e-14	25.8

DBSCAN-SWA_317

4692501 : 4693422

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049002837.1\|4692501_4693422_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	7.0e-75	53.5

DBSCAN-SWA_318

4702678 : 4705989

Bacillus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845032.1\|4702678_4703329_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.7e-20	42.4
WP_088903217.1\|4703347_4704340_-	urea transporter	NA	NA	NA	NA
WP_031285326.1\|4705041_4705989_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_319

4713729 : 4714677

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|4713729_4714677_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_320

4719382 : 4724271

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903225.1\|4719382_4719772_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.0e-18	45.1
WP_088903226.1\|4719820_4720351_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_003845054.1\|4720881_4721475_-	Slp family lipoprotein	NA	NA	NA	NA
WP_003845055.1\|4721598_4721853_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_088903227.1\|4722372_4724271_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-14	23.8

DBSCAN-SWA_321

4729360 : 4731225

uncultured_Caudovirales_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903228.1\|4729360_4730212_+	acyltransferase	A0A2H4IZR3	uncultured_Caudovirales_phage	1.5e-18	30.4
WP_031285326.1\|4730277_4731225_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_322

4734634 : 4738616

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903230.1\|4734634_4737070_+	DEAD/DEAH box helicase	Q5YA94	Bacillus_phage	2.8e-22	25.8
WP_003028212.1\|4737143_4738616_+	type I restriction-modification system subunit M	J7I0U9	Acinetobacter_phage	5.6e-34	28.8

DBSCAN-SWA_323

4743611 : 4750322

Morganella_phage(50.0%)

integrase

attL 4729992:4730005|attR 4750587:4750600

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4729992:4730005	attL	NA	NA	NA	NA
WP_003028200.1\|4743611_4746371_-	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	1.9e-285	54.7
WP_003028198.1\|4746487_4746688_-	AlpA family phage regulatory protein	A0A1W6JPE9	Morganella_phage	1.5e-11	55.6
WP_003028196.1\|4746796_4747675_-	hypothetical protein	NA	NA	NA	NA
WP_003028195.1\|4747766_4749044_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A2H4J5F8	uncultured_Caudovirales_phage	4.9e-50	32.4
WP_046670109.1\|4749380_4750322_-	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	2.6e-149	89.6
4750587:4750600	attR	NA	NA	NA	NA

DBSCAN-SWA_324

4759511 : 4760597

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028170.1\|4759511_4760597_+	chorismate synthase	A0A291AU41	Pandoravirus	5.9e-89	47.0

DBSCAN-SWA_325

4769077 : 4770214

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049002855.1\|4769077_4770214_+	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	5.2e-19	26.3

DBSCAN-SWA_326

4776711 : 4778229

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028127.1\|4776711_4778229_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-88	44.0

DBSCAN-SWA_327

4782584 : 4783358

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028114.1\|4782584_4783358_+	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	3.6e-08	27.7

DBSCAN-SWA_328

4798508 : 4799108

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028083.1\|4798508_4799108_-	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	3.1e-07	39.8

DBSCAN-SWA_329

4818028 : 4819033

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839364.1\|4818028_4819033_-	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.4e-28	25.7

DBSCAN-SWA_330

4831714 : 4835819

Tupanvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903245.1\|4831714_4833697_-	bifunctional UDP-4-amino-4-deoxy-L-arabinose formyltransferase/UDP-glucuronic acid oxidase ArnA	A0A2K9KZK0	Tupanvirus	6.3e-20	25.5
WP_003027648.1\|4833693_4834677_-	undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase	A8CG95	Salmonella_phage	9.9e-35	32.5
WP_088903246.1\|4834679_4835819_-	UDP-4-amino-4-deoxy-L-arabinose aminotransferase	A0A2K9L0G1	Tupanvirus	1.1e-29	29.0

DBSCAN-SWA_331

4844920 : 4856922

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839410.1\|4844920_4845988_+	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	2.3e-08	50.9
WP_003027609.1\|4846161_4846416_-	ferredoxin-like diferric-tyrosyl radical cofactor maintenance protein YfaE	G9IAA2	Pseudomonas_phage	2.4e-25	76.1
WP_003027605.1\|4846415_4847546_-	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	1.3e-174	78.9
WP_048215880.1\|4847656_4849942_-	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	4.6e-285	63.9
WP_088903249.1\|4850430_4851159_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_044701169.1\|4851317_4853954_+	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	2.8e-92	31.1
WP_088903250.1\|4854075_4856922_+	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	2.4e-41	26.3

DBSCAN-SWA_332

4861107 : 4869641

Enterobacteria_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057101391.1\|4861107_4862208_+	porin OmpC	Q1MVN1	Enterobacteria_phage	1.7e-115	59.4
WP_044711498.1\|4862323_4863376_+	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
WP_088903251.1\|4863455_4864520_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A2P1EL10	Moumouvirus	5.4e-18	51.8
WP_003027582.1\|4864519_4865170_+	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	2.9e-06	34.3
WP_003027580.1\|4865245_4866889_+	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-10	22.8
WP_088903252.1\|4866994_4868431_+	magnesium transporter	NA	NA	NA	NA
WP_088903402.1\|4868393_4869641_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	8.0e-82	49.0

DBSCAN-SWA_333

4878440 : 4879061

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903255.1\|4878440_4879061_+	cytochrome c biogenesis heme-transporting ATPase CcmA	A0A2H4PQG7	Staphylococcus_phage	1.1e-12	26.3

DBSCAN-SWA_334

4888029 : 4895663

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027504.1\|4888029_4889037_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	1.0e-82	47.6
WP_003027502.1\|4889158_4889443_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_088903404.1\|4889567_4891328_-	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	7.1e-100	41.8
WP_088903257.1\|4891478_4892186_+	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
WP_003027494.1\|4892201_4893392_+	Bcr/CflA family multidrug efflux MFS transporter	S4TR35	Salmonella_phage	1.4e-19	22.4
WP_085951589.1\|4893725_4894070_+	hypothetical protein	NA	NA	NA	NA
WP_088903258.1\|4894073_4895663_-	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	6.1e-18	31.8

DBSCAN-SWA_335

4903714 : 4908018

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027474.1\|4903714_4904284_-	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	2.3e-12	37.6
WP_003840063.1\|4904697_4905411_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003027465.1\|4905445_4906432_-	GTP-binding protein	NA	NA	NA	NA
WP_016150668.1\|4906551_4908018_-	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	2.6e-39	30.2

DBSCAN-SWA_336

4930468 : 4931326

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027428.1\|4930468_4931326_-	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	4.4e-23	32.8

DBSCAN-SWA_337

4935236 : 4937222

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840102.1\|4935236_4937222_-	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	4.5e-10	32.6

DBSCAN-SWA_338

4942920 : 4943589

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027410.1\|4942920_4943589_+	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	4.1e-56	56.8

DBSCAN-SWA_339

4947293 : 4948814

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027396.1\|4947293_4948814_+	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	3.4e-10	32.8

DBSCAN-SWA_340

4963194 : 4963929

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903270.1\|4963194_4963929_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.2e-53	44.4

DBSCAN-SWA_341

4974694 : 4983113

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903273.1\|4974694_4975642_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.4e-22	29.2
WP_003844383.1\|4975625_4976357_+	ABC transporter permease	NA	NA	NA	NA
WP_003027354.1\|4976337_4976445_-	protein YohO	NA	NA	NA	NA
WP_049002964.1\|4976496_4977228_-	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.8e-105	93.5
WP_003027348.1\|4977453_4979139_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-281	91.6
WP_003840155.1\|4979135_4979855_+	two-component system response regulator BtsR	NA	NA	NA	NA
WP_003027346.1\|4979901_4980372_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.9e-64	76.9
WP_071697500.1\|4980414_4980873_-	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	1.0e-50	69.3
WP_003027344.1\|4981079_4983113_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.0e-54	27.6

DBSCAN-SWA_342

4988082 : 4989030

Staphylococcus_prophage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031285326.1\|4988082_4989030_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4

DBSCAN-SWA_343

4993348 : 4995761

Burkholderia_phage(50.0%)

integrase

attL 4985624:4985636|attR 4997838:4997850

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4985624:4985636	attL	NA	NA	NA	NA
WP_088903277.1\|4993348_4994920_+	DUF262 domain-containing protein	E5E3X3	Burkholderia_phage	1.4e-176	57.5
WP_008321055.1\|4995200_4995761_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5SCL7	Streptococcus_phage	1.8e-17	34.6
4997838:4997850	attR	NA	NA	NA	NA

DBSCAN-SWA_344

5000220 : 5002374

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903283.1\|5000220_5002374_+	chemotaxis protein	A0A076G6U4	Escherichia_phage	2.3e-07	73.8

DBSCAN-SWA_345

5008342 : 5012848

Serratia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060854713.1\|5008342_5009347_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	2.4e-12	28.1
WP_088903289.1\|5009343_5010621_-	MFS transporter	NA	NA	NA	NA
WP_071599139.1\|5010604_5010838_-	hypothetical protein	NA	NA	NA	NA
WP_003027312.1\|5010873_5011926_+	class I fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_044711374.1\|5011948_5012848_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.3e-12	28.6

DBSCAN-SWA_346

5016113 : 5016842

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027295.1\|5016113_5016842_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.1e-27	36.0

DBSCAN-SWA_347

5022555 : 5024274

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044711364.1\|5022555_5024274_-	ubiquinone-dependent pyruvate dehydrogenase	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.5e-30	23.8

DBSCAN-SWA_348

5036302 : 5050369

Bacillus_phage(25.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840216.1\|5036302_5038249_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.4e-40	41.8
WP_003036813.1\|5038323_5038548_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_003036810.1\|5038871_5039192_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-13	45.7
WP_003036804.1\|5039222_5041499_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.1
WP_003844346.1\|5041768_5043130_-\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.1e-204	92.9
WP_003841759.1\|5043289_5043622_-	YegP family protein	NA	NA	NA	NA
WP_003036797.1\|5043757_5044480_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	9.2e-30	32.7
WP_003844344.1\|5044476_5045880_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	5.0e-32	29.2
WP_088903291.1\|5045879_5047292_-	MFS transporter	NA	NA	NA	NA
WP_044711355.1\|5047288_5050369_-	multidrug efflux RND transporter permease subunit MdtC	S5VTK5	Leptospira_phage	9.9e-65	22.7

DBSCAN-SWA_349

5061147 : 5071786

Catovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036776.1\|5061147_5061789_+	uridine kinase	A0A1V0SAA3	Catovirus	2.2e-35	38.3
WP_003036774.1\|5061880_5062462_+	dCTP deaminase	I4AZP2	Saccharomonospora_phage	3.2e-33	43.2
WP_088903293.1\|5062488_5064342_+	outer membrane assembly protein AsmA	NA	NA	NA	NA
WP_003841782.1\|5064386_5065970_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.5e-37	44.9
WP_044711342.1\|5066626_5067766_+	polysaccharide export protein	NA	NA	NA	NA
WP_003036763.1\|5067771_5068221_+	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
WP_088903294.1\|5068217_5070380_+	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	2.9e-18	30.8
WP_003036760.1\|5070452_5071295_+	colanic acid biosynthesis glycosyltransferase WcaA	NA	NA	NA	NA
WP_003844327.1\|5071297_5071786_+	colanic acid biosynthesis acetyltransferase WcaB	A0A191KBJ5	Streptococcus_virus	1.2e-09	41.0

DBSCAN-SWA_350

5075532 : 5082269

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903297.1\|5075532_5076654_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	65.5
WP_003841801.1\|5076656_5077622_+	GDP-L-fucose synthase	M1I5W5	Acanthocystis_turfacea_Chlorella_virus	6.9e-89	51.6
WP_016150604.1\|5077624_5078104_+	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
WP_049002527.1\|5078100_5079324_+	colanic acid biosynthesis fucosyltransferase WcaI	NA	NA	NA	NA
WP_088903298.1\|5079326_5080763_+	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	2.4e-53	31.7
WP_088903299.1\|5080898_5082269_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.1e-31	26.5

DBSCAN-SWA_351

5087730 : 5091400

Klebsiella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903301.1\|5087730_5089125_+	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	4.0e-21	34.6
WP_049014367.1\|5089273_5090269_+	SDR family oxidoreductase	A0A0K1L6Z1	Scale_drop_disease_virus	5.5e-09	28.1
WP_088903302.1\|5090506_5091400_+	UTP--glucose-1-phosphate uridylyltransferase GalF	A0A127AW70	Bacillus_phage	2.8e-44	39.7

DBSCAN-SWA_352

5099240 : 5104192

Ostreococcus_lucimarinus_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088903306.1\|5099240_5100647_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	6.2e-38	28.7
WP_003030115.1\|5100845_5102012_+	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	1.5e-114	55.0
WP_088903307.1\|5102070_5103072_-	NAD-dependent epimerase	E3SLG9	Synechococcus_phage	2.4e-12	34.5
WP_001407551.1\|5103175_5104192_-\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	4.4e-187	100.0

DBSCAN-SWA_353

5111857 : 5112757

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003834191.1\|5111857_5112757_-	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_354

5120720 : 5123375

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838976.1\|5120720_5121299_+	thiosulfate reductase electron transport protein PhsB	A0A077SL61	Escherichia_phage	2.1e-21	38.0
WP_049002260.1\|5121295_5122063_+	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_049002261.1\|5122202_5123375_+	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	3.2e-197	86.7

DBSCAN-SWA_355

5143032 : 5143842

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030258.1\|5143032_5143842_+	propanediol diffusion facilitator PduF	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.7e-11	27.8

DBSCAN-SWA_356

5157336 : 5158152

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839037.1\|5157336_5158152_+	energy-coupling factor ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.5e-07	24.2

DBSCAN-SWA_357

5163121 : 5163805

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844224.1\|5163121_5163805_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-27	37.2

DBSCAN-SWA_358

5168234 : 5168450

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000250489.1\|5168234_5168450_+	AlpA family transcriptional regulator	A0A2H4J8C8	uncultured_Caudovirales_phage	6.5e-08	50.0

DBSCAN-SWA_359

5189941 : 5215158

Salmonella_phage(33.33%)

transposase,terminase,integrase

attL 5180295:5180309|attR 5203890:5203904

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5180295:5180309	attL	NA	NA	NA	NA
WP_088903335.1\|5189941_5190796_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	1.0e-80	55.7
WP_075808383.1\|5190990_5192379_+	SpnT protein	NA	NA	NA	NA
WP_088903336.1\|5192425_5193700_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	6.8e-68	38.1
WP_003030306.1\|5194088_5194853_-	DgsA anti-repressor MtfA	NA	NA	NA	NA
WP_048222627.1\|5195102_5196146_-\|integrase	tyrosine-type recombinase/integrase	A0A192Y7M7	Salmonella_phage	3.9e-98	55.5
WP_071667664.1\|5196120_5196363_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_088903337.1\|5196433_5198905_-	exonuclease	K7P6V4	Enterobacteria_phage	1.5e-111	38.5
WP_048222630.1\|5199046_5199373_-	transcriptional regulator	NA	NA	NA	NA
WP_136345438.1\|5199384_5199723_-	hypothetical protein	NA	NA	NA	NA
WP_047357951.1\|5199884_5200100_-	hypothetical protein	NA	NA	NA	NA
WP_047358007.1\|5200298_5200706_-	helix-turn-helix domain-containing protein	H6WRX4	Salmonella_phage	7.5e-29	49.2
WP_047357952.1\|5200836_5201064_+	Cro/Cl family transcriptional regulator	H6WRX5	Salmonella_phage	2.2e-30	78.7
WP_047357953.1\|5201066_5201621_+	hypothetical protein	NA	NA	NA	NA
WP_048221168.1\|5201675_5202476_+	DUF1376 domain-containing protein	A0A0U2RT81	Escherichia_phage	2.1e-59	48.4
WP_047357954.1\|5202478_5203219_+	DNA replication protein DnaC	H6WRX8	Salmonella_phage	2.7e-93	68.3
WP_048221169.1\|5203238_5203655_+	PerC family transcriptional regulator	NA	NA	NA	NA
WP_047358009.1\|5203660_5203999_+	DUF977 family protein	H6WRX9	Salmonella_phage	5.1e-15	45.7
5203890:5203904	attR	NA	NA	NA	NA
WP_047357956.1\|5204255_5205215_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
WP_032943871.1\|5205444_5205678_+	DinI family protein	K7PM44	Enterobacteria_phage	5.2e-27	72.7
WP_048221170.1\|5205721_5205967_+	hypothetical protein	H6WRY6	Salmonella_phage	1.7e-20	62.2
WP_048221172.1\|5206095_5206296_+	hypothetical protein	H6WRY8	Salmonella_phage	7.2e-17	61.5
WP_048221174.1\|5206298_5206658_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	4.0e-42	64.4
WP_031285326.1\|5207380_5208328_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-42	36.4
WP_071667708.1\|5208798_5209404_+	hypothetical protein	H9C175	Pectobacterium_phage	3.0e-82	72.0
WP_016150433.1\|5209785_5210064_+	hypothetical protein	K7PGZ9	Enterobacteria_phage	4.3e-44	95.7
WP_088903338.1\|5210035_5210584_+	lysozyme	K7PM52	Enterobacteria_phage	1.6e-95	91.2
WP_088903339.1\|5210562_5211087_+	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	1.4e-08	33.8
WP_088903340.1\|5211083_5211314_+	hypothetical protein	NA	NA	NA	NA
WP_071667536.1\|5211665_5212103_+	hypothetical protein	NA	NA	NA	NA
WP_088903408.1\|5212355_5212844_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	4.7e-78	95.1
WP_088903341.1\|5212843_5214946_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	86.6
WP_001082414.1\|5214942_5215158_+	hypothetical protein	A5LH28	Enterobacteria_phage	1.5e-25	82.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP022275

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12335 : 63357

uncultured_Caudovirales_phage(12.5%)

transposase,integrase

attL 18262:18277|attR 44437:44452

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_034039555.1\|12335_13625_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_034039553.1\|13617_15348_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_049306259.1\|16163_17384_+	hypothetical protein	NA	NA	NA	NA
WP_023443007.1\|17364_17829_+	hypothetical protein	NA	NA	NA	NA
WP_088903430.1\|17896_20587_-	AAA family ATPase	NA	NA	NA	NA
18262:18277	attL	NA	NA	NA	NA
WP_088903444.1\|21027_21585_-	transcriptional regulator	NA	NA	NA	NA
WP_088903445.1\|21630_22605_+\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	5.3e-81	49.8
WP_088903431.1\|22918_24082_+	MexC family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_027591160.1\|24097_27232_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_137922721.1\|27251_28670_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_155275771.1\|28839_28989_-	hypothetical protein	NA	NA	NA	NA
WP_032693964.1\|30240_30492_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_032693963.1\|30488_30776_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.3e-19	47.4
WP_088903433.1\|30840_31047_+	hypothetical protein	NA	NA	NA	NA
WP_001752311.1\|31861_32893_-\|transposase	IS630-like element ISEc33 family transposase	NA	NA	NA	NA
WP_088903435.1\|32978_33449_+	hypothetical protein	NA	NA	NA	NA
WP_080884174.1\|33724_34117_-	plasmid stability protein	NA	NA	NA	NA
WP_080884175.1\|34120_35095_-	StbA family protein	A0A222YXF2	Escherichia_phage	1.7e-71	43.8
WP_088903436.1\|35334_35709_-	hypothetical protein	NA	NA	NA	NA
WP_080884176.1\|35708_36341_-	ParA family protein	A0A0K1LMB9	Rhodobacter_phage	6.8e-29	39.6
WP_042078022.1\|37328_38084_-	replication initiation protein RepE	I3WF20	Macacine_betaherpesvirus	5.3e-137	96.4
WP_080884177.1\|38614_39409_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	4.0e-50	88.4
WP_080884178.1\|39405_39741_-	hypothetical protein	NA	NA	NA	NA
WP_088903437.1\|39862_40228_-	hypothetical protein	NA	NA	NA	NA
WP_004193995.1\|40709_41399_+	hypothetical protein	NA	NA	NA	NA
WP_020315560.1\|41430_42120_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_000272716.1\|42555_42804_+	hypothetical protein	NA	NA	NA	NA
WP_020805590.1\|42800_43373_+	hypothetical protein	NA	NA	NA	NA
WP_020805591.1\|43403_43898_+	hypothetical protein	NA	NA	NA	NA
WP_004197807.1\|43941_44310_+	hypothetical protein	NA	NA	NA	NA
WP_004197808.1\|44343_44547_+	hemolysin expression modulator Hha	NA	NA	NA	NA
44437:44452	attR	NA	NA	NA	NA
WP_004197809.1\|44560_44764_+	hypothetical protein	NA	NA	NA	NA
WP_000427623.1\|44945_45950_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_003100881.1\|46028_48995_-\|transposase	Tn3-like element ISPa38 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.2
WP_001247892.1\|49069_49360_+	nucleotidyltransferase	NA	NA	NA	NA
WP_001293886.1\|49356_49758_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_000215515.1\|49747_50104_+	cupin domain-containing protein	NA	NA	NA	NA
WP_000091613.1\|50358_50673_+	hypothetical protein	NA	NA	NA	NA
WP_004194048.1\|51099_52281_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.9e-120	64.2
WP_000509966.1\|52940_53546_-	DNA resolvase	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
WP_023307208.1\|53640_56538_+\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	5.5e-182	37.8
WP_088903438.1\|56534_57158_-	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	4.0e-21	34.8
WP_020314631.1\|57592_57823_-	hypothetical protein	NA	NA	NA	NA
WP_020314635.1\|58026_58272_+	DinI-like family protein	Q7Y3V9	Yersinia_phage	1.1e-08	39.3
WP_046960466.1\|58268_58718_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.3e-31	52.0
WP_020314652.1\|58729_60004_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	1.3e-148	60.7
WP_020314634.1\|60186_60414_-	hypothetical protein	NA	NA	NA	NA
WP_022644718.1\|60458_61085_-	ParA family protein	A0A2H4EW66	Aeromonas_phage	4.5e-25	34.4
WP_088903439.1\|61989_62508_+	hypothetical protein	NA	NA	NA	NA
WP_032635043.1\|62760_63357_+	recombinase family protein	A0A219YA40	Aeromonas_phage	1.8e-23	37.2

DBSCAN-SWA_2

70840 : 80437

Enterobacteria_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020314642.1\|70840_71461_+	resolvase	A0A219Y912	Aeromonas_phage	1.0e-08	31.0
WP_088903441.1\|71480_71744_+	hypothetical protein	NA	NA	NA	NA
WP_020314639.1\|71868_72822_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	9.5e-75	57.1
WP_020804876.1\|72818_73430_-	DUF2913 family protein	NA	NA	NA	NA
WP_020314648.1\|73747_74026_-	hypothetical protein	NA	NA	NA	NA
WP_088903446.1\|74063_74405_-	restriction endonuclease	NA	NA	NA	NA
WP_001143760.1\|74451_77457_-\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	100.0
WP_001217881.1\|77619_78177_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.0e-93	98.4
WP_013213985.1\|78299_79280_+\|transposase	IS481-like element ISKpn27 family transposase	A8RHK4	Spiroplasma_virus	2.9e-10	27.4
WP_004199234.1\|79555_80437_+	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022274

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP022273

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP022275

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection