CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP022394	Corynebacterium glutamicum strain WM001 chromosome, complete genome	3 crisprs	WYL,cas3,csa3,cas9,DEDDh,PrimPol,DinG,RT	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP022394_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022394_1

91171-91264

Orphan

Consensus_repeat	Method
AGTTTTCGGTCACCTAGTTTGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022394_1

>merge|NZ_CP022394|1|91171-91264|CRISPRCasFinder
AGTTTTCGGTCACCTAGTTTGGTTTCCAACCCGCCAAACCAAACTATTTGACCGAAAATTCCCCCGGAGGCAGTTTTCGGTCACCTAGTTTGGT

>NZ_CP022394|1|1|91171-91264|CRISPRCasFinder
AGTTTTCGGTCACCTAGTTTGGT	TTCCAACCCGCCAAACCAAACTATTTGACCGAAAATTCCCCCGGAGGC
AGTTTTCGGTCACCTAGTTTGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022394.1\|WP_060563909.1\|85942_87346_+\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP022394.1\|WP_060563919.1\|93582_94635_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP022394.1\|WP_075348479.1\|94635_96213_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NZ_CP022394.1\|WP_075348084.1\|84494_84779_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022394.1\|WP_075348083.1\|81362_81611_+\|glutaredoxin-family-protein	unknown	unknown	gnl\|CDD\|368604
NZ_CP022394.1\|WP_060563917.1\|92308_93469_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP022394.1\|WP_060563900.1\|81696_83091_+\|glutamyl-tRNA-reductase	unknown	unknown	gnl\|CDD\|234592
NZ_CP022394.1\|WP_065532538.1\|87369_89226_+\|dehydroshikimate-dehydratase-QsuB	unknown	unknown	gnl\|CDD\|225726
NZ_CP022394.1\|WP_060563912.1\|90579_90855_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|223300
NZ_CP022394.1\|WP_060563925.1\|100372_101392_+\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|236450
NZ_CP022394.1\|WP_003860437.1\|89722_90574_+\|quinate/shikimate-dehydrogenase-(NAD+)	unknown	unknown	gnl\|CDD\|172521
NZ_CP022394.1\|WP_059288679.1\|96289_97369_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270265
NZ_CP022394.1\|WP_075348086.1\|99855_100284_+\|DUF3806-domain-containing-protein	unknown	unknown	gnl\|CDD\|372263
NZ_CP022394.1\|WP_060563903.1\|83092_84001_+\|hydroxymethylbilane-synthase	unknown	unknown	gnl\|CDD\|223259
NZ_CP022394.1\|WP_065366623.1\|98042_99839_+\|bifunctional-uroporphyrinogen-III-C-methyltransferase/uroporphyrinogen-III-synthase	unknown	unknown	gnl\|CDD\|224503
NZ_CP022394.1\|WP_060563907.1\|84782_85667_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP022394.1\|WP_060563926.1\|101421_102006_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022394.1\|WP_040966933.1\|89271_89709_+\|type-II-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|237270
NZ_CP022394.1\|WP_060563914.1\|91496_92306_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022394.1\|WP_003855576.1\|102046_102559_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP022394.1\|WP_060563909.1\|85942_87346_+\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.06473e-158
NZ_CP022394.1\|WP_060563919.1\|93582_94635_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	5.01221e-128
NZ_CP022394.1\|WP_075348479.1\|94635_96213_-\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	2.08141e-102
NZ_CP022394.1\|WP_060563925.1\|100372_101392_+\|porphobilinogen-synthase	gnl\|CDD\|236450	PRK09283, PRK09283, porphobilinogen synthase.	0
NZ_CP022394.1\|WP_075348083.1\|81362_81611_+\|glutaredoxin-family-protein	gnl\|CDD\|368604	pfam05768, DUF836, Glutaredoxin-like domain (DUF836). These proteins are related to the pfam00462 family.	1.36745e-13
NZ_CP022394.1\|WP_065532538.1\|87369_89226_+\|dehydroshikimate-dehydratase-QsuB	gnl\|CDD\|225726	COG3185, COG3185, 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only].	2.75007e-132
NZ_CP022394.1\|WP_060563900.1\|81696_83091_+\|glutamyl-tRNA-reductase	gnl\|CDD\|234592	PRK00045, hemA, glutamyl-tRNA reductase; Reviewed.	7.50526e-158
NZ_CP022394.1\|WP_060563917.1\|92308_93469_+\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.34545e-26
NZ_CP022394.1\|WP_060563912.1\|90579_90855_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|223300	COG0222, RplL, Ribosomal protein L7/L12 [Translation, ribosomal structure and biogenesis].	1.24501e-15
NZ_CP022394.1\|WP_003860437.1\|89722_90574_+\|quinate/shikimate-dehydrogenase-(NAD+)	gnl\|CDD\|172521	PRK14027, PRK14027, quinate/shikimate dehydrogenase (NAD+).	0
NZ_CP022394.1\|WP_059288679.1\|96289_97369_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270265	cd13547, PBP2_Fbp_like_2, Substrate binding domain of an uncharacterized ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic domain (Fbp) has high affinity for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.33674e-102
NZ_CP022394.1\|WP_075348086.1\|99855_100284_+\|DUF3806-domain-containing-protein	gnl\|CDD\|372263	pfam12713, DUF3806, Domain of unknown function (DUF3806). This family represent the C-terminal domain of the structure. In two related Bacteroides species the gene lies immediately upstream from a putative ATP binding component of an ATP transporter and a putative histidinol phosphatase. The structure of this domain is strikingly similar to the N-terminal structure of 1ma7 whose C-terminal domain is a phage integrase, pfam00589.	5.71885e-22
NZ_CP022394.1\|WP_060563903.1\|83092_84001_+\|hydroxymethylbilane-synthase	gnl\|CDD\|223259	COG0181, HemC, Porphobilinogen deaminase [Coenzyme metabolism].	4.14818e-132
NZ_CP022394.1\|WP_065366623.1\|98042_99839_+\|bifunctional-uroporphyrinogen-III-C-methyltransferase/uroporphyrinogen-III-synthase	gnl\|CDD\|224503	COG1587, HemD, Uroporphyrinogen-III synthase [Coenzyme metabolism].	3.97466e-65
NZ_CP022394.1\|WP_060563907.1\|84782_85667_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.03883e-33
NZ_CP022394.1\|WP_040966933.1\|89271_89709_+\|type-II-3-dehydroquinate-dehydratase	gnl\|CDD\|237270	PRK13015, PRK13015, 3-dehydroquinate dehydratase; Reviewed.	8.40157e-84

>NZ_CP022394.1|WP_060563912.1|90579_90855_-|50S-ribosomal-protein-L7/L12
MFGRKDVNLSALEARVAALERRLAEQDRIIAQLGGDSSTPLSLQRPQSGLHPDVVALLQQGKKIAAIKRHRELTGAGLKEAKETVEASRFY
>NZ_CP022394.1|WP_003860437.1|89722_90574_+|quinate/shikimate-dehydrogenase-(NAD+)
MNDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSRASGQDLKTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIDANGHTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLDTSRAQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNATPMGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETELLKAARALGCETLDGTRMAIHQAVDAFRLFTGLEPDVSRMRETFLSL
>NZ_CP022394.1|WP_040966933.1|89271_89709_+|type-II-3-dehydroquinate-dehydratase
MPGKILLLNGPNLNMLGKREPDIYGHDTLEDVVALATAEAAKHGLEVEALQSNHEGELIDALHNARGTHIGCVINPGGLTHTSVALLDAVKASELPTVEVHISNPHAREEFRHHSYISLAAVSVIAGAGIQGYRFAVDILANLQK
>NZ_CP022394.1|WP_065532538.1|87369_89226_+|dehydroshikimate-dehydratase-QsuB
MRTSIATVCLSGTLAEKLRAAADAGFDGVEIFEQDLVVSPHSAEQIRQRAQDLELTLDLFQPFRDFEGVEEEQFLKNLHRLEEKFKLMNRLGIEMILLCSNVGTATINDDDLFVEQLHRAADLAEKYNVKIAYEALAWGKFVNDFEHAHALVEKVNHKALGTCLDTFHILSRGWETDEVENIPAEKIFFVQLADAPKLSMDILSWSRHHRVFPGEGDFDLVKFMVHLAKTGYDGPISLEIFNDSFRKAEVGRTAIDGLRSLRWLEDQTWHALNAEDRPSALELRALPEVAEPEGVDFIEIATGRLGETIRVLHQLGFRLGGHHCSKQDYQVWTQGDVRIVVCDRGATGAPTTISAMGFDTPDPEAAHARAELLRAQTIDRPHIEGEVDLKGVYAPDGVELFFAGPSPDGMPEWLPEFGVEKQEAGLIEAIDHVNFAQPWQHFDEAVLFYTALMALETVREDEFPSPIGLVRNQVMRSPNDAVRLLLSVAPEDGEQGDFLNAAYPEHIALATADIVAVAERARKRGLDFLPVPENYYDDVQARFDLPQEFLDTLKENHLLYDRDENGEFLHFYTRTLGTLFFEVVERRGGFAGWGETNAPVRLAAQYREVRDLERGIPN
>NZ_CP022394.1|WP_060563909.1|85942_87346_+|MHS-family-MFS-transporter
MSEQLQGVTHSESTPGKTPKRAALSSWIGSALEYYDFAVYGTAAALVLNHLFFPADTSPGIAILAAMGTVGVAYVVRPLGALIMGPLGDRYGRKFVLMLCLFLIGASTFAVGCLPTFDQVGYLAPALLVLCRVIQGLSASGEQSSAISVSLEHADERHRAFTASWTLHGTQFGTLLATGVFIPFTLFLSEDALMSWGWRVPFWLSAAVVLVAFLIRRGLEEPPAFHENKEAVAGAASPLAMTLRYHKAAVVRVAIAAMINSVNIVFTVWALSFATNIVGLDRSTVLLVPVVANLVALIAIPLSGMLADRIGRRPVFIMGAIGGGLAMNGYLGAIYSGNWTMIFFMGVLMSGLLYSMGNAVWPAFYAEMFPTSVRVTGLALGTQIGFAVSGGFVPVIASALAGDQGDQWMKVSIFVGVVCVISALVAMTAKETKALTLDEIDALHTARGEAADLAAASKASEAQLAAQ
>NZ_CP022394.1|WP_060563907.1|84782_85667_-|LysR-family-transcriptional-regulator
MHLNQLEFFIAVAQHGQINRAAEDLLISQPALSRQISALEKSVGAPLFERHSRGVSLTKAGEILHEEALRTLSRMQSVVDEIQSGEHLITSINIGVPPGIPIDWLRCQLIDLGPETRISLIESPTDDQLKLLKQRELDIALCRRQSEAFATTLVHEQELGIVVRKNSELHQKVAGKDNATLFDLEGLRVLAHSRGEVRIQEEILKNAMLAAGVNATWIFRKFGQYSSLIADLVQADVALTTEESARTNFPSWQWVPIEGEDASGNDLVVRTWITWNPQPTPAVKALIQKFIDGN
>NZ_CP022394.1|WP_075348084.1|84494_84779_+|hypothetical-protein
MRIPRKAIRNIQVVDNVISSVDRPIKRAGRLRIPGVFVAGTHAYVNETLSENEFSMCRKNEPGLVIELENISIDRIVISTPDAHRYADELMAAV
>NZ_CP022394.1|WP_060563903.1|83092_84001_+|hydroxymethylbilane-synthase
MTLKIGTRGSKLATTQAGTIRDQLKHYGRDAELHIVTTPGDVNMSPVERIGVGVFTQALRDVLHSGDCDVAVHSMKDLPTAADPRFHLVVPTRADSREALIARDGLTLAELPEGAKVGTSAPRRISQLKVIRPDLEILPLRGNIDTRMGKVTSGELDAVMLAYAGLTRVGMQDRATEVFDADIIMPAPAQGALAIECRADDTETVRALNMLMHADTFVSAVAERTVLNRLEAGCTAPVAAHATLDGYSGDTMTLTAGVYALDGSDQLVFSAEGDGARPEELGELVAQQLIDAGAANLLGDRS
>NZ_CP022394.1|WP_060563900.1|81696_83091_+|glutamyl-tRNA-reductase
MVSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSEALIVSTCNRLEVYTVTSSFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAIDDAGASMVSFAVDRALVQMGLDPEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISNLIMANRTLERAERLAEHSLEAGVPAEVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIPEGASLMLVDLSMPRDIDDACADLPGVDLVNIERLHKASREGGSGMAPSEEEALAIVREELDSFTSEQRIRDIVPAVSALRRQAASVGSDELDRLRQRAPGISEVEWGEVEKTVRRVVDKLLHEPTVRVKELAARSGSISYDSALQELFGLESLASTAAPATTSVNASELPDAGIVAFVNAPSATQTRE
>NZ_CP022394.1|WP_075348083.1|81362_81611_+|glutaredoxin-family-protein
MGATMGHSVEIIVRDNCGSCVRVKAQILSIVEAAGIKLTERNVDQDASLKLEFGDRVPVILVDDEEFACWEVDNDELANALL
>NZ_CP022394.1|WP_060563914.1|91496_92306_+|hypothetical-protein
MSIPFSVLQDYLDLISPEALPQIPQPPAPAPTAPQLPPAPDPHSIEWPIFPPDRISANGRRYYEPQTRLEFMRIYTTLPHGYRQPFLKANNIGHCTVRTWLAAISTFSRLPHAFDDAHRFGIERTTPVDDVTTLTADDKRDLVIGYLAQPHGQGQQFLTFYQLRKHTIMAWCAAMTDGDLDADVYPRKIGLMTTRTVVEIVRLRHMIAQQLERATIMENEYLKEIAALKKELAHYKQKDHQNQMVIDILGKAIGTRPNPGEGLDEEDAT
>NZ_CP022394.1|WP_060563917.1|92308_93469_+|IS3-family-transposase
MDEQRAFDQGLKEENTLITDLTTCARLSHNKALRLIKLSKSTAYYRNKPRPCPAPKPVLQAVAAPTAPGVEPTPEPWQGKEPAVSSVRQALAEHERQFIVDAITAYPQLSVSGVFNMLFNKGIYRASLRTWWRVAKQHKLLHKDRVSALSPGKRSPTPRVKPRLEATQPGQVVCWDVTFLPSLVRGKTYALHLAIDLFSRKIVGAKVAPTENTSTAVELLTQVLADNPGVVTVHSDNGSAMTSTRVRRLLADHGVALSLIRPRVSDDNAFVESVFHTLKYRPFYPKVFASMDQARVWVEEFVVYYNTVHPHSGVAGHTPQSVFDGSWRAAHRLRVQALDAHYRQFPQRYVGRPVVQEVAGVVRLNGARDDGSVQERVGGVASLLSA
>NZ_CP022394.1|WP_060563919.1|93582_94635_-|ABC-transporter-ATP-binding-protein
MSSIKLRDLSVSFRDGTFGLLDINLKIEPEEFVVLIGPSGSGKTTMLRTIAGFAEPTSGSVLIGGEDMTHVPPERRRMGMVFQQHAVWPHMSVAKNVGYPLARSGQKGASISKRVERTLALVGLEGFGSRKPASLSGGQRQRVALARAIIADPTVLLLDEALSALDEPLRDALRRELVSLTRREGLTTVHVTHDRAEAISIADRIVVLGNGRIQQVATPTELLSAPATADVARFIIDATVLNGIVRNGRVMCPDLDTSWDLDAVQAIDDIFDGDLVDIAIPPHSVGIGPAHHPDYIFAEITSVLFQVTSYSVTAKTQSGHSFRMSITCSVPEIGETIGLSIDNPMVYRAD
>NZ_CP022394.1|WP_075348479.1|94635_96213_-|iron-ABC-transporter-permease
MRLGVWLIVAGLFITPLALVVGLALGGNQFPALWDSGLGKALWNSAYTTVLSAVGATIIGTIMALTLDRTDVFGRTALRLFLLSPLLIPPFIGAIAWLQLFGKNQGINRFFGTEVWDIYGADGVTFLLIVHSYPTVYIIVSAALRQLPSDLEQAARIAGADTFTVLRTITLPLLKPALLSAFTLTAVANLADFGIPALLGSPARFETLATMIYRFMESGTVSNPLQVVSTIGIVLLFLGIAAVTADYLVSLYAASKLQDAGTPHRFTLNKSRIPVSLITWIIALIITAAPLLGLAYRALLPAPGVPFNLDNITLNNFEAALSNPRVIEGFSNSLMLSLGAALICGVLGWLIGVLITRTQHFANVPLTLTVLLPTALPGMIIGVGWLILGRYTGIYNTPWVILGAYVCAFTALVVQAVRGPLSQAPEAIEEAARISGAGRLRSIMDTTGAMAIPAAFAGAVLVAVTAVRELTVSILLIAPGTTTLGVQVFNLQQAGNYNQASALSLMFAIIGIVALALTVRSQKEF
>NZ_CP022394.1|WP_059288679.1|96289_97369_-|ABC-transporter-substrate-binding-protein
MSSKHPLKRTAVTVFALGASAALLVACSEPSEDVSTAETTTASSSANASDAAGEKVTITVYTSEPEEKVDEINKAFMEANPDIEVEVYRAGTGDLTARIEAEKASGSIEADVLWAADAATFETYAAQGDLAELEDVDTSDIIEEALDAENFYVGTRIIPTVIAYNTEVVDQAELPTSWADLTDPKYAGQLVMPDPAVSGAAAFNASVWKNDPALGEAWITALGENQPMIAQSNGPTSQEIAGGGHPVGIVVDYLVRDLAAAGSPIDTIYASEGSPYITEPAGVFADSEKKEAAERYINFLLSVEGQEIAVEQAYLPVREDVGTPEGTPELADIELMTPDLEVVTADKAAAVEFFQNAMN
>NZ_CP022394.1|WP_065366623.1|98042_99839_+|bifunctional-uroporphyrinogen-III-C-methyltransferase/uroporphyrinogen-III-synthase
MTIAHKPEMAETTGIETNQVSETIGVESLTHGNLRPVSSFEGQHEGQTEELLPGKVIFVGAGPGNPDLLTVRAREVLGNAVRAITDEQVLSGVRAFVATEIPVPEDKLQAAEDEYERICIEAKENGARRKPPRPAPPTAAEITEVSEATPAQIVELVQDALSYGGDVIRLVTGNPLSSDATLAEISAVSEAGLEFQVVPGMSLPGTVPAFAGIALGSTYTETDVNGQDLDWDQLASAPQPLVLQARVDDLSRIAQELKARNMSLETPVSVTVNGTTRLQRTYDTTLGLLHKLDAELSGPLVVTLGKGVDDRSKYSWWENRALYGWRVLVPRPREQAASMSARLSSHGAIPQEVPTISVEPPRNPAQMERAIKGIVEGRYQWVVLTSVNAVKAVWEKITEFGLDSRSFAGVRIAAVGEKTAAEIRALGITPELLPARTRQNAQGLVDVFPEYFEELDPVGRVLLPRADIATDVLVDGLTHLGWEVEDVVAYRTVRAAPPSADIRDMIKTGGFDAVAFTSSSTVKNLVGIAGKPHPRTIVACIGPMTAATAEELGLRVDVMPEIAEVPELIDALAEHVADLRAKGELPPPRKKRRRRKAS
>NZ_CP022394.1|WP_075348086.1|99855_100284_+|DUF3806-domain-containing-protein
MLSMDIQQLDAETTAWKDSLLRAAQEAGFHFEPPKFFEDFETMVEQYKQAAASDPDIDVTDIQQMWGIVVGEYLREKMGMEWVVITDDYGTDLAILATAPNGDHVYSCPIIVVGKRFSTDYEPGQLEFFCNQFMVTSLAQLQ
>NZ_CP022394.1|WP_060563925.1|100372_101392_+|porphobilinogen-synthase
MSTSSDYSHALIRRPRRLRANPAMRELVAETALRPADLILPMFFADGIAEAREISSMPGVYQHTEDSLLRAAHEALDAGVRCVDLFGVPVDAAKDFNGSEAWSETGVLNRALSSLRKEFGDDLLIMADTCLDEFTDHGHCGVVTEDRHGNAIVDNDATLPLYQQMAVAQARAGAHIVSPSGMMDGQIAAIRAALDEEGYQDVAIMAYSAKYASAFFGPFREAVGSSLQGDRRTYQQDPANLRESLLEAELDIAEGADFIMVKPALPYLDVLTRIADTSPVPVAAYQVSGEYAMIQAAGRNGWVDLDAVMMESLTSIKRAGANQILTYFAVNAARALRNA
>NZ_CP022394.1|WP_060563926.1|101421_102006_+|hypothetical-protein
MSMLPNLTPKKSAPPSSSASAKNPGEKKEDTVKLLIQMWAVMIGLELLHQILNVVMSFTDPTALRTVAKEQAAAQGLSDGIVNATVIAAILVMGFFNLIVIAILSWMVVMVKNRSKRLPTAFLLLTIFSFFFILRVLMLFFASPGGTDVPMALFAIDGCVQILVGVSAGVAYALSRTEQPVKMLTDYAPEDAKR
>NZ_CP022394.1|WP_003855576.1|102046_102559_+|hypothetical-protein
MPSMFPSPATGGDDINRRPLNEPNADATTIPTALKVVFWMLFATAAFMIFTGLVMYTAGYTGPDDVDESYKAVVVNNQEFIGGINAFAGIVIAALTSQLPKGGKNPRRLLLAIMLLVLLTDLLSFATRAGGFALAIIAVLLALEALLMFRPAVNDHIDRNHMARVMNREK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022394_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022394_2

2432067-2432152

Orphan

Consensus_repeat	Method
AGGTGGCTTTTAGAGGGACCGACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022394_2

>merge|NZ_CP022394|2|2432067-2432152|CRISPRCasFinder
AGGTGGCTTTTAGAGGGACCGACTTACCCATCGCCCGCGTCACTCATGACCGAACTCAAAGAAGGTGGCTTTTAGAGGGACCGGCT

>NZ_CP022394|2|2|2432067-2432152|CRISPRCasFinder
AGGTGGCTTTTAGAGGGACCGACT	TACCCATCGCCCGCGTCACTCATGACCGAACTCAAAGA
AGGTGGCTTTTAGAGGGACCGGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022394.1\|WP_003853711.1\|2424616_2424997_+\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|183613
NZ_CP022394.1\|WP_003853699.1\|2427908_2428121_-\|DUF3263-domain-containing-protein	unknown	unknown	gnl\|CDD\|378688
NZ_CP022394.1\|WP_003853704.1\|2426038_2427169_-\|glutamate--cysteine-ligase	unknown	unknown	gnl\|CDD\|237408
NZ_CP022394.1\|WP_075348530.1\|2438436_2439825_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022394.1\|WP_060565238.1\|2432436_2433633_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP022394.1\|WP_011015344.1\|2436033_2436804_-\|ABC-transporter-permease	unknown	unknown	unknown
NZ_CP022394.1\|WP_003862894.1\|2428136_2428718_+\|peptide-deformylase	unknown	unknown	gnl\|CDD\|237227
NZ_CP022394.1\|WP_081299886.1\|2443704_2444910_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP022394.1\|WP_034983209.1\|2435189_2436032_-\|PhzF-family-phenazine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|223461
NZ_CP022394.1\|WP_089158598.1\|2425432_2426032_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP022394.1\|WP_089158599.1\|2439825_2440860_+\|glutamate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270408
NZ_CP022394.1\|WP_060565236.1\|2428707_2429715_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP022394.1\|WP_060565527.1\|2436784_2437717_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213235
NZ_CP022394.1\|WP_003853702.1\|2427237_2427903_-\|LytR-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|379163
NZ_CP022394.1\|WP_003853692.1\|2429741_2430533_+\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197320
NZ_CP022394.1\|WP_011015349.1\|2440849_2443318_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|319004
NZ_CP022394.1\|WP_060565237.1\|2430539_2432042_+\|cardiolipin-synthase-A	unknown	unknown	gnl\|CDD\|234967
NZ_CP022394.1\|WP_060565239.1\|2434026_2435193_+\|Na/Pi-cotransporter-family-protein	unknown	unknown	gnl\|CDD\|224202
NZ_CP022394.1\|WP_074492444.1\|2437738_2438242_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239217
NZ_CP022394.1\|WP_003862899.1\|2424340_2424616_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|181179

Protein	Function_ID	Function_description	E-value
NZ_CP022394.1\|WP_003853711.1\|2424616_2424997_+\|cation:proton-antiporter	gnl\|CDD\|183613	PRK12592, PRK12592, putative monovalent cation/H+ antiporter subunit G; Reviewed.	2.61795e-74
NZ_CP022394.1\|WP_003853699.1\|2427908_2428121_-\|DUF3263-domain-containing-protein	gnl\|CDD\|378688	pfam11662, DUF3263, Protein of unknown function (DUF3263). This family of proteins with unknown function appears to be restricted to Actinobacteria.	3.49121e-25
NZ_CP022394.1\|WP_003853704.1\|2426038_2427169_-\|glutamate--cysteine-ligase	gnl\|CDD\|237408	PRK13517, PRK13517, glutamate--cysteine ligase.	0
NZ_CP022394.1\|WP_060565238.1\|2432436_2433633_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.30364e-100
NZ_CP022394.1\|WP_081299886.1\|2443704_2444910_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.77403e-138
NZ_CP022394.1\|WP_003862894.1\|2428136_2428718_+\|peptide-deformylase	gnl\|CDD\|237227	PRK12846, PRK12846, peptide deformylase; Reviewed.	6.52209e-77
NZ_CP022394.1\|WP_034983209.1\|2435189_2436032_-\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	8.50827e-101
NZ_CP022394.1\|WP_089158598.1\|2425432_2426032_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.35942e-06
NZ_CP022394.1\|WP_089158599.1\|2439825_2440860_+\|glutamate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270408	cd13690, PBP2_GluB, Substrate binding domain of ABC glutamate transporter; the type 2 periplasmic binding protein fold. This group includes periplasmic glutamate-binding domain GluB from Corynebacterium efficiens and its related proteins. The GluB domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.89773e-75
NZ_CP022394.1\|WP_060565236.1\|2428707_2429715_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.68058e-10
NZ_CP022394.1\|WP_060565527.1\|2436784_2437717_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213235	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter. The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.	1.28038e-94
NZ_CP022394.1\|WP_003853702.1\|2427237_2427903_-\|LytR-C-terminal-domain-containing-protein	gnl\|CDD\|379163	pfam13399, LytR_C, LytR cell envelope-related transcriptional attenuator. This family appears at the C-terminus of members of the LytR_cpsA_psr, pfam03816, family.	0.0014775
NZ_CP022394.1\|WP_003853692.1\|2429741_2430533_+\|exodeoxyribonuclease-III	gnl\|CDD\|197320	cd09086, ExoIII-like_AP-endo, Escherichia coli exonuclease III (ExoIII) and Neisseria meningitides NExo-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases. This subfamily includes Escherichia coli ExoIII, Neisseria meningitides NExo,and related proteins. These are ExoIII family AP endonucleases and they belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER, the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiencies. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity. For example, Neisseria meningitides Nape and NExo, and exonuclease III (ExoIII) and endonuclease IV (EndoIV) in Escherichia coli. NExo and ExoIII are found in this subfamily. NExo is the non-dominant AP endonuclease. It exhibits strong 3'-5' exonuclease and 3'-deoxyribose phosphodiesterase activities. Escherichia coli ExoIII is an active AP endonuclease, and in addition, it exhibits double strand (ds)-specific 3'-5' exonuclease, exonucleolytic RNase H, 3'-phosphomonoesterase and 3'-phosphodiesterase activities, all catalyzed by a single active site. Class II AP endonucleases have been classified into two families, designated ExoIII and EndoIV, based on their homology to the Escherichia coli enzymes ExoIII and endonuclease IV (EndoIV). This subfamily belongs to the ExoIII family; the EndoIV family belongs to a different superfamily.	1.12558e-104
NZ_CP022394.1\|WP_011015349.1\|2440849_2443318_+\|serine/threonine-protein-kinase	gnl\|CDD\|319004	pfam16918, PknG_TPR, Protein kinase G tetratricopeptide repeat. This domain is found at the C-terminus of protein kinase G and contains a tetratricopeptide repeat (TPR).	3.85826e-95
NZ_CP022394.1\|WP_060565237.1\|2430539_2432042_+\|cardiolipin-synthase-A	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	4.27935e-117
NZ_CP022394.1\|WP_060565239.1\|2434026_2435193_+\|Na/Pi-cotransporter-family-protein	gnl\|CDD\|224202	COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism].	4.15863e-96
NZ_CP022394.1\|WP_074492444.1\|2437738_2438242_-\|NUDIX-hydrolase	gnl\|CDD\|239217	cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzymes. Substrate specificity is used to define child families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. This superfamily consists of at least nine families: IPP (isopentenyl diphosphate) isomerase, ADP ribose pyrophosphatase, mutT pyrophosphohydrolase, coenzyme-A pyrophosphatase, MTH1-7,8-dihydro-8-oxoguanine-triphosphatase, diadenosine tetraphosphate hydrolase, NADH pyrophosphatase, GDP-mannose hydrolase and the c-terminal portion of the mutY adenine glycosylase.	4.6603e-16
NZ_CP022394.1\|WP_003862899.1\|2424340_2424616_+\|hypothetical-protein	gnl\|CDD\|181179	PRK07948, PRK07948, putative monovalent cation/H+ antiporter subunit F; Reviewed.	4.78942e-38

>NZ_CP022394.1|WP_060565237.1|2430539_2432042_+|cardiolipin-synthase-A
MIFQINLESWQTVGLIIDYTIKIIAIGYVPEGRRPSSSTAWLLAILLLPYVGLPLFLLMGSPYINRRRHRIQQEINDLIEDVHDDVPDIPTGMDVSAEVESVIKLNRRLTRMPAVTGGNNGFYSDYRESLKRMTAAIDEAEEYIYVEIYIMAWDSCTQPFFAALERAHNRGVQVRLLFDHVGSWKYPGYHRLKKELNRMGFAWYLMLPLQPWRRRFRRPDLRNHRKMLIIDGHTAFMGSQNLIAPSYLQKKNIKLGREWKDLMVELTGPIVSSMEMIFAGDWYVESNEALDIRDHAEAHGYIGNTQKDSATNLVQLIPSGPGYTTEPNLRMFNSIVHHAKERLILCSPYFIPDESLLEAVTSACYRGVTVELFVSEQADQFAIDHAQSSYYQALLEAGVKIYQFPKPDVLHTKYMIADPDDTTGNEALGVLGSSNLDIRSFGLNYEISLMIAKGNLIHELNALTDRYRTVSLKLTLDKWNQRSWRRRYVDNVMRLTSALQ
>NZ_CP022394.1|WP_003853692.1|2429741_2430533_+|exodeoxyribonuclease-III
MRIVNWNVNSARTRVDRMVDFLLRHDVDVLAVQETKCKDEQFPTERFTEIGYEVAHFGLNQWNGVAIISRVGIENVETHFPAQPGFNKDITKEQSIEARAIGARCGGVQVWSLYVPNGREIADPHYDYKLRWLFSLRNYVIDTLEYRPEEKLVLLGDFNIAPTDIDVWDIAAFEGKTHVTEPERAAFDGLIEAGLKETTPGPGTYTYWDYKGARFLKGEGMRIDFQLASPALAATAGETFVDVEERSGTGASDHAPVIVDYKV
>NZ_CP022394.1|WP_060565236.1|2428707_2429715_+|GNAT-family-N-acetyltransferase
MTPSLPRFRSQKPAVGDRVVARRRIPGANVHWTDAIGHVIGVDPLVVRPQSVGGMPSDAEEIVIPDDQLEVIKILSPRTIRNSDIRAVEVATAKAFPGLVNEWHDGWLLRAGDGIAERSNSASPLGPSVGFEPVPMEDISRFYARHDLPVKLHIPERIGRPAQKVIDADPQKWVMGPEILVMTKSLDHVESHELPGGLEFSVDKQPDQEWLGMYHFRGQALPAHALELLRTQIEGRMGFGRLTTPAGQTVAITRATITAAEERIFLGYSAVEVDPAFRRQGLGTALGSRIQEWGAEQHAQEAYLQVVAHNEAGIGLYQKLGFSEHHRHRYAERKF
>NZ_CP022394.1|WP_003862894.1|2428136_2428718_+|peptide-deformylase
MTVRPIVIHGDPVLHNPTQLVTEDVSELQELIADMYETMDVANGVGLAANQIGVSKRIFVYDCPDDEGVMHKGCFINPVLETSEIPETMPADDGSDEEGCLSVPGEGFPTGRAHWAKVTGLNEKGEEVSVEAEGFLARCFQHEVGHLDGFLYTDVLIGRWKRMAKKAIKANGWTEPGLTWMPGEDEDPFGHDA
>NZ_CP022394.1|WP_003853699.1|2427908_2428121_-|DUF3263-domain-containing-protein
MLSADDLTLLEFEAHAPHAIGAKEEAIRATFGISPVRYYQRLNVIIDTPEAMKVNPTLVSRLRRRAGKID
>NZ_CP022394.1|WP_003853702.1|2427237_2427903_-|LytR-C-terminal-domain-containing-protein
MTSDMQNSPQHSATPSEEKQGGLPMRGLAMILIAVAVLLAAWALWSMQGKDDTSTTSAGQTQSTETNAGTIAESSGSSDSEQASAEPGTSEETSAEQPAADGEAANAAGTAAAGGASSANGNSTPVNTLYVLNNSTVPQLAARVADSLSGDYQKVESGNLPDTIIPQNTVYFTAGNTEAEKAARELADRVSGVAMERSDALPTETEGKDALVLVLVQDVAL
>NZ_CP022394.1|WP_003853704.1|2426038_2427169_-|glutamate--cysteine-ligase
MGIEFKRSPRPTLGVEWEIALVDPETRDLAPRAAEILEIVAKNHPEVHLEREFLQNTVELVTGVCDTVPEAVAELSHDLDALKEAADSLGLRLWTSGSHPFSDFRENPVSEKGSYDEIIARTQYWGNQMLIWGIHVHVGISHEDRVWPIINALLTNYPHLLALSASSPAWDGLDTGYASNRTMLYQQLPTAGLPYQFQSWDEWCSYMADQDKSGVINHTGSMHFDIRPASKWGTIEVRVADSTSNLRELSAIVALTHCLVVHYDRMIDAGEELPSLQQWHVSENKWRAARYGLDAEIIISRDTDEAMVQDELRRLVAQLMPLANELGCARELELVLEILERGGGYERQRRVFKETGSWKAAVDLACDELNDLKALD
>NZ_CP022394.1|WP_089158598.1|2425432_2426032_-|alpha/beta-hydrolase
MVESQHIIFIPESQQTPDEFTEVVNEIPAGIKPRIVPWSGSVSAGVQAVESILDREEIRRVILVGAGTGAGVALEIAKNQPRRVERLVLDSPLMTFDEKQLKGMSTALKMMPGFFFRKKNKKDLLQQVEEARTAVPMGFSEITMPTLIIRGSAAKAGIDSDLEKQIPSARATTIIGANWLTYTTHGRQTGAAIAEFLAQ
>NZ_CP022394.1|WP_003853711.1|2424616_2424997_+|cation:proton-antiporter
MTLQLFTDIVSLVFILSGAFLSFSASIGLIRFKDTMSRVHAMTKPQTTGLILTVVGAIIRILGHEHFDQSQRSDLGVLVLLVLFALLTSPVTAQRVGRVSRREGLYGAKDDMSDNQAPAELKPKKS
>NZ_CP022394.1|WP_003862899.1|2424340_2424616_+|hypothetical-protein
MDNTLYTAGLTIAAAFFMLSFIFTIYRIIVGPNSIDRLLGLDGTVSMIQCSMATYICWTLDTTVTNFMMVIALLGFISSVSVARFRKRDGA
>NZ_CP022394.1|WP_060565238.1|2432436_2433633_-|multidrug-effflux-MFS-transporter
MQKKQQLSTALIMGLALLSASSALATDMYLPAMPGIAEDLGTTAPMVQLTLSSFMAGMAIGQLIIGPLSDQLGRKGLLVAGAVAALVASVVCALAPSISVLVIARLVQGLGGGACVVIARAIVPDLERGQKAAHAFALLMIIQGIAPVVAPLIGGVLVGPFGWRGIFWALALVNFAQLLVALLQIKESKPVEERTAAGLGGMLSNYVFVLKNPQFLAYVFTLGLSFGAMFSYISASPFVLQNQMGIPVLLYSIIFGVNAFGLIVGGMVNRRLLQRIHPHRIMQTVLASFTVLCALLLIEVLFINWIPLFLVLLFLIVSHIPMVMANATALGTEVVRSRAGSGSAILGFVQFTMGALVSSLVGLGSDKALTMGIAMTACALLACGCAYLAGRKGIPEMK
>NZ_CP022394.1|WP_060565239.1|2434026_2435193_+|Na/Pi-cotransporter-family-protein
MLLSGWGKFVRWLLVLLSILVIIIGINLILDGVYGFGTFSTTQMYQVAKDPLIGVLIGILATALVQSSTTTTTLTVTAVGTGIVSVPVAIPIILGANIGTTITAMLVAFSYVGERREFKRAFTVAAMHVWFNVLVILVLFVVELLFHPFRTISGAIATEITLTTGGSLPTSDVMTKIFDPPTQLLGMNGLIGSIGNPSISAIVCLVVGTILILISVRAMSSQIRTITAATVTSIMDKVINPENSPKATILSNFWSFILGVLFTLMVTASSVTVASMQPVAVSGVVKQKPLLGVILGANVGTTVTAMFATFAIVSDQGEFAIQAALIHLIVNFTGALLVLCIPQLANVIIHLAEKTANLTARSYSITLATIVTAYVLVPSAVLMIYFFI
>NZ_CP022394.1|WP_034983209.1|2435189_2436032_-|PhzF-family-phenazine-biosynthesis-protein
MPSKISRPYYQVDVFSSEPFMGNPLAVIADADDLSAEQMARIARWTNLSETTFLLKPTQEGADYRVRIFTPTGELPFAGHPTLGTAHVFRELHGEQGTQLVQECVAGLVAVRAIDGPASGLAFQAPPTLKDGPLDASDLDAACEALGISPDFIRAHQWVDNGPGWAVVELPSAQHVLDLEPDFSAHPTLKLGVIGAYPEGAPHAFEVRAFAPGIGEDPVTGSLNASIAQWLHRDGRAGEGYLASQGTAIGRAGEIHISIESHVIWVGGSVTTIFQGTAEF
>NZ_CP022394.1|WP_011015344.1|2436033_2436804_-|ABC-transporter-permease
MWTTMINTIRSEWTKLVTTKSFWWTTALILVFSLGYAALTGSLATGESFASLFLLAGSTVTGLYLLGFVVIMIQSIMMFTTEFRFGYQTQTFLATPKRWVVAVSKWLLYLVFAVVLTFITVILCFYLAKALASDTASSTLVVWEDTQARRIMWQYPLAAALLVTFCSGIALLLRQTAGAVALVLMWHFAIENLLSFLPRIGEYVGKYGPFTNLYAFITDYQSIDPGWSTTMGAVYFGAWAFVLFALGIVVLEKKDA
>NZ_CP022394.1|WP_060565527.1|2436784_2437717_-|ABC-transporter-ATP-binding-protein
MINVEGLTKQYGQVRAVDDLSFEVKPGIVTGFLGPNGAGKSTTMRLILGLDNPTAGHATIEGQPYRSLKNPLTKVGALLDAKATHPNRTAENHLKWIARANGLSTKRVDEVLTLVGLTGVASKKTGGFSLGMGQRLGLAAALLGDPEYLILDEPVNGLDPEGIHWVRTLLQNIAKQGRTVLVSSHLLSEMAQTAEHLIVIGRGKLVADMPMHEFVRSHSASTVVVRAAVPGALESALKEAGVAFNTAPDESGRMTYRIDGSTTDDIGRLAFERGIALLELSETRASLEEAFLETTGEAVQYQAGSVDNND
>NZ_CP022394.1|WP_074492444.1|2437738_2438242_-|NUDIX-hydrolase
MDTMKGDGDGWAAAPNGGAVWGKNGAAGLLLVADKQMLMQHRAAWTNNGDTWALPGGARDSHETAAESALREAFEETGILPDDVEVLDSIVTAGPFPADPERPELAGNWTYTTVIARTKTGETLETTANEESLELRWVDIAAVDSLALMPAFAKAWPSLRKLLNTTE
>NZ_CP022394.1|WP_075348530.1|2438436_2439825_+|hypothetical-protein
MDTDDSSDHWLDPLTEKDTSKRTLVNSIVQETFGQPIFVARKIWAFVNTSPGRMTLMTIIISIAIFAAGYAMSVSSDTRQSNLDDLITNAEPVSYNAHVLYTSLAVADTTATTGFVQAGVEGPVNRVKYHTAIDRAAVAATHTAASADSSNEHLMELVLEIQRQLPVYTGLVETARTNNRAGNPVGVAYMSEASAMMRNEILPMASELYNLTSRAVSDQQRSVTGPQWFPLSGLLAALAMLVVAQWWLMRITRRRINKGFALATVMMMTATLWVSAANWATWQAGTKGFEEASGPLNSMTTARIYAQQTRTTETLSLVRRQSIQGSGTGFTATINQIKRALDEYETTAQSQTPEHQQLITAIRNAIAAWTADHDEFTVLLASGEYNGAVSAVLNKDEEGQTSFDELDTALAELIADSRSSMRSYIQSGLQATELVSVMVMLLSVVSVLALWVGIRPRLQEYL
>NZ_CP022394.1|WP_089158599.1|2439825_2440860_+|glutamate-ABC-transporter-substrate-binding-protein
MHAFRRPPPLTTRVGAALLAATLLASCTPTPVEPAETLTALDPDAGPPLPPDSSIEAPGEKEPIVEAIENWPGSLRPDDLTPEERVPGIVNRGRIIVGVDQSQNLLSFRDPVTGELRGFEVELAREISRDIFGDPNKVDFRFVGSSDRLRSLDQGDVDIVIRSVTITDERAKLVEFSTPYLRTQTRMLTMESSGITSIADLPGHTICVTDGSTSLQRARTIAPEASILKTRNWSDCLMALQQHQAQVILGDDVILSGIAAQDPYTEILDTFLDSHSYGVAAASTTAETDSSGLIRQVNYTIERIRTDRMWWTMFDDWFGPYLWSYGPPQLQYMPEEEGTENDEG
>NZ_CP022394.1|WP_011015349.1|2440849_2443318_+|serine/threonine-protein-kinase
MKDNEDFDPDSPATEAVAFNPFDDDDEDDSPATSAVAFNPFEDDDDDDEFQGEGLEFLLRDLDNLRATQGQMVVEQPAVEDSLGSASAHTETTAASLRPRPEVDPSERSRRQAISLFRERRRVRRQSRPVADGMVELPFITPKPEDELLIDPEKKRKPGVAAPQLVAGDIVAEQYEVLGVIAHGGMGWIYLANDRNVSGRIVVLKGMMAQSSVQDQGTAEAEREFLADITHPGIVKAYNFIDDPRVPGGFIVMEYVNGPSLKDRCKAQPDGVLRVDLAIGYILELLPAMDYLHQRGVVYNDLKPENVIATEDQVKLIDLGAVTGIGAFGYIYGTKGFQAPEVATHGPSISSDIFTIGRTLAALTMPLPVEDGVLAPGIPSPKNSPLLRRHLSFYRLLQRATADDPQHRFRNVSELRTQLYGVLREILAVRDGKQYPPQHSLFSPQRSTFGTKHLVFRTDRIIDGIERQARITAPEIVSALPVPLIDRTDPGARMLSGSSYAEPSETLETLRNSMEDEQYRQSIEIPLGVVRALLDLGFTTEARQWLETLEGRIGDDWRHKWFSGITYLLLDDYATAQVFFNHVLTILPGEAAPKLALAAVDELILQQIGAESTAYLTPDIVSATATLSKDFEDLDASAFESLSDTWSHISSDPHVVRFHSLRLYALVWATNPTTVSSAFGLARQLMAENQIELAVQALDKLPQSSTHYRMATLTTILLLVSSNLSESRIRRAARRLTEIPTNEPRFNQIKIAIMSAGLSWLRERKLKASASANPLFEYPFSQKGLRTGISEALRIQARSAPFPHHRYALVDMANAVRPLSWF
>NZ_CP022394.1|WP_081299886.1|2443704_2444910_-|IS30-family-transposase
MGPYYGPRTLHQVLREDYTTLFNELSSLGLPAQVCGALLHLTQRPSLRFSYMSCVVPLFADEIKVVGQGTRLSLEEKMMIQRFHDTGVSAAEIGRRLGRCRQTISRELRRGQDDDGCYRARDSYEGAIRKLARPKTPKLDANRRLRAVVVEALNKKLSPEQISGLLATEHANDSSMQISHETIYQALYVQGKGALRDELKVEKFLRTGRKGRKPQSKLPSRGKPWVEGALISQRPAEVDDRAVPGHWEGDLVIGGENQATALVTLVERTSRLTLIKRLGVNHEASTVTDALVEMMGDLPQALRRSLTWDQGVEMAEHARFSVVTKCPVFFCDPHSPWQRGSNENTNGLVRDFFPKGTNFAKVSDEEVQRAQDLLNYRPRKMHGFKSAAQVYEKIVVGASTD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP022394_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP022394_3

3207845-3207940

Orphan

Consensus_repeat	Method
TGCGTGGGCAGTGTGGTTTGGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP022394_3

>merge|NZ_CP022394|3|3207845-3207940|CRISPRCasFinder
TGCGTGGGCAGTGTGGTTTGGTTTTGGGGGCTCGGAACCGGTCACAGATGCCCACGATTGCGGTTTTTCCGTTGCGTGGGCAGTGTGGTTTGGTCT

>NZ_CP022394|3|3|3207845-3207940|CRISPRCasFinder
TGCGTGGGCAGTGTGGTTTGGTTT	TGGGGGCTCGGAACCGGTCACAGATGCCCACGATTGCGGTTTTTCCGT
TGCGTGGGCAGTGTGGTTTGGTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP022394.1\|WP_060563676.1\|3205762_3206506_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
NZ_CP022394.1\|WP_065366576.1\|3212465_3213599_+\|TadA-family-conjugal-transfer-associated-ATPase	unknown	unknown	gnl\|CDD\|200328
NZ_CP022394.1\|WP_040966841.1\|3203243_3203927_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP022394.1\|WP_060563668.1\|3199597_3200542_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
NZ_CP022394.1\|WP_003855827.1\|3214955_3215156_+\|DUF4244-domain-containing-protein	unknown	unknown	gnl\|CDD\|379429
NZ_CP022394.1\|WP_074493244.1\|3202322_3203168_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293836
NZ_CP022394.1\|WP_060563673.1\|3204419_3205202_+\|endonuclease-III	unknown	unknown	gnl\|CDD\|223255
NZ_CP022394.1\|WP_003863295.1\|3208360_3209356_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP022394.1\|WP_060563685.1\|3213583_3214360_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP022394.1\|WP_060563675.1\|3205209_3205770_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP022394.1\|WP_060563678.1\|3209370_3209922_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377816
NZ_CP022394.1\|WP_060563671.1\|3200534_3201731_+\|glutaryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173840
NZ_CP022394.1\|WP_003863306.1\|3204188_3204374_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022394.1\|WP_003863293.1\|3210086_3210929_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP022394.1\|WP_060563686.1\|3214356_3214932_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP022394.1\|WP_060563687.1\|3215159_3215480_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP022394.1\|WP_065532532.1\|3211407_3212469_+\|septum-site-determining-protein	unknown	unknown	gnl\|CDD\|274798
NZ_CP022394.1\|WP_060563688.1\|3215502_3215802_+\|flp-pilus-assembly-TadE/G-like-family-protein	unknown	unknown	gnl\|CDD\|274799
NZ_CP022394.1\|WP_060563677.1\|3206596_3207793_+\|MarP-family-serine-protease	unknown	unknown	gnl\|CDD\|367140
NZ_CP022394.1\|WP_003863309.1\|3201752_3202226_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534

Protein	Function_ID	Function_description	E-value
NZ_CP022394.1\|WP_060563676.1\|3205762_3206506_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	4.08015e-53
NZ_CP022394.1\|WP_065366576.1\|3212465_3213599_+\|TadA-family-conjugal-transfer-associated-ATPase	gnl\|CDD\|200328	TIGR03819, heli_sec_ATPase, helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.	5.58238e-154
NZ_CP022394.1\|WP_040966841.1\|3203243_3203927_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	8.3036e-56
NZ_CP022394.1\|WP_060563668.1\|3199597_3200542_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	5.19928e-87
NZ_CP022394.1\|WP_003855827.1\|3214955_3215156_+\|DUF4244-domain-containing-protein	gnl\|CDD\|379429	pfam14029, DUF4244, Protein of unknown function (DUF4244). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 66 and 95 amino acids in length. There is a conserved EYA sequence motif.	1.21917e-15
NZ_CP022394.1\|WP_074493244.1\|3202322_3203168_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293836	cd16278, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.91342e-64
NZ_CP022394.1\|WP_060563673.1\|3204419_3205202_+\|endonuclease-III	gnl\|CDD\|223255	COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair].	7.82099e-107
NZ_CP022394.1\|WP_003863295.1\|3208360_3209356_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.10411e-22
NZ_CP022394.1\|WP_060563685.1\|3213583_3214360_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	2.72284e-66
NZ_CP022394.1\|WP_060563675.1\|3205209_3205770_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	4.38626e-22
NZ_CP022394.1\|WP_060563678.1\|3209370_3209922_-\|phage-holin-family-protein	gnl\|CDD\|377816	pfam07332, Phage_holin_3_6, Putative Actinobacterial Holin-X, holin superfamily III. Phage_holin_3_6 is a family of small hydrophobic proteins with two or three transmembrane domains of the Hol-X family. Holin proteins are produced by double-stranded DNA bacteriophages that use an endolysin-holin strategy to achieve lysis of their hosts. The endolysins are peptidoglycan-degrading enzymes that are usually accumulated in the cytosol until access to the cell wall substrate is provided by the holin membrane lesion.	9.48535e-32
NZ_CP022394.1\|WP_060563671.1\|3200534_3201731_+\|glutaryl-CoA-dehydrogenase	gnl\|CDD\|173840	cd01151, GCD, Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.	2.05892e-107
NZ_CP022394.1\|WP_003863293.1\|3210086_3210929_-\|HAD-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.05942e-74
NZ_CP022394.1\|WP_060563686.1\|3214356_3214932_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	1.60236e-14
NZ_CP022394.1\|WP_065532532.1\|3211407_3212469_+\|septum-site-determining-protein	gnl\|CDD\|274798	TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein. Members of this protein family belong to the MinD/ParA family of P-loop NTPases, and in particular show homology to the CpaE family of pilus assembly proteins (see ). Nearly all members are found, not only in a gene context consistent with pilus biogenesis or a pilus-like secretion apparatus, but also near a DEAD/DEAH-box helicase, suggesting an involvement in DNA transfer activity. The model describes a clade restricted to the Actinobacteria.	4.52424e-91
NZ_CP022394.1\|WP_060563688.1\|3215502_3215802_+\|flp-pilus-assembly-TadE/G-like-family-protein	gnl\|CDD\|274799	TIGR03816, tadE_like_DECH, helicase/secretion neighborhood TadE-like protein. Members of this small, highly hydrophobic protein family occur in a pilus/secretion-like region that usually is next to an uncharacterized DEAH-box helicase, in Actinobacteria. Members show sequence similarity to the TadE-like family described by pfam07811. The function is unknown. [Unknown function, General].	2.11014e-07
NZ_CP022394.1\|WP_060563677.1\|3206596_3207793_+\|MarP-family-serine-protease	gnl\|CDD\|367140	pfam02674, Colicin_V, Colicin V production protein. Colicin V production protein is required in E. Coli for colicin V production from plasmid pColV-K30. This protein is coded for in the purF operon.	2.02474e-18
NZ_CP022394.1\|WP_003863309.1\|3201752_3202226_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	1.47997e-80

>NZ_CP022394.1|WP_060563677.1|3206596_3207793_+|MarP-family-serine-protease
MLSPSLVVDAVIVLVMAFALWGGWRQGAFTSLLSTVGVVSGLVVGAAAAPFVMGLTDSTALRFLLAIGTVVLLVGLGNLIGAHLGAAIRDNIKFRSSRTLDSGLGAIFQVLATLIVVWLVAIPLATGLPGTVASGIRDSRILGFVDKYTPQGLDTLPSKIAAMLSESGLPPLISPFAGGSSVEVDAPEINVTNVDLVEAMRPSVIHVMGDAQECSRRLMGSGFVASPDYVVTNAHVVAGTSTVSLDTMIGTRSAEVVFYDPNLDIAVLYSPDLGLDPLPWASTPLDTGDEAIVMGFPQSGPFNASPARVRERIMITGSNIYANGQHEREAYSVRGSIQSGNSGGPMTNEMGEVVGVVFGAAIDGSDTGYVLTAEEVQERIGDITALTQPVDTMQCAVS
>NZ_CP022394.1|WP_060563676.1|3205762_3206506_+|CoA-pyrophosphatase
MRNYPDLPHDFPGQNTELTPAKAPVWMHRLLDRIHTGRMANPLDGAETLGDTDSEKRAAVLMLFSGSETSFDLPNDASVLLTHRTPTMRSHAGQIAFPGGRIDPTDTNAVDCAFREAWEETGLDRRTATPLAQLNEVHIRATGYPVYPIIGHWHTPSPVAVASPHETDEVFDAPLYDLIDPKNRLMVGWREWHGPAFRINDYIIWGFTGGLLSAILDTAGWATEWDTDRIFDLENTLSTSRNNERMR
>NZ_CP022394.1|WP_060563675.1|3205209_3205770_+|TlpA-family-protein-disulfide-reductase
MTSSAKWSIVGVVAILAVIVALIPQLVGGESAEEAQGETSTSKITTRPDCVASGAAGVDLPCLGGANGAGNELATVVNLWAWWCEPCRAELPIFDEFATTHPELNVIGVHADQNAANGAALLEDLGVNLASYQDDSNLFAGTLGLPGVVPITIVVSPDGNVVDTFPQPFETIDDLETAVAGALQNA
>NZ_CP022394.1|WP_060563673.1|3204419_3205202_+|endonuclease-III
MGSITPQKRPRVGSHIANKGQETDIGRKRRARRINRTLTVAYPDAHCELDFTNPLELTVATILSAQCTDVRVNQVTPALFKRYPTAADYANADRTELEEFIRPTGFYRNKAASLIGLGEALISLHDGQVPGTLEQLVELPGVGRKTANVVLGNAFGVPGITVDTHFGRLVRRLKLTDEEDPVKVEKVMNELIEKPEWTMFSHRLIFHGRRICHSRRAACGACMLAADCPSFGLEGPSDPFEAQKLIKSDDREHLLKMAGM
>NZ_CP022394.1|WP_003863306.1|3204188_3204374_-|hypothetical-protein
MTGLLVVIIPLLLMLFAFAMERIESSFLHSNAPQNTEVKLAKDAVGAENLNEDDVQEASAA
>NZ_CP022394.1|WP_040966841.1|3203243_3203927_-|Crp/Fnr-family-transcriptional-regulator
MEGVQDILSRAGIFQGVDPTAVNNLIQDMETVRFPRGATIFDEGEPGDRLYIITSGKVKLARHAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSAVCVTEVHAATMNSDMLRNWVADHPAIAEQLLRVLARRLRRTNASLADLIFTDVPGRVAKTLLQLANRFGTQEAGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRGWIRLEGKSVLIVDTEHLARRAR
>NZ_CP022394.1|WP_074493244.1|3202322_3203168_+|MBL-fold-metallo-hydrolase
MTKLERMEHPAYSQLRPVTPSASVVLCPNPGYSSLEGTNSWVIRAPEDPRSIVIDPGPEDEGHLNVLHSKAEEVGLILLTHRHHDHADGAQRFRQLTNAPVRAMDPSYCAGAEEIHDGEIITIDGVTPQIEVVATPGHTRDSVSYFIWSGVPHESTLEGIVSGDTIAGRHTTMISETDGDLGEYLNSLAILEERGKDIPLLPGHGPDGQDVASFARKYIERRELRLNQIREVWETRGRDVSMKDLIDAIYDDVDPVLRGAAEQSTHVAIRYLQAQEASASN
>NZ_CP022394.1|WP_003863309.1|3201752_3202226_+|MaoC-family-dehydratase
MTTSTTPNTIVSFEDAPTLTGQDLGFSQWRTVTQEMVNTFADATDDQQWIHTDPERAKDGPFGGAIAHGFLTLSMIIPFWGELLDVTGVTTKVNYGLDKVRFTSPVKVGSRIRMGAVVREISEVKGNGLHLVADGTIEIEGQERPAVVATFLTRFYA
>NZ_CP022394.1|WP_060563671.1|3200534_3201731_+|glutaryl-CoA-dehydrogenase
MRDPIQGAVIPSDLFGFAEVLTEAERAVLLETRRVLEEEVKPYINEAWDKAVFPNAIMQPLQDLQLLDPPALREAGESVRDIFTGFRNFELARCDINVGTYYNASAGLFRTACMVGGSAEQAQRLDAQIKSGEVKGVFALTEPDHGSDIAGGLATTATKDADTGEWIINGEKRWIGGASTADLIATFARDTADNQVKCFLVAPKAEGVSMEIIDRKASLRIMQNAHITYNNVRVSEDARLHNINSFKDVSECLRRMRSDVAWMAVGAQAGAYEAAVKYVRSREQFGRPIAGFQLIQEKLALMLGNLTASLGMMVKLTEQQQAGIFKEENSALAKMFTSLKLRETVGWAREICGGNGIILDNDVARFHADAEAVYSYEGTHEINALIVGRAITGVSAFI
>NZ_CP022394.1|WP_060563668.1|3199597_3200542_+|amidohydrolase
MSNNVVKYECAVDADNIVAVDMHVHLEVDSCGHESMPADIMEASSKYFKAAERTPSADAIADIYREHKMAAVVFTIDARTQMGHLPNSIDDLVASCARNNDVLIPFGSVDPRTGEDALVEARRQVEELGVRGFKFHPSVQGFDPSAPEFYPLWELLESFGLPCVFHTGQNGMGAGLPGGRGIKLRFSNPLLLDDVAADFPNLTIIMAHPSVPWQDEANSIATHKANVFIDLSGWSPKYFPESLVRQSNNVLSKKVLFGTDFPLITPEKWLAAFANLPLKDEVRPGILKDNAVKVLGLAASTERGSQAEKAVQHA
>NZ_CP022394.1|WP_003863295.1|3208360_3209356_-|alpha/beta-hydrolase
MAFFSFSTSPLTRLIPGSRSKATGAKRRLSSTIASIERSPGIIALDGPFTHDHVSVRGIRLHLAEAGSPTNPLVLLIHGAFGGWYDYREVIGPLADAGFHVAAIDLRGYGMSDKPPTGYDLRHAAGELSSVIAALGHDDALLVGSDTGASIAWAIASMYPERVRGLISLGAIHPLDMRRAIRRKPHLHVSDLSRLAPFRLPSFLHNLFHFGITSEARREIVNNTSSSYQRSNAFTETVLLRKKALSIDHTITPIIRTNRYLVGSIPSKTVSAPVWLLRTNTRRWEHLANTARTRTTGPFTTIAIPGGYELPYLENPSEFAATIAEFARTTF
>NZ_CP022394.1|WP_060563678.1|3209370_3209922_-|phage-holin-family-protein
MSNKDGLFTDGSSTFAPKVDSIPLSDVDTSVSGEASIGTLISNATSQMSSLFRAEVELAKTELAGEAKKAAIGGGAFSVAGVIALYSSFFFFFFVAALLSEWIKPWAAFLIVFLFMLVIAAALALFGWRKVKKMGAPKNTIQSVNQLKNLVPGQASEKLEKANKRGLYTSASFHSPGAITGNH
>NZ_CP022394.1|WP_003863293.1|3210086_3210929_-|HAD-family-hydrolase
MKHPDPAQKVEGTTATTPTKVAAFFDLDKTIIAMSSTYAYGREFMNSGLISPVEALQLSLAQATYMFAGHTSEQMDNTRDQLTAMIRGWEVQQVRSIAEETMHSVVTPTIYAEARELIEHHQELGHDVIIISASVKELVEPIARELGVHKTVTTVLEAHDGMYTGEVLFYCKGDAKAQSILDLAEANNYDLSLSFAYSDSFTDLPMLEAVGNPAAVNPDRALKKIALEQGWKILSFKNPEPLFQMPSTRDVGIGTGVVAGIAAVAAGSIWWMKRARRGSA
>NZ_CP022394.1|WP_065532532.1|3211407_3212469_+|septum-site-determining-protein
MNTITHQAILIAVEDPVLHPEAMHVAAATGRPVIETTNLMDISRHFHRASAVLIDASMASQLSPGKRRDRVFLLDSDPGPSDWKTAMKIHAEQAMLLPAQAGELLSALGRDDKQLPVASGHVIGVAGVVGGTGASTFAAALAKRRAESATTVLIDADPSSGGIDLLLGIEDVPGARWPDVGLRRGTVQAADVLKALPSTPDEVVVLSTARSNVLDPFALSESDVSAAIDCFLSADRSVDVVVDLPHARVHPDIAERLSHLVLVIPAEVRAVAAARARYMELQQLHVSITCVLRHRGWSGLDVAEVEEILGADITAEIGSIQRLAKSVEMHGLTGSLPRVLSSACDAVLGEVAA
>NZ_CP022394.1|WP_065366576.1|3212465_3213599_+|TadA-family-conjugal-transfer-associated-ATPase
MTDIDLVVENVQRIIATKETPPTSAEIASLIREQAGVISNEDIVMVLRRLRSDSVGVGPLESLLALPGVTDVLVNAHDSVWIDRGQGVEKVDMDLGSEEAVRRLATRLALTCGRRLDDAQPFADGRITRDDGSVLRIHAVLAPLAESGTCISVRVLRQARLSLDDLINSGTVPEDIAPALRNIINQRRSFLVVGGTGTGKTTLLSAMLTEVPADQRIICIEDTAELHPGHPSTINLVSRQANVEGAGAVSMADLLKQSLRMRPDRIVVGEIRGAEVVDLLAAMNTGHDGGAGTIHANSISEVPARMEALAATGGLDRMALHSQLAAAVDIVLVMKHTPFGRRLAQLGVLRGNPVTTQVVWDLDHGMHEGSEEAWFMP
>NZ_CP022394.1|WP_060563685.1|3213583_3214360_+|type-II-secretion-system-F-family-protein
MVYALGLLSVAVLISGSRGPGARTRPPTPGNGVHLFALIALFCLATVLFIVVEAYTMIAGIIIATTLFWYLRQTHAAAQRTKQSLQLASFLSLCAGNLRAGVTMVDAMDYALDNTTPDKFLSPTLQTAARQARSGGSGPRVLIDASLPDLQRLGHLWETSERHGIPLVALIDQMRSRISSKQRHGESTRAALQGPQATAVILTVLPLAGLLMGTAMGANPLGLLTGGGIGGFLLVIGVGLDAAGFVVTHKILQSASPS
>NZ_CP022394.1|WP_060563686.1|3214356_3214932_+|type-II-secretion-system-F-family-protein
MITALVIAAVAMFIGSPNPGVRGGLISPKSGKSLRIRAGPKKLGNADPVDVSADIELFSACLDAGLNTRDAAQVVAHVAAKTHRELWTHVVALLSIGVSAPQAFALMAGVDGLDELANLATVSHRSGSALSDGCRNISTSLLASAGDKRTAAAERAGVFIALPLALCFLPAFMIVGLAPVVLSLGTQLINF
>NZ_CP022394.1|WP_003855827.1|3214955_3215156_+|DUF4244-domain-containing-protein
MSNNLELLRLRTRAILAQDDGLTTVEYALGTLAAAALAAVLYMVVNSDAVSSAFESIISDALSARP
>NZ_CP022394.1|WP_060563687.1|3215159_3215480_+|hypothetical-protein
MRTKQQREPPELCSDDGSVSIEAALALSSLVIVCGLIIAAMATLAAYLAAVDAAGAAARAHAIGESFEPARGHVDMQEAGGMLTATATIPAPIGQVSASAVFPVEN
>NZ_CP022394.1|WP_060563688.1|3215502_3215802_+|flp-pilus-assembly-TadE/G-like-family-protein
MTIASAGVASILISLLVALAWQAGNLVAREQAQVAADVSAVAGAYAFARGELPDAACATAKHTAEANNAQLENCATEGEDLTLTVTVRGQEAHAKAGPL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

19104 : 33364

Lactobacillus_phage(28.57%)

transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060563823.1\|19104_20013_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_060563825.1\|20291_21479_+	hypothetical protein	NA	NA	NA	NA
WP_065532535.1\|21513_24741_+	glycosyltransferase	A0A1V0SAE6	Catovirus	8.9e-32	28.3
WP_060563829.1\|24999_25197_-\|transposase	transposase	NA	NA	NA	NA
WP_060563542.1\|25331_26642_-\|transposase	ISL3-like element IS13869 family transposase	A0A2H4PDF8	Mycobacterium_phage	2.5e-86	44.2
WP_060563833.1\|27178_27490_+\|transposase	transposase	NA	NA	NA	NA
WP_081299820.1\|27486_28086_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	4.5e-14	28.6
WP_152024168.1\|28063_29265_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	1.2e-26	30.5
WP_075348078.1\|29323_29503_-\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	2.4e-08	49.1
WP_065366609.1\|29642_30122_+	hypothetical protein	NA	NA	NA	NA
WP_075348475.1\|30322_31732_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.1e-45	29.2
WP_075348476.1\|31923_32802_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	9.4e-45	39.9
WP_075348080.1\|32791_33364_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA

DBSCAN-SWA_2

2700642 : 2758300

Streptococcus_phage(13.33%)

integrase,transposase

attL 2721436:2721451|attR 2755409:2755424

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040968032.1\|2700642_2700933_+\|transposase	transposase	NA	NA	NA	NA
WP_040968033.1\|2701476_2701683_+	hypothetical protein	NA	NA	NA	NA
WP_065532601.1\|2701958_2703521_-	hypothetical protein	NA	NA	NA	NA
WP_003860174.1\|2704305_2704932_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.9e-23	36.4
WP_011013963.1\|2705281_2705641_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_046552205.1\|2705640_2706237_+	cadmium transporter	NA	NA	NA	NA
WP_003859023.1\|2706495_2707917_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-44	30.0
WP_003859021.1\|2708015_2708405_+	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_060565376.1\|2708895_2709606_-\|transposase	IS6-like element ISCef5 family transposase	A0A077SL39	Escherichia_phage	3.6e-79	59.8
WP_003862073.1\|2709709_2710021_-	hypothetical protein	NA	NA	NA	NA
WP_040968043.1\|2710017_2710260_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_003862071.1\|2710496_2711798_-	APC family permease	NA	NA	NA	NA
WP_060565377.1\|2711863_2713345_-	multicopper oxidase family protein	NA	NA	NA	NA
WP_003862069.1\|2713341_2713608_-	hypothetical protein	NA	NA	NA	NA
WP_157676154.1\|2714319_2714826_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q8W6R2	Burkholderia_virus	1.2e-39	54.2
WP_157676156.1\|2714861_2715071_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_075348431.1\|2715156_2715897_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_011015535.1\|2716052_2716289_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_011015536.1\|2716494_2716812_+	hypothetical protein	NA	NA	NA	NA
WP_060565379.1\|2717455_2719333_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.0e-105	37.2
WP_003861174.1\|2720540_2720915_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.5e-12	38.7
WP_060565381.1\|2721100_2721307_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
2721436:2721451	attL	NA	NA	NA	NA
WP_011015541.1\|2721479_2722826_+	MFS transporter	NA	NA	NA	NA
WP_003861180.1\|2722785_2722968_-	hypothetical protein	NA	NA	NA	NA
WP_075348434.1\|2722978_2723581_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_060565382.1\|2723787_2725320_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-88	42.3
WP_003855068.1\|2725927_2726380_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_060565383.1\|2726436_2727114_-	single-stranded DNA-binding protein	A0A1P8D5R5	Corynebacterium_phage	2.9e-49	52.7
WP_003855074.1\|2727150_2727438_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_003861194.1\|2727797_2727989_-	hypothetical protein	NA	NA	NA	NA
WP_060565384.1\|2729491_2731654_-	penicillin-binding protein	NA	NA	NA	NA
WP_060565385.1\|2731745_2732138_-	hypothetical protein	NA	NA	NA	NA
WP_003855083.1\|2732329_2732803_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011015549.1\|2732830_2733775_+	universal stress protein	NA	NA	NA	NA
WP_003861203.1\|2733806_2734304_+	hypothetical protein	NA	NA	NA	NA
WP_038586445.1\|2734371_2734695_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_060565387.1\|2734715_2735654_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_060565388.1\|2735701_2736967_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_003855103.1\|2736963_2737656_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-38	43.1
WP_060565535.1\|2737659_2739498_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003855107.1\|2739864_2740956_+	inositol-3-phosphate synthase	A0A0H4IPK5	Stenotrophomonas_phage	8.6e-72	42.4
WP_075348539.1\|2741031_2741586_-	hypothetical protein	NA	NA	NA	NA
WP_060565390.1\|2741651_2743139_-	DUF1846 domain-containing protein	NA	NA	NA	NA
WP_006285365.1\|2743507_2743921_+	hypothetical protein	NA	NA	NA	NA
WP_006285366.1\|2744097_2745003_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	3.4e-13	27.5
WP_081299886.1\|2745316_2746522_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-31	32.7
WP_060565391.1\|2747030_2747528_-	DNA starvation/stationary phase protection protein Dps	NA	NA	NA	NA
WP_075348438.1\|2747673_2748489_+	Fpg/Nei family DNA glycosylase	NA	NA	NA	NA
WP_060565393.1\|2748725_2749877_+	RtcB family protein	A0A0M5M6X2	Mycobacterium_phage	1.4e-136	63.2
WP_003855120.1\|2749883_2750360_-	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.0e-16	42.7
WP_075348439.1\|2750374_2751388_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_060565394.1\|2751545_2752469_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011898098.1\|2752772_2753951_+	MFS transporter	NA	NA	NA	NA
WP_038586475.1\|2754226_2755405_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_065532602.1\|2755535_2756909_+	hypothetical protein	NA	NA	NA	NA
2755409:2755424	attR	NA	NA	NA	NA
WP_034983522.1\|2756989_2758300_+\|transposase	ISL3-like element IS31831 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.0e-82	42.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP022394

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection